Conserved Protein Domain Family
PTZ00237

?
PTZ00237: PTZ00237 
acetyl-CoA synthetase; Provisional
Statistics
?
PSSM-Id: 240325
Aligned: 20 rows
Threshold Bit Score: 1090.55
Threshold Setting Gi: 166240111
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66823867   2 FKLSDPFDYENDYNYS-QINPISFWDEVAKKYVHWDKMYDKIYSSDGMYPDWFKGGELNTCYNVLDKNVKNPVKRDQNAL 80 
66822241   1 MKLSDPFDYENDLKYA-ESQPVSFWDDIAKKYIHWDKMYDKVYSGDEMYPDWFKGGELNTCYNVLDIQVQNPLKRDQDAL 79 
66822233   2 YK----FNYENDIDFA-NNQPIEFWDEVAKDLVHWDKMYEKVYSDDEIYPDWFKGGELNTCYNVLDIHIKNPETRDQDAL 76 
66822221   2 YRLSEPFDYLNDKTYA-NNEPEAFWDEVAKKLIKWDKMYDKVYSGDEMYPDWFKGGELNTCYNVLDRQVQNPLKRDQDAL 80 
66822841   1 MKLSDPFDYENDLKYA-ESQPVSFWDDIAKKYIHWDKMYDKVYSGDEMYPDWFKGGELNTCYNVLDIQVQNPLKRDQDAL 79 
66822845   2 YTLSQPFNYENDYKFSiNTDPISFWDQVATKYVYWDKMYDKVYSGNEIYPDWFKGGELNTCYNLLDRQVQNPLKKDQVAL 81 
66822849   2 YK----FNYENDIDFA-NNQPIEFWDEVAKDLVHWDKMYEKVYSDDEIYPDWFKGGELNTCYNVLDIHIKNPETRDQDAL 76 
66822861   2 YRLSEPFDYLNDKTYA-NNEPEAFWDEVAKKLIKWDKMYDKVYSGDEMYPDWFKGGELNTCYNVLDRQVQNPLKRDQDAL 80 
66827521   2 YILSDPFNYENDSNFA-NDKPNEFWDEVAKKYIYWDKIYDKVYSGDEIYPDWFQGGKFNSCFNVLDINVNNPLKRDQVAI 80 
66827467   2 FKLSDPFDYENDYSYS-QINPISFWDEVAKKFVHWDKIYDKVYSGDEIYPDWFQGGELNTCYNVLDKQVKNPLKRDKDAL 80 
66823867  81 IYECPFIKKTIKLTYFQLYEKVCEFSRVLLNLNISKNDTVLIFMANTLEPIIALLSCARIGATFSTLFDGYPVRSLIDRI 160
66822241  80 IYECPFLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNILIFMANTVEAPIAMLSCARIGATHCVLFDGYSTKSLIDRI 159
66822233  77 IYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNVLIYMSNTLEPLIAMLSCARIGATHCVLFDGYSVKSLIDRI 156
66822221  81 IYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNVLIYMANTLEPLIAMLSCARIGATHCTIFDGYSVKSLIDRI 160
66822841  80 IYECPFLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNILIFMANTVEAPIAMLSCARIGATHCVLFDGYSTKSLIDRI 159
66822845  82 IYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNVSKNDNVLIYMANTVEAPIAMLSCARIGATHCALFDGYSVKSLIDRI 161
66822849  77 IYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNVLIYMSNTLEPLIAMLSCARIGATHCVLFDGYSVKSLIDRI 156
66822861  81 IYECPYLKKTVKLTYYQLYEKVCEFSRVLLNLNISKNDNVLIYMANTLEPLIAMLSCARIGATHCTIFDGYSVKSLIDRI 160
66827521  81 IYECPYLNKTIELTYNQLFEKVCEFSRVLLNLNITKDDNVLIYMATTLEPIIAMLSCARIGATHCVIYDNYGVNTLVDRI 160
66827467  81 IYECLYLKKTVKLTYYQLYEKVCEFSRVLLNINISKNDNVLIYMANTLEPLIAMLSCARIGATFTVLFEGYPVKSLIDRI 160
66823867 161 DKLTPKLIITSNYGILNDEIITFTPNLKDAIQLSTFKPNHVITHFRN-NED-IESNDSSIETIPIIPNTLDWDKEIQKIK 238
66822241 160 EAVRPKVIITSNYGILNEEIITFTPNLIEAIEISTFKPDHVITHNRD-LIS-SDAQLSIIETIPTVPSSLDWDLEINKIK 237
66822233 157 ETITPKLIITTNYGIFNDEIINFIPNLKESIELSTFKPSNVITLFRN-DIT-SESDLKKVNDIPTIPNTLSWYDEIKKFK 234
66822221 161 ETITPKLIITTNYGILNDEIITFTPNLKDAIEQSTFKPSNVITLFRN-DIT-SESDLKKVKDIPTIPNTLSWYDEIKKFK 238
66822841 160 EAVRPKVIITSNYGILNEEIITFTPNLIEAIEISTFKPDHVITHNRD-LIS-SDAQLSIIETIPTVPSSLDWDLEINKIK 237
66822845 162 ETITPKLIITTNLGVGLDEIVDITTNLKEAIELSTFKPDNVITLYRN-DIVyNNNNFQTI-----IPNSLNWEEEIKKIK 235
66822849 157 ETITPKLIITTNYGIFNDEIINFIPNLKESIELSTFKPSNVITLFRN-DIT-SESDLKKVNDIPTIPNTLSWYDEIKKFK 234
66822861 161 ETITPKLIITTNYGILNDEIITFTPNLKDAIEQSTFKPSNVITLFRN-DIT-SESDLKKVKDIPTIPNTLSWYDEIKKFK 238
66827521 161 ESITPKLILSSSFTIVNDTIVELPTNLKNAIEISKFKPNHVIIHFRSyDSTfKESDFNLIESIKPIPNSLNWDSEINKIK 240
66827467 161 ETITPTLIITSNYGILNDELITFTPNLKEAIQQSAFKPNHIITHFRN-DYE-DIEFKNIIGTMTIIPNTLDWDKEIQKIK 238
66823867 239 DNNQKPFYEYVPVESNHPLSIYFSSGTTGNCKAIVRSNGGNLVGLVYSWFSCI---SKKd--eTVYFSHSSIGWISFHLG 313
66822241 238 ENNQTPFYEYVTVESSHPLYIIYTSGTTGNSKGVVRSNGPHLVCFGYLWPSIV---QKN----TTFFSHTSIGWVSFHSF 310
66822233 235 ENNQLPFYEYVPVESSHPLYILYTSGTTGNSKGAVRSNGPHLVGIKY--QTLI---QKGk--tKVVFYHTSVGWISIHNA 307
66822221 239 ENNQSPFYEYVPVESSHPLYIIYTSGTTGNSKAVVRSNGSHMVCLNYFNRYIS---ENNq--sTTLLTTSSVGWVSFHGF 313
66822841 238 ENNQTPFYEYVTVESSHPLYIIYTSGTTGNSKGVVRSNGPHLVCFGYLWPSIV---QKN----TTFFSHTSIGWVSFHSF 310
66822845 236 INNQSPFYDYVPVESSHPIYLIYTSGTTGNSKPVVRSNGSNLVGLLYHWNCLSskvNNDe--nVVLFSATSVGWVSFHMF 313
66822849 235 ENNQLPFYEYVPVESSHPLYILYTSGTTGNSKGAVRSNGPHLVGIKY--QTLI---QKGk--tKVVFYHTSVGWISIHNA 307
66822861 239 ENNQSPFYEYVPVESSHPLYIIYTSGTTGNSKAVVRSNGSHMVCLNYFNRYIS---ENNq--sTTLLTTSSVGWVSFHGF 313
66827521 241 ENQQKPFYEYVPVDSNHPLYIIYTSGTTAKPKSIVRSNSS-LVCLKYHYSAMM---IKDv--vLRFLAHHKVGGLTFHSF 314
66827467 239 YNNQSPFYEYVPVESSHPLSIHFTSGTTGNAKAVVRGNGSNLVGLVYNWYSSM---SSKkyddSVYFSHSSIGWITFHMG 315
66823867 314 LFGSLVLGNTMVMFEGDIMKPIHYEHYLWETVEKHKINTFLTSPKTIRFLIKNDPDANKIKSKYDLSSLVSIWTSGEVIE 393
66822241 311 LYASLLHGCSFVMFEGGIVKPKHMEDDIWSIVEKHKVSAFLTLAKTIRYLNKVDPDAKQIHSKYDISSLKSIWNGGEVIE 390
66822233 308 FNGLLSLGYTLVMFEGGLTKTKHMEDDIWEVIERNKVTCASIMAKAIRYLIKVDPECKNLHSKYDLSNLKEIIVGGEPIE 387
66822221 314 LYGMLSFGSTFVMYEGGIIKNKHIEVDLWNTIEKHKVTHALSLASAIRYLIKTDPEGTILRSKYDLSNLKEIWIGGEPIE 393
66822841 311 LYASLLHGCSFVMFEGGIVKPKHMEDDIWSIVEKHKVSAFLTLAKTIRYLNKVDPDAKQIHSKYDISSLKSIWNGGEVIE 390
66822845 314 FYASLSKGNTFVMFEGGFLKQNNVEDDIWATIEKHNVNIYLALPIVMRYLKKMDPNAERLHSKYDISRLKQVWIGAEVIE 393
66822849 308 FNGLLSLGYTLVMFEGGLTKTKHMEDDIWEVIERNKVTCASIMAKAIRYLIKVDPECKNLHSKYDLSNLKEIIVGGEPIE 387
66822861 314 LYGMLSFGSTFVMYEGGIIKNKHIEVDLWNTIEKHKVTHALSLASAIRYLIKTDPEGTILRSKYDLSNLKEIWIGGEPIE 393
66827521 315 LYGFLSFGQTFVLSESGVTK-------FWNTLEKHKISMSFAWPKTIRNLIKYDPNAENLKSNFNLSNLKVLCFGGEVTE 387
66827467 316 LIGSLALGNTFVMFEGGITKPIHYEHYLWATIEKHKINTFLTLAKTIRYLIKNDPGATNINSKYDSSSLLSIWIAGEVIE 395
66823867 394 QSIPEYIESKIKCRSSNLYGQTESGCALLFDYKr-INSKQFKTLFKPTPFLKPLIFSE-DGIELPENQVGEVAFKLPLPP 471
66822241 391 DSIPEYIENKLKSRPSIGYGQTETGYLYLFDYIk-SKKNPYNTVGPPSPFVYPSILSE-DGIELPVNQIGEIVFKLPLPP 468
66822233 388 ESIPNYIQEKLKVKSIRVYGQTETGACYFYCYDykNLKIPINTSGFPFSSLKAMIFSD-DGKELGVNEIGELVFKLPLPP 466
66822221 394 ESISEYIEQKLKIKSTRGYGQTEIGITYLYCFG--HINIPYYATGLPSIFIRPSIFSD-DGKELGVNEIGEIAFKLPMPP 470
66822841 391 DSIPEYIENKLKSRPSIGYGQTETGYLYLFDYIk-SKKNPYNTVGPPSPFVYPSILSE-DGIELPVNQIGEIVFKLPLPP 468
66822845 394 KSIQDYIENKLNAESIGLYGQTESGMMYIYEYS--SINKTYDTVGIPSPFIKPSILSE-DGKELGVNEIGEFSLKLPLPP 470
66822849 388 ESIPNYIQEKLKVKSIRVYGQTETGACYFYCYDykNLKIPINTSGFPFSSLKAMIFSD-DGKELGVNEIGELVFKLPLPP 466
66822861 394 ESISEYIEQKLKIKSTRGYGQTEIGITYLYCFG--HINIPYYATGLPSIFIRPSIFSD-DGKELGVNEIGEIAFKLPMPP 470
66827521 388 EPISEYIENKIGVKCSRGYGQSESGITLILGYG--HIKIPYSACGLPAVFIKPVILSPvDGKELNENEIGEVSFKLPMPP 465
66827467 396 QSIPEYIESKLKCCSGNVYGQTEGGCISLFNCKr-IYNKQYNTLINPTPFLKPSIFSE-DGIELPDNQVGEIVFKLPMPP 473
66823867 472 SFATTFYKNELLYKKMFNKFPGYYNSGDLGFKNENDYYGIVSRADDQIKIG-GFDVLLNDIETSILKHPLVLECCSIGIY 550
66822241 469 GFASTFYKNDEQFKKVLTKFPGYYSSGDLGYKDENGYYAIVSRADDQIKIG-GNKVQLNTIETSILKHPNVIECCSIGIY 547
66822233 467 SFATTFYKNDEKFKQLFTKFPGYYNPGDLGFKDENNCYGVVSRSDDQIKIS-GNKVQLNKIETSILKHPLVLECCSIGIY 545
66822221 471 SFATTFYKNDEKFKQLFSKFPGYYNPGDLGFKDENGFYTIVSRSDDQIKIS-GNKVQLNTIETSILKHPSVLECCSIGIN 549
66822841 469 GFASTFYKNDEQFKKVLTKFPGYYSSGDLGYKDENGYYAIVSRADDQIKIG-GNKVQLNTIETSILKHPNVIECCSIGIY 547
66822845 471 GFATTFYKNDEQYKKLFSKFPGYYNSGDLGYKDENGYYGIVSRADDQIKIS-GNKVQLNTIESSILKHPNVIECCSIGIN 549
66822849 467 SFATTFYKNDEKFKQLFTKFPGYYNPGDLGFKDENNCYGVVSRSDDQIKIS-GNKVQLNKIETSILKHPLVLECCSIGIY 545
66822861 471 SFATTFYKNDEKFKQLFSKFPGYYNPGDLGFKDENGFYTIVSRSDDQIKIS-GNKVQLNTIETSILKHPSVLECCSIGIN 549
66827521 466 SFAATFYKNDDRFKQLFSKYKGYYNSGDLGFKDKNGCFSVVSRLEDQLNFSdGRSIILNKIEDSILKHPLVLECCSFGFE 545
66827467 474 SFATTFYKNELLYKKIFNKFPGYYNSGVITFKKEIDYYGIVSRADDQIKIG-GFKVDLNQIETSILKHPLVLECCSIAIY 552
66823867 551 HQDLANVPIGLLVLNqqqpdnspSSSSSssssssssssssssssssssssssalsLSLIDIKNQINEIIENDIGFYSELT 630
66822241 548 NPDCYNKPIGLLTLK--------QQDSN---------------------------VDLIQLKNEINSIITQDIDKFAQLT 592
66822233 546 NPDCYNVPIAFLVLKqq----edQSIQQ---------------------------IDLNKLQSEINIIISKDIENFAILR 594
66822221 550 DPTCYSVPIALLVLKqqqqqqqdQSTRQ---------------------------IDLNKLHSEINNIITQDIASLAVLR 602
66822841 548 NPDCYNKPIGLLTLK--------QQDSN---------------------------VDLIQLKNEINSIITQDIDKFAQLT 592
66822845 550 DYDCYKAPIGILVLK--------KQDSI---------------------------LDFNQLKNEINNIINDDIESYAELK 594
66822849 546 NPDCYNVPIAFLVLKqq----edQSIQQ---------------------------IDLNKLQSEINIIISKDIENFAILR 594
66822861 550 DPTCYSVPIALLVLKqqqqqqqdQSTRQ---------------------------IDLNKLHSEINNIITQDIASLAVLR 602
66827521 546 K---LNQLVALLVLKn------aDDHHH---------------------------IDMNQLNNEINFIISNDFNPSTFLS 589
66827467 553 HQDLKNVPIGLLVLKqqqqqqqqQQQQQqqqqqqqqqqqqqqqqqqpdnsssslsLSLIDLKNQINKIIKNDMDFYSELT 632
66823867 631 KIIFVPQLPKTKTGKIPRQIISKFLNEPNYQLKDSTCDR-EVFYSIKELYEK 681
66822241 593 HIIIVEQLPKTKSGKIQRLIISKFLNDNNFKLPDHVFESqQIYTDIKNLYLN 644
66822233 595 KTLIVTQIPKTKAGKIQRQIISKYLNDINYELPDNVCDV-EIFYKIKDLYNN 645
66822221 603 KIVIVNQLPKTKTGKIPRPIISKFLNDSNFLLPDNISNV-EIFYEIKELYTK 653
66822841 593 HIIIVEQLPKTKSGKIQRLIISKFLNDNNFKLPDHVFESqQIYTDIKNLYLN 644
66822845 595 QIIIVNQLPKTKSGKIQRHILSNYLNNNNFKLPDNIENL-QLFYNIKDSFIK 645
66822849 595 KTLIVTQIPKTKAGKIQRQIISKYLNDINYELPDNVCDV-EIFYKIKDLYNN 645
66822861 603 KIVIVNQLPKTKTGKIPRPIISKFLNDSNFLLPDNISNV-EIFYEIKELYTK 653
66827521 590 KIIIIPELPISMGGKITRSILSNYLNDSNYQLPENVGDL-NIFYKIKNLFKQ 640
66827467 633 KIIIVPQLPKTKSGKIPRSIVSKFLNEPNYQLHES-CDH-EVFYLIKELYVE 682
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap