Conserved Protein Domain Family
AhaC

?
TIGR02923: AhaC 
ATP synthase A1, C subunit
The A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The C subunit is part of the hydrophilic A1 "stalk" complex (AhaABCDEFG), which is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex.
Statistics
?
PSSM-Id: 274352
View PSSM: TIGR02923
Aligned: 6 rows
Threshold Bit Score: 443.81
Threshold Setting Gi: 55232444
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAF30598       44 ETAPFAYVNARVRSMESRLLKDHKINELIESaGTTELIGFLED-TDYGPYLSEVLGQSEDPVVVEKALDIHLAHVYQTLA 122 Methanococcus ...
Q60184         22 GSSNYAYAVTRVRAMKSKLLPKESYPRLLNM-GIDEITRFIQE-SEYKNDVDELAMKYSGGDLAEHALNRNLALTYDKLV 99  Methanosarcina...
O29103          9 NRAAWAYIVARTKVMKSRLLKPEDFRKLLNM-EFDEIVRYIGE-TEYKKEIDELGYKFTGPRLLDHALYANLARTYRKLI 86  Archaeoglobus ...
vng:rrnAC3157  10 QGSNYEYVIARVRARSASLFDDDDYRKLVRM-GTGEIARFMEE-TEYETEMNALGSRYDGVDLVEYALNRNLAKHFDDLL 87  Haloarcula mar...
Q5JDR9         30 KYTPYSYPNARVRAMEAKLLTEQRFNELAESrTLQNFVASLED-TDYKETLSNV--SSYSVEEIERALDASLAKTYELMF 106 Thermococcus k...
O27038         45 DLFPFAYPNARVRARIGRLLNEKQLSEILETeSMEEFKNYLRGlPDYAKYIDRF--------PIEKALESQLAETYEMVS 116 Methanothermob...
CAF30598      123 NISPDGARKILKLLEKKFDVKNIKTLLRAKYVGLDAEETFKLLIPLGTIPESKLRELSETKEIEEIVSALDGTGYSGVLS 202 Methanococcus ...
Q60184        100 RITSGELNYLIVAYLKRYDIWNIKTLLRGKIYNASVEDILESLIAAGEFTYTSMSELAAKATYQEIVEALKHTEYYPLLQ 179 Methanosarcina...
O29103         87 EVSFGASKFLIMKYLEKWDVWNIINIIRGKMANVQPEVVDDILVPAGERDMDFWKTLL-VKDIEEIVKSFEGTPYYEPLS 165 Archaeoglobus ...
vng:rrnAC3157  88 RWSEGALYDYIARYLRKFDVWNVKTVIRGLYSDAERTEVEDDLIRAGEFSDRRIEDLLNAGSIEEVVEQLDDTIFGDTLA 167 Haloarcula mar...
Q5JDR9        107 KILPKRSRDFFRLMMEEWDVRNIANVVKAKLANEPASDY---IIELGPMLPK-VKAMAEAKTLEEILVILEGTPYEGPYQ 182 Thermococcus k...
O27038        117 QIAPASIRDPFRANLKRWDVRNIKSLITAKAAGLSAEETVNLLVPGGEVYEI-IEGLADASSVQEVVTGLEATEYAGVLE 195 Methanothermob...
CAF30598      203 EGlteyeQNGKLTTLEMSLDKLILENLWKNV--SVD-GTEKDLFKEFIGTMIDIENLKIILKAKADGL-SSEVISKYTTS 278 Methanococcus ...
Q60184        180 KF-----DGTNLAYIENELDKIYYADLFEAIg-KPR-SKDRKLFAQVVRLEVDVKNLINLFRLKKAGVmQPDEIMPLMIE 252 Methanosarcina...
O29103        166 KI-----GSEDMSKIEDGLYKVYYRELLKL---NPS-DFAMKLFLDFIKMEIDIRNVKTLLRLKAEDA-TPDEIMECTIP 235 Archaeoglobus ...
vng:rrnAC3157 168 EAfdvyeESGVLVPLENALDRAFYETLLSGLpdNPEiDSPTGLYVEFLETEVDFRNLRNALRLARSGA-DIDPS-EYFIE 245 Haloarcula mar...
Q5JDR9        183 ELi---aGNIDVSTFETELYRMYYKKLLNYAr-SRK-DDEKTLLTEFIKLKIDKLNLMTTLRGKLAGL-SAKEIRSMLIP 256 Thermococcus k...
O27038        196 DAlsgyeETGMLLPIEAALDRKFLEGLIRTVg-SPS-DDNTKILHTYFGTMVDISNLKIILRAKADGL-SYDDISPYIVP 272 Methanothermob...
CAF30598      279 KGYELASWKLKELADvesiEGVISSLDGTKYAPIVTENLEefEKVKSVYVFEKALDSYLVQMGKKLSLRQPFGIGPIIGL 358 Methanococcus ...
Q60184        253 GGLELKIEKLAALPY----DEFVNELQRTQYWEAISGVVG--PDMISLTTLESRLTRYYLESSTILSHVSPITVVPILDY 326 Methanosarcina...
O29103        236 GGYELTEEELRKLAAmp-iDEMIKALEGYWFWNDVQ------IEGKEVAAVEIEFDKVWIKTISKRASNYPLSILPVLQY 308 Archaeoglobus ...
vng:rrnAC3157 246 GGQLFDAQEVAQLSTn--lDQLVSAVRESKYGDDLDQALSalEEADNLIDFERALDAALLEYADRLSNRYPLSVCPVLSY 323 Haloarcula mar...
Q5JDR9        257 GGSL----DVEPLLHidsiEMTLAQLDSTEYGEFIRKVRE--EAEKDISVIERAFDEHLIKKVTEFDRFHPLSIAAPLAY 330 Thermococcus k...
O27038        273 HGYQIREWKLKDLMEsedvSGVVSGLEGTDYGQMLSEALSeyTSTGSVAVFERVLEDNLNRMARNFALKKPFGVGPMIGF 352 Methanothermob...
CAF30598      359 ITSKELEIRNLKIIIKGKIE-GLSASEIREILV 390 Methanococcus maripaludis S2
Q60184        327 IIHKNNEATNLRIIFRGKET-GLSDELIKDQLV 358 Methanosarcina mazei Go1
O29103        309 IVLKKVEVDNLRVLGWGKYY-GLPSEEIERQMV 340 Archaeoglobus fulgidus DSM 4304
vng:rrnAC3157 324 VLAKEREVDNIRAIARGREA-GLGPDEIEQELV 355 Haloarcula marismortui ATCC 43049
Q5JDR9        331 VLKKEREVRKLRAMVKLIGD-GLEPEVIKEFVG 362 Thermococcus kodakarensis KOD1
O27038        353 LSRKEVEVKNLKVIARSKREpGFPEAMVKEMLA 385 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap