Conserved Protein Domain Family
PH-GRAM_MTMR7

?
cd13344: PH-GRAM_MTMR7 
Myotubularian (MTM) related 7 protein (MTMR7) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain
MTMR7 is a member of the myotubularin dual specificity protein phosphatase gene family. MTMR6 binds to phosphoinositide lipids through its PH-GRAM domain and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate. MTMR7 interacts with MTMR6, MTMR8 and MTMR9. MTMR7 contains a N-terminal PH-GRAM domain, a Rac-induced recruitment domain (RID) domain, an active PTP domain, a SET-interaction domain, and a C-terminal coiled-coil region. Myotubularin-related proteins are a subfamily of protein tyrosine phosphatases (PTPs) that dephosphorylate D3-phosphorylated inositol lipids. Mutations in this family cause the human neuromuscular disorders myotubular myopathy and type 4B Charcot-Marie-Tooth syndrome. 6 of the 13 MTMRs (MTMRs 5, 9-13) contain naturally occurring substitutions of residues required for catalysis by PTP family enzymes. Although these proteins are predicted to be enzymatically inactive, they are thought to function as antagonists of endogenous phosphatase activity or interaction modules. Most MTMRs contain a N-terminal PH-GRAM domain, a Rac-induced recruitment domain (RID) domain, a PTP domain (which may be active or inactive), a SET-interaction domain, and a C-terminal coiled-coil region. In addition some members contain DENN domain N-terminal to the PH-GRAM domain and FYVE, PDZ, and PH domains C-terminal to the coiled-coil region. The GRAM domain, found in myotubularins, glucosyltransferases, and other putative membrane-associated proteins, is part of a larger motif with a pleckstrin homology (PH) domain fold. The PH domain family possesses multiple functions including the ability to bind phosphoinositides via its beta1/beta2, beta3/beta4, and beta6/beta7 connecting loops and to other proteins. However, no phosphoinositide binding sites have been found for the MTMRs to date.
Statistics
?
PSSM-Id: 270152
View PSSM: cd13344
Aligned: 5 rows
Threshold Bit Score: 210.933
Threshold Setting Gi: 94536956
Created: 24-Jan-2012
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001098872   1 MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDTRKETWILHSQISTIEKQATTATGCPLLIRCKNFQII 80  rhesus monkey
NP_004677      1 MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDPRKETWILHSQISTIEKQATTATGCPLLIRCKNFQII 80  human
XP_003221635   1 MEYIRMPKVENVRLIDGISSKRAAPGTLYLTATHVIFVENESDARKETWILHSQIASVEKQATTATGCPLLIRCKNFQNI 80  green anole
XP_002940495   1 MEHIRLPKVENVRLLDRISSRKAALGTLYLTGTHIIFVENISETRKETWILYSQISSIEKQATATSGCPILIHCKNFQVI 80  western clawed ...
NP_001035406   1 MEHIRMPKVENVRLVDRSSSRKSQVGTLYLTATHTIFVGKGSEDRNELWVLHSLVCNIVKHKASQSGYPLLIHCKNFQVI 80  zebrafish
XP_001098872  81 QLIIPQERDCHDVYISLIRLARP 103 rhesus monkey
NP_004677     81 QLIIPQERDCHDVYISLIRLARP 103 human
XP_003221635  81 QFIMPQERDCHDVYISLIRLARP 103 green anole
XP_002940495  81 QLIIPQERDCHDIYLSLVRLSRP 103 western clawed frog
NP_001035406  81 QFIILQESDLHNVYISLTRLSRP 103 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap