Conserved Protein Domain Family
vWA_midasin

?
cd01460: vWA_midasin 
VWA_Midasin: Midasin is a member of the AAA ATPase family. The proteins of this family are unified by their common archetectural organization that is based upon a conserved ATPase domain. The AAA domain of midasin contains six tandem AAA protomers. The AAA domains in midasin is followed by a D/E rich domain that is following by a VWA domain. The members of this subgroup have a conserved MIDAS motif. The function of this domain is not exactly known although it has been speculated to play a crucial role in midasin function.
Statistics
?
PSSM-Id: 238737
View PSSM: cd01460
Aligned: 9 rows
Threshold Bit Score: 379.387
Threshold Setting Gi: 23491038
Created: 10-Jan-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
metal ion
Feature 1:metal ion dependent adhesion site (MIDAS)
Evidence:
  • Comment:binding to metal ions is mediated by the MIDAS motif.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                         # # #        
Q12019    4643 LVSRLGEQLRLILEPTLATKLKGDYKTGKRLNMKRIIPYIASQFRKDKIWLRRTKPSKRQYQIMIALDDSKSMSESKC-- 4720 baker's yeast
NP_500551 4109 LAAELAENLRLILEPQRANKMQGDYRSGKRLNMRRLIPYIASEYRKDRIWMRRTKRAQREYQILIAVDDSESMNENGI-- 4186 Caenorhabditis e...
EAA28123  4708 LSMSLSSQLRLILTPSQSTKLSGSFRTGKRLNIKKIIPYIASSYKRDKIWMRRAIPTKRSYQILLCVDDSQSMGDSLNns 4787 Neurospora crassa
EAA22672     2 ISSQLCEQLKIILEPTVRNKYEGDYKSGKKLNIKKLVNYFASNFRNNKIWKRKTKLNKRDYNILIAIDNTKSMKINNI-- 79   Plasmodium yoeli...
AAO53165  5599 LSQDLCEQLRLILEPTLATKLQGDYKSGKRINMKKVIPYIASQFKKDKIWLRRTKPNKRQYQVLLAIDDTESMAAYHS-- 5676 Dictyostelium di...
CAA20864  4444 LSIELCEQLRLILEPTLATKMQGDFRTGKRLNMKRIIPYIASQFKKDKIWMRRVKPSKRTYQVMISIDDSKSMSESGS-- 4521 fission yeast
NP_610708 5038 NARELCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKSMHHNNS-- 5115 fruit fly
XP_308444 4973 SARDLCEQLRLILEPTKCTRLKGDYRTGRRINMKKIIPYIASQFRKDKIWLRRTKPAQRDYKITIAIDDSKSMDHNNS-- 5050 Anopheles gambia...
Q9NU22    5323 LSQRLCEELRLILEPTQAAKLKGDYRTGKRLNIRKVIPYIASQFRKDKIWLRRTKPSKRQYQICLAIDDSSSMVDNHT-- 5400 human
Feature 1                                                                           #          
Q12019    4721 ---VKLAFDSLCLVSKTLTQLEAGGLSIVKFGENIKEV-----HSFDQQFsn-esGARAFQWFGFQETKTDVKKLVAEST 4791 baker's yeast
NP_500551 4187 ---HQNTCESVCIVEDALRRCDAGRVSVCSFGADVNTI-----IPFGEASas--sSIEMLKQMTFSQKKTDLLLLLKTAK 4256 Caenorhabditis e...
EAA28123  4788 gsaGRLALESLVMTSRALTMLEVGQVGVLGFGTDVFVA-----HRLTDPFashdaGARVLQQFTFKQEGTDMVNLLRRTI 4862 Neurospora crassa
EAA22672    80 ---QKMTLNAIFLVAKAFEKLNVGKIGICSFGESEQITsnnivCPMVNSLnk-qnFLKILNHFNFNHDTQNSFDCAMLNA 155  Plasmodium yoeli...
AAO53165  5677 ---GGFALEAMTMISRAMSRLEVGQLGIVRFGEDVQLV-----HSFDQVFsd-qtGPEIITQFKFQQTKTNMVNFLSKTL 5747 Dictyostelium di...
CAA20864  4522 ---TVLALETLALVTKALSLLEVGQIAVMKFGEQPELL-----HPFDKQFss-esGVQMFSHFTFEQSNTNVLALADASM 4592 fission yeast
NP_610708 5116 ---KTLTLEAISLVSQALTLLESGRLSIVSFGEAPQII-----LNHTEQFd----GPRLVNALNFAQDKTKIAGLLNFIR 5183 fruit fly
XP_308444 5051 ---KDLTLQAISLVSQALSLLESGRLNVMSFGEKPRIL-----LKHSDQFd----GPKLISALNFAQNQSRIAELLKFVR 5118 Anopheles gambia...
Q9NU22    5401 ---KQLAFESLAVIGNALTLLEVGQIAVCSFGESVKLL-----HPFHEQFsd-ysGSQILRLCKFQQKKTKIAQFLESVA 5471 human
Feature 1                                      #                                               
Q12019    4792 KIf-----ERARAMVHNdq-----wQLEIVISDGicedHETIQKL---VRRARENKIMLVFVIIDGIt--------sNES 4850 baker's yeast
NP_500551 4257 QQl-----DEMRTGTSE--------QMLIVISDGrgalSQGADKVr--ALYSALQGVTVLFIVLDSG----------KKS 4311 Caenorhabditis e...
EAA28123  4863 DHf-----RDARLTSASqsggedlwQLALILSDGlv-qSKDHARLrplLREAMEQRVMVVFIVMDDArdaqgnakkgSQS 4936 Neurospora crassa
EAA22672   156 LKicnyvfKNSYTQNNSknt---lnHLMLIISDGr--fNKSSVRAe--IFNSIKNNFIPILMIIDTQlsd-----nkAQS 223  Plasmodium yoeli...
AAO53165  5748 QI------MDMNKQSSSgep---amQLVFIVSDGwslrDPETTKKy--LREASIKNVFIVFIVIDNPv--------nNNS 5808 Dictyostelium di...
CAA20864  4593 KCf-----NYANTASHHrsns-dirQLEIIISDGicedHDSIRKL---LRRAQEEKVMIVFVILDNVnt------qkKSS 4657 fission yeast
NP_610708 5184 TAn----aEESGTGGDNgl----feNLLLILSDGrnifSEGAQNVknaIKLARLQRIFLVYIIIDNPd--------nKNS 5247 fruit fly
XP_308444 5119 TFs----tEDASASENGvf-----eHLLLVLSDGrniySEGEKEVknaVKLARLQRIFIVYIIIDNPd--------nKHS 5181 Anopheles gambia...
Q9NU22    5472 NMfa--aaQQLSQNISSet-----aQLLLVVSDGrglfLEGKERVlaaVQAARNANIFVIFVVLDNPs--------sRDS 5536 human
Feature 1                                                                  
Q12019    4851 ILDMSQVNYIPDQYgnpqlKITKYLDTFPFEFYVVVHDISELPEMLSLILRQYFTDLASS 4910 baker's yeast
NP_500551 4312 IEDHTVASFKDNKV-----VLTPYLALFPFPFYALVKSVQQLPSVIAESIRQWFEMTTTH 4366 Caenorhabditis elegans
EAA28123  4937 VLDLKEARFGSDGMp----VIHRYLDSFPFQYYLIVHHLDDLPGALAGLLRSWFSEVSAS 4992 Neurospora crassa
EAA22672   224 IFNLKQTFYKNNKL-----EIVPYLHDFPFPYFVVVNDINDIPSMTCDIIRQWFEVLNNK 278  Plasmodium yoelii yoelii
AAO53165  5809 ILDFESISFNNGKI-----QRTNYMSEFPFMYYVILRSLNNIPSILSDTLRQWFDLTKST 5863 Dictyostelium discoideum
CAA20864  4658 ILDIKKVYYDTKEDgtmdlKIQPYIDEFAFDYYLVVRNIEELPQLLSSALRQWFQQMSNT 4717 fission yeast
NP_610708 5248 ILDIQHVAVNADGSv----NINSYLDSFPFPYYVIVRDLNQLPLVLSEAMRQWFELVNSE 5303 fruit fly
XP_308444 5182 IMDVRVPLFTEDSSq---iVMQSYLDVFPFPYYVIVRDLGQLPMVLSDAMRQWFELVNSE 5238 Anopheles gambiae str. PEST
Q9NU22    5537 ILDIKVPIFKGPGEm---pEIRSYMEEFPFPYYIILRDVNALPETLSDALRQWFELVTAS 5593 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap