Conserved Protein Domain Family
aconitase_mito

?
TIGR01340: aconitase_mito 
aconitate hydratase, mitochondrial
This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 273561
View PSSM: TIGR01340
Aligned: 4 rows
Threshold Bit Score: 1416.95
Threshold Setting Gi: 8250175
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC18623  50 YETLYNKYSEVRRVLGsQRLTLAEKILYSHLDNVEEsllsNTNGgrdvRGKANLKLKPDRVNMQDASAQMALLQFMTCNL 129 Neurospora crassa
CAB93521  52 YEKLNKRLEVVRGRLN-RPLTLSEKVLYSHLDDPAN----QDIV----RGTSYLRLRPDRVAMQDATAQMALLQFISSGL 122 fruit fly
AAC61778  42 YKKMSENLDIVRRRLS-RPLTYAEKVLYSHLDDPHG----QDIE----RGVSYLKLRPDRVACQDATAQMAILQFMSAGM 112 Aspergillus terreus
P39533    35 YAKLLTNLDKIKQITNnAPLTLAEKILYSHLCDPEEsitsSDLSt--iRGNKYLKLNPDRVAMQDASAQMALLQFMTTGL 112 Saccharomyces cerev...
CAC18623 130 PQPVIPASIHCDHLIVGSKGADEDLKAGIATNNEVFDFLESAGKKYGIDFWPPGAGIIHQTVLENYAVPGLMMLGTDSHS 209 Neurospora crassa
CAB93521 123 KKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHT 202 fruit fly
AAC61778 113 PSVATPTTVHCDHLIEAQVGGEKDLARANEINKEVYDFLATATAKYNIGFWKPGSGIIHQIVLENYAFPGGLMIGTDSHT 192 Aspergillus terreus
P39533   113 NQTSVPASIHCDHLIVGKDGETKDLPSSIATNQEVFDFLESCAKRYGIQFWGPGSGIIHQIVLENFSAPGLMMLGTDSHT 192 Saccharomyces cerev...
CAC18623 210 PNAGGLTTITIGVGGADAVEALVGAPWELKAPKILGVRLTGKLNDWVSAKDIILHLTGRLTVRGGTGYIVEYFGPGIESL 289 Neurospora crassa
CAB93521 203 PNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSI 282 fruit fly
AAC61778 193 PNAGGLAMAAIGVGGADAVDVMAGLPWELKAPKVIGVKLTGEMSGWTTPKDIILKVAGLLTVKGGTGAIIEYHGPGVNSL 272 Aspergillus terreus
P39533   193 PNAGGLGAIAIGVGGADAVDALTGTPWELKAPKILGVKLTGKLNGWSTPKDVITKLAGLLTVRGGTGYIVEYFGEGVSTL 272 Saccharomyces cerev...
CAC18623 290 SCSGSSTLCNMGAEIGATTSIFPFTEASSRYLKATNREQADKDAKnfenftkgtgQDSFFKFKADEGAQYDELIEIDLSK 369 Neurospora crassa
CAB93521 283 SCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQ----------KYQAKILSADKNCEYDELIEINLDT 352 fruit fly
AAC61778 273 SCTGMGTICNMGAEIGATTSMFPFNDRMYDYLKATKRQHIGEFAR----------SYAKELR-EDEGAEYDQLIEINLSE 341 Aspergillus terreus
P39533   273 SCTGMATICNMGAEIGATTSTFPYQEAHKRYLQATNRAEVAEAADv--------aLNKFNFLRADKDAQYDKVIEIDLSA 344 Saccharomyces cerev...
CAC18623 370 LEPHINGPFTPDLSIPLSEFKKTVQEQKWPEKLSAGLIGSCTNSSYEDMTRCESIVKAAEQAGIKPASDFYITPGSEGIR 449 Neurospora crassa
CAB93521 353 LEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIR 432 fruit fly
AAC61778 342 LEPHINGPFTPDLATPISKFKEAVDANGWPEELKVGLIGSCTNSSYEDMSRAASIARDALNHGVKSKSLFTVTPGSEQIR 421 Aspergillus terreus
P39533   345 IEPHVNGPFTPDLSTPISQYAEKSLKENWPQKVSAGLIGSCTNSSYQDMSRVVDLVKQASKAGLKPRIPFFVTPGSEQIR 424 Saccharomyces cerev...
CAC18623 450 ATLERDNTLQTFEKAGGIVLSNACGPCIGQWKRQDd-IPKGTPNAILTSYNRNFRGRNDGNLETMNFLASPEIVTAMAYA 528 Neurospora crassa
CAB93521 433 ATIERDGISEVFDKFGGTVLANACGPCIGQWDRKD--VKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIA 510 fruit fly
AAC61778 422 ATIERDGQLQTLEEFGGVILANACGPCIGQWDRKD--VKKGEPNSIISSYNRNFTGRNDANPATHAFVASPDLVVAMCVA 499 Aspergillus terreus
P39533   425 ATLERDGIIDIFQENGAKVLANACGPCIGQWNREDvsKTSKETNTIFTSFNRNFRARNDGNRNTMNFLTSPEIVTAMSYS 504 Saccharomyces cerev...
CAC18623 529 GSTTFNPITDSLTTPDGKEFKFPAPKGLEGPETPFEAGREVFQVQSGSp-NPNVEVAISPSSERLALLEPFEPFPESDLS 607 Neurospora crassa
CAB93521 511 GRLDFNPLTDELTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPS--GENVKVAVDPKSTRLQLLEPFDKWNGQDLT 588 fruit fly
AAC61778 500 GTLKFNPLTDTVKDKDGKEFKLAPPSGDGLPSKGYDAGRNTYQAPPQD--RASINVAVSPTSDRLQLLAGFEAWDGKDAN 577 Aspergillus terreus
P39533   505 GDAQFNPLTDSIKLPNGKDFKFQPPKGDELPKRGFEHGRDKFYPEMDPkpDSNVEIKVDPNSDRLQLLEPFKPWNGKELK 584 Saccharomyces cerev...
CAC18623 608 GLRVLVKVTGKCTTDTISAAGPWLKYKGHLPNISENTLNTAVNAATGEVNVAYDL-DGSKHTIPELAKQWKQRNQPWLVV 686 Neurospora crassa
CAB93521 589 DLTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQrNGSWGGVPDVARDYKANGIKWVAV 668 fruit fly
AAC61778 578 GIPILIKCQGKTTTDHISMAGPWLKYRGHLDNISNNMLIGAVNAENGEANKVKNKfTGEYGAVPATARDYKARGVKWVVI 657 Aspergillus terreus
P39533   585 -TNVLLKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDL-DGTEYDIPGLMMKWKSDGRPWTVI 662 Saccharomyces cerev...
CAC18623 687 AEHNYGEGSAREHAALQPRYLGARIIVTKSFARIHETNLKKQGVVPLTFANEQDYDLIDAGDEVATVGLYEMLKng--gQ 764 Neurospora crassa
CAB93521 669 GDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAP-----G 743 fruit fly
AAC61778 658 GDWNYGEGSSREHAALEPRHLGGLAIITRSFARIHETNLKKQGMLPLTFADPADYDKIQPEDTVDLL-CTELEV-----G 731 Aspergillus terreus
P39533   663 AEHNYGEGSAREHAALSPRFLGGEILLVKSFARIHETNLKKQGVLPLTFANESDYDKISSGDVLETLNLVDMIAkdgnnG 742 Saccharomyces cerev...
CAC18623 765 GEVSLRVTKkDtGKVVEIKTKHAVSKDQAGFILAGSALNLL 805 Neurospora crassa
CAB93521 744 KPVDAEIKN-G-DKVERIKLNHTLNDLQIGWFKAGSALNRM 782 fruit fly
AAC61778 732 KPMTLRVHPkN-GSTFDVKLNHTFNESQIEWFKDGSALNTM 771 Aspergillus terreus
P39533   743 GEIDVKITKpN-GESFTIKAKHTMSKDQIDFFKAGSAINYI 782 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap