Conserved Protein Domain Family
hsdR

?
PRK11448: hsdR 
type I restriction enzyme EcoKI subunit R; Provisional
Statistics
?
PSSM-Id: 236912
View PSSM: PRK11448
Aligned: 44 rows
Threshold Bit Score: 1616.56
Threshold Setting Gi: 161507780
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218709367    1 MAKSNFEFLKGINDFLYAIARAAEKNYPDDPNTTLVKLRIFGEATAKHLAKLLDI-----EVPENQHELLRELGKIPFVD 75  
42779916     1 MSKSNFSFFREKWDVLANLGETAERNMYYDPHTTLMKLRLFGETLAKVILAMENIk---eAYNTSQVDRIQTLRREGLLE 77  
218901961    1 MSKSNFSFFREKWDVLANLGETAEKNMYYDPHTTLMKLRLFGETLAKVILAMENIk---eAYNTSQVDRMQTLRREGLLE 77  
302874004    1 --MSNFTFLKEKWPILENLGRLAERNLYIDSNTTFIKCGMFGEIVVQYMFSMEKIdytsiADDNNHNNRIKLLKKEDLIP 78  
161507780    1 --MSNFNTSDKNYHEYAKLASSAESLIFSDPRSSLTVFGTFGEQLTREIMHLDGLgd-weLNQKARIDKMRYSGNG--YP 75  
251798710    1 -MAGNFEFLHDRWEILSDLGEMAERNLFIDPNTSLIKLRMFGETLTKYICAMEEMd---eTKELTQVDRLSQLKRDDLIS 76  
150388682    1 -MKSNFEFLNKTFPVLANLGSTAESYLYSDANSSLIKLGLFGETIVNLMLKLDQMep--pEYDNTHANRIKLLKKEGLIS 77  
261419105    1 -MAHNFQFLEGKWDVLARVGETAERHVHQNPNVAISELRKLAETMTKYILAFEGIr---eERGTDQQDRLKVLLYEQIIP 76  
297530926    1 -MAHNFQFLEGKWDVLARVGETAERHVHQNPNVAISELRKLAEAMTKYILAFEGIr---eERGTDQQDRLKVLLYEQIIP 76  
138894433    1 -MSHNFRFLEEKWEVLARVGETAERNVYQNPNVTISELRKFAETITKYILALEEIr---eERGTDQQERLRILFYEQIIP 76  
218709367   76 DSILNVFHKLRKIGNQAVH--EYHDDLQDAEMCLRFAFRLAVWYYRLVTKNYDFPVPHFVLPSSDSG--EQFEQEVLSLK 151 
42779916    78 KELYDMFDALRKKGNNAAHeaGY-GTVKEAQALLLMSFRLGIWFMEVYGD-WDFEAPEYVEPEK---------------- 139 
218901961   78 KELYDMFDALRKKGNNAAHeaGY-GTVKEAQALLLMAFRLGIWFMEVYGD-WDFEAPEYIEPEK---------------- 139 
302874004   79 EDIDNILHMLRIKRNSAAH--QGYEDVEKAKVQLELTFKLAVWFMQTYGD-WEFEPKEFEEPKENEYgeN---------- 145 
161507780   76 DAVLLALDEIRRKRNGATHdnQFIATKGAALKIDQKAYLVWKWFLESFSLN---DVPEYVTPVDQRNilKSQADKIKALE 152 
251798710   77 DDIVDYLHTLRKIGNKAVHesGY-GSTREAQASTLLAFRLSVWFMQVYGD-WNFQAPDYIEPVEQQDsaG---------- 144 
150388682   78 QNIDDIIYSLRIARNKAVH--SGYDSFEDCVILLEMGHNLAIWFMQTYGD-WQYAPAEFVLPEDNSQ------------- 141 
261419105   77 KEIYDIFTMIRLKGNQAVHdpNY-GDVHEAKTLLHMAFRLAVWFMEVYGD-WSFEAPQYREP------------------ 136 
297530926   77 KEIYDIFTMIRLKGNQAVHdpNY-GDVHEAKTLLHMAFRLAVWFMEVYGD-WSFEAPQYREP------------------ 136 
138894433   77 KEIYDLFTVIRLKGNEAVHnpSY-GEVNEAKALLHMAFRIAVWFMEVYGD-WSFQTPEYIEPTPQPSisA---------- 144 
218709367  152 HELalarqsesqakeqskaeLDAQQAKLTALNGYISVLESKQEETHEQSQarig---aleaKLKEQETElskkTEVERKA 228 
42779916   140 -------------------------EEKVDASALQKEYDEKVKQLEAELE-----------KVRKESQY----DTSEDKQ 179 
218901961  140 -------------------------EEKVDVSVLQKEYDEKVKQLEIELE-----------KVRKESQY----DTSEDKQ 179 
302874004  146 ------------------------------IIDIAKAYEEKYKALEAELN-----------ILKTQE------KDKGQLE 178 
161507780  153 EKIk---------------------------------------------------------QLQENRPQi--tISAEERT 173 
251798710  145 --------------------------NEVQLDQLARAYEEKMAKLQQELA-----------ALRQQQTN----VTHEDKK 183 
150388682  142 ---------------------------------------------QADFEallkekeeliaVLTEKVLKqkpsKTLSSKE 176 
261419105  137 --------------------LPSSSESTDELNRLIESYKQRLADLEAELS-----------HIREAGLY----TSAEEKQ 181 
297530926  137 --------------------LPSSSESTDELNRLIESYKQRLADLEAELS-----------HIRETGLY----TSAEEKQ 181 
138894433  145 ----------------------------DELDHVVKSYEEKLAQLETELE-----------KIRKEQLY----ISSEEKQ 181 
218709367  229 YKKQIIEEAKSRpLNLSEDETRYLIDNQLRKAGWDADTKKL-NFANGTRPRVGRNIAIAEWPTgkdetgKTGFADYVLFV 307 
42779916   180 RRSRISKEYVNR-LLLSEEETRTIIDEKLRQAGWEADSVNL-TFQNGTRPEKGRNMAIAEWTV------KGGRADYALFI 251 
218901961  180 RRSRISKKYVNR-LHLSEEETRTIIDEKLRQAGWEADSVNL-TFQNGTRPEKGRNMAIAEWTV------KGGRADYALFI 251 
302874004  179 KRKEQGKNASKK-IDLTEAETRIIIDSQLRSAGWEVDTINL-RYSKGTKPQKGKNLAISEWPTyse-dkGHGAVDYALFI 255 
161507780  174 RRRKVNVQFAKK-HPLNEEETRQLIDSQLRNAGWEADTPRLnNWKHQTEPQKGHSMAIAEWVLp-----NGQRADYALFK 247 
251798710  184 KRHSKSKQAGSA-FALTEAETRLIIDEKLRQAGWEVDSQTL-RYGLGTRPEKGRNLAIAEWAL------KTGFADYALFC 255 
150388682  177 RLKRAASASEM--MKLSEKETRYLIDAQLRKVGWEVDTVNL-RYSKGTRPQKGKNIAIAEWPTnss-vgDHGYADYVLFI 252 
261419105  182 KRRDYSRRAVAN-FELTEAETRLFIDEQLRAAGWEADSEKL-RFAKGARPEKGRNLAIAEWPL------RHGVADYALFI 253 
297530926  182 KRRDYSRRAVAN-FELTEAETRLIIDEQLRAAGWEADSEKL-RFAKGARPEKGRNLAIAEWPL------RHGVADYALFI 253 
138894433  182 KRREFSQRAIAN-FELTEAETRILIDQQLREAGWEADSEKL-RFSKGVRPEKGRNMAIAEWPL------KRGYADYALFI 253 
218709367  308 GLKPLGVIEAKKNNKDVSAKLT-EAYRYSKYFDndflrselqqaangqdeldqVAEALPTYLPSWADSHGSstlkmqEFK 386 
42779916   252 GKQLVGFIEAKAKHKKIASVLDsQTKFYARNV--------------------------------YQHEDEIlmpttgEYK 299 
218901961  252 GKQLVGFIEAKAKHKKIASVLDsQTKFYARNV--------------------------------YQHEDETlmpttgEYK 299 
302874004  256 GERLVGFIEAKKFSKDVAGTII-EAKTYAKGVK---------------------EEHTDYVISKWNE-----------YK 302 
161507780  248 GLDFYGIVEAKRWDQDIAGQMA-QPKEYAKEVP--------------------FRSDYHLIGQEMGD-----------YK 295 
251798710  256 GLELVGIVEAKRISKNVEADIA-QAKKYAMQVV---------------------RHGDEIIHGPWGN-----------YQ 302 
150388682  253 GLKLVGIIEAKRMFLDIPSVLDyQCKDYAKNIK---------------------DEHAEYMIDSWGE-----------YK 300 
261419105  254 GLELVGLIEAKRASKDIPADIE-QAKQYARLVV---------------------RHGQEVIHEPWGE-----------YF 300 
297530926  254 GLELVGLIEAKRASKDIPADIE-QAKQYARLVV---------------------RHGQEVIHEPWGE-----------YF 300 
138894433  254 GLELVGIIEAKRASKDIPSDIE-QAKEYAKLVV---------------------RHGNEVIHEPWGD-----------YF 300 
218709367  387 VPFCFSANGRGYKAAAKTKSGIWYRDVRHATNMPKALPEWHRPEEL-VAKLESDDQLTNNWFSRNADMSdLG------LR 459 
42779916   300 APFLYATNGRPYLKQLKDESGIWFWDSRKRLEHSRPLEGWHSPMDL-QMLLEQDDQDADKKLEEESIEK-FS------LR 371 
218901961  300 APFLYATNGRPYLKQLKDESGIWFWDSRKPLEHSRPLEGWHSPMDL-QMLLEQDDQDADKKLEKESIEK-FS------LR 371 
302874004  303 VPFLFSANGRKYIKEIEDKSGVHFLDCRDKKNNPKVLQGWYSPEKL-DDMLNENIEEANKSLDELSFEF-LQsensigLR 380 
161507780  296 VPFIYAANGRPYLEQYKEKSGIWFWDARNPKENAYALEEFHTPEDLaLKLTAKNKDEANKDLADDEDYPqFA------AR 369 
251798710  303 VPFLFSTNGRPYLEQLKHMSGIWFLDARKPTNHPRPLQAWYSPQGL-KDLLKQDTEQAAKDLQDETLDY-LK------LR 374 
150388682  301 APLLFATNGRKYLKQLETKSGIWFLDVRKPANIPKAQQGWMSPDGI-LELLEKDIEAANASLEELPYDL-LRdkdglnLR 378 
261419105  301 VPFLFATNGRPYVKQLEQKSGIWFLDARKSTNHPRPLQGWYTPDGL-KQLLEQDIERSEQRLRDETFDY-LK------LR 372 
297530926  301 VPFLFATNGRPYVKQLEQKSGIWFLDARKSTNHPRTLQGWYTPDGL-KQLLEQDIERSEQRLRDETFDY-LK------LR 372 
138894433  301 VPFLFATNGRPYLKQLEQKSGIWFLDARKSTNHPRPLQGWYTPRGL-KKLLEQDVERSEQFLRDEKFDY-LK------LR 372 
218709367  460 YYQEEAVQATEQAIVNGQQDILLAMATGTGKTRTAIALMYRLIQSQRFKRVLFLVDRTSLGKQALDSFEDTNIKGD-TFN 538 
42779916   372 PYQQNAVLSVESGLKESKRRMLVAMATGTGKTRTAIALMYRLIKTKKCRRILFLVDRKSLGTQTEDSLKDTKFEGL-AFT 450 
218901961  372 PYQQNAVLSIESGLKEGKRRMLVAMATGTGKTRTAIALMYRLIKAKKCRRILFLVDRKSLGTQTEDSLKDTKFDGL-AFT 450 
302874004  381 YYQVDAIKAVEKAIIEGKETALITMATGTGKTRTVLGLIYRLIKTNRYKRILFLVDRTSLGDQAMDTFKEVKLEDLkTLN 460 
161507780  370 PYQLDAIQSLENAIKDGKKRILLAMATGTGKTRTAISLMYRLLKHKRARRILYLVDRNSLGRQTANAIKDNKIGTM-SIS 448 
251798710  375 PYQEDAILSVEGAIDEGQRSILLAMATGTGKTRMAIGLIYRLIKHNRFKRILFLVDRSALGRQAEAAFKDSKLESYhSFT 454 
150388682  379 EYQIDAIEAAEKAIIEGKQTALLSMATGTGKTRTVLGMIYRFLKTGRFKRILFLVDRSALGEQAQDVFKEVKLEDLmTLD 458 
261419105  373 PYQVRAIQAVERALEDKRRSVLVAMATGTGKTRMAIGLIYRLLKAKRFRRILFLVDRKALAEQAEAAFKESRMEHFqTFA 452 
297530926  373 PYQVRAIQAVERALEDKRRSVLVAMATGTGKTRMAIGLIYRLLKAKRFRRILFLVDRKALAEQAEAAFKESRMEHFqTFA 452 
138894433  373 AYQVKAIQAVEKALEEKKRSILIAMATGTGKTRMAIGLIYRLLKAKRFHRILFLVDRKALAEQAESAFKESKMESFhTFT 452 
218709367  539 SIFNVKGLTDRFPEDSTKIHVATVQSLVKRTLQSD-EVM---PVGRYDCIIVDEAHRGYILDKEQTEGEEKFRSEQDFIS 614 
42779916   451 DIYDVKTLEHISPEIETKVHIATVQGMVQRLFYSD--NAnlpTVGQYDFIIVDEAHRGYTSDREMSEEEMEFRDQNDYIS 528 
218901961  451 DIYDVKTLEHMSPEIETKVHIATVQGMVKRLFYSD-NENl-pTVGQYDFIIVDEAHRGYTSDREMSQEEMEFRDQNDYIS 528 
302874004  461 QIYNINGLDEKLIDKETKVHISTIQAMVKRIMYNE-EETnipTVGDYDCVIVDEAHRGYTLDKEMSDSEVQWRDNKDFLS 539 
161507780  449 SIYGLKELSDKVPDASTKIQIATVQGMIKRLFFND-DNSekpSVGQYDFIIVDEAHRGYAEDRGLSDQEYENYDQEEYVS 527 
251798710  455 EIFELQTLDDKKPNPETKVQIATVQGMVKRIFYNEsDEAeipSVDQYDCVIVDEAHRGYTLDKEMSELELEFRDHEDYVS 534 
150388682  459 EIYNIKNLEDRMIDKETKIQVATVQSLVKRILDNQ-DETm-pSIIDYDLIVIDEAHRGYILDKEMDEDEILYRNQDDYIS 536 
261419105  453 EIYGLQSLYDQKPDPETKVHIATVQGMLKRIFYND-RPEdvpPIDQYDCIIVDEAHRGYTLDKEMNEIELEFKDHRDYVS 531 
297530926  453 EIYGLQSLYDQKPDLETKVHIATVQGMLKRIFYND-RPEdvpPIDQYDCIIVDEAHRGYTLDKEMNEIELEFKDHRDYVS 531 
138894433  453 EIYSLQSLYDQKPDDETKVHIATVQGMLKRIFYND-RSEdipPVDQYDCIIVDEAHRGYTLDKEMDEVELQFRDHQDYIS 531 
218709367  615 SYRRIIDHFDAVKVALTATPALHTIDIFGgeqkKPVYRYSYRKAVIDGYLTDQEPPIRIITKLSESGLYLSQGSEVQRLS 694 
42779916   529 QYRRVIDYFDAACLGLTATPALHTTDIFG----MPIYKYSYSEAVLDGYLVDHEPPYVFKTELMEAGIKFEKGDEVQVYD 604 
218901961  529 QYRRVIDYFDAACLGLTATPALHTTDIFG----MPIYKYSYSEAVLDGALVDHEPPYVFKTELMEAGIKFEKGDEVQVYD 604 
302874004  540 KYKKVIEYFDAFKVALTATPALHTSMIFG----TPVYNYSYRDAVIDGYLVDHEPPHLIETELTRDGIHYKKGDKVAKYN 615 
161507780  528 QYRRVVDYFDATAIGMTATPALQTTEIFG----NPVYSYSYQQAVLDGYLVDHDAPVIIQTKLAKEGIHFKKGAEVDVFN 603 
251798710  535 KYRKVLDYFDAFRIGLTATPALHTVEIFG----RPVFNYSYREAVIDGYLIDHEPPMQFETQLKKHGIKWQVGEEVAVYD 610 
150388682  537 KYRAVIEYFDSVKIALTATPALHTSEIFG----KPVYNYTYREAVVEGYLVDHDAPHTIVTKLSKEGINYEKGETVAIYD 612 
261419105  532 KYRQVLDYFDAVRIGLTATPALHTTDIFG----PPVFTYSYREAVIDGYLVDHEPPYQFDTVLKREGITWAKGETVDVYD 607 
297530926  532 KYRQVLDYFDAVRIGLTATPALHTTDIFG----PPVFTYSYREAVIDGYLVDHEPPYQFDTVLKREGITWGKGETVDVYD 607 
138894433  532 KYRKVLDYFDAVRIGLTATPALHTTEIFG----PPVFTYSYREAVVDGYLVDHEPPYQFETVLKKEGITWAKGETVDVYD 607 
218709367  695 NQGELI--NDTLDDEQGFEVADFNRALIASNFNKVVCEELV-NHIDPTN-P--QKTLVFCVNNTHADSVVEELRTAFKAK 768 
42779916   605 VDQQELk-LEEMEDTVQFEVEQFNRKVITEPFNRAVLNKLT-DYVDPTS-K--EKTLIFAVNDAHADTIVRLLKEAYKEH 679 
218901961  605 VDQQELk-LEEMEDTVQFEVEQFNRKVITEPFNRAVLNKLT-DYIDPTS-K--EKTLIFAVNDAHADMVVRLLKEAYKER 679 
302874004  616 KFTGELinGAELEDDVEFEIDQFNKRIVVEAHTRAALEEVA-KYIDPENdE--GKTLIFAASDAHADMIVRVLKEIFKET 692 
161507780  604 QDEKTId-KEKLPDNMNFDIKDFNHRVITPSFNKVVCDELVrNYLDPTD-RdgGKTLIFAATDEHADMVVDLLKKAFKDD 681 
251798710  611 ISSGNVe-KELLQDEINLEVTQFNKTVITENFNRVILEELT-KYIDPES-E--GKTLIFAATDDHADMVVRIFKEELEKA 685 
150388682  613 PVTGEImnSDELEDELKFDVEKFNRQVITESFNRTVLIEIS-KELDPEG-E--GKTLIYAVDDSHADLIVKILKEIFEPY 688 
261419105  608 AVSHTVs-QEYLEDELNIDVSHFNTKVVTESFNRVIIRELV-NYIAPDD-E--GKTLIFAATDDHADLVVRLLKEEFARV 682 
297530926  608 TVSHTVs-QEYLEDELNIDVSHFNTKVVTESFNRVIIRELV-NYIAPDD-E--GKTLIFAATDDHADLVVRLLKEEFARV 682 
138894433  608 TVTGTIs-QEYLEDEVNIDVSQFNTKVITESFNRVIIRELT-NYISPDD-E--GKTLIFAATDDHADLVVRLLKEEFEKL 682 
218709367  769 YSQLEHDAIIKITGDSDKDSTkv-qsMITRFKKERLPNIVVTVDLLTTGIDIPSICNLVFMRKVRSRILYEQMKGRATRL 847 
42779916   680 GDEVEDDAIMKITGYIHKPLE-----AIKRFKNERLPNVVVTVDLLTTGIDVPTITNLVFLRRVQSRILYDQMLGRATRL 754 
218901961  680 GDEVEDDAIMKITGYIHKPLD-----AIKRFKNERLPNVVVTVDLLTTGVDVPAITNLVFLRRVQSRILYDQMLGRATRL 754 
302874004  693 VGGVDDNSILKITGAIKDADL-----AIKKFKNETYPKVVVTVDLLSTGIDVPKIDKIVFLRRIKSRILYEQMLGRATRL 767 
161507780  682 GRPVDDDAIEKITGSIRHPNQ-----EIRNFKNEDYPNIVVTVDLLTTGVDVPAITNIVFLRRVQSRILYEQMLGRATRL 756 
251798710  686 YGAVDDNAVLKITGSIKDPLH-----TIKLFKNERLPSIVVTVDLLTTGIDIPSITNLVFLRRVRSRILYEQMLGRATRR 760 
150388682  689 --GVDNDAIMKITGSVGGGNKkkvleAVKRFKNEKYPNIAVTVDLLTTGIDVPEITTLVFMRRVKSRILFEQMMGRATRL 766 
261419105  683 YGEFDDNAVMKITGSIKDPSG-----AIRRFKNEKYPTIAVTVDLLTTGVDVPAITNLVFLRRVRSRILYEQMLGRATRR 757 
297530926  683 YGEFDDNAVMKITGSIKDPSG-----AIRRFKNEKYPTIAVTVDLLTTGVDVPAITNLVFLRRVRSRILYEQMLGRATRR 757 
138894433  683 YGEVEDNAVMKITGSIKDPSG-----AIRRFKNEKYPTIVVTVDLLTTGVDVPTITNLVFLRRVRSRILYEQMLGRATRR 757 
218709367  848 CPAVGKTAFKIFDAVDLYSTLQSVDTMRPVVVRPKVELQTLVNEITDsetykvieADGRSFAEHSHEQLVAKLQRISSHA 927 
42779916   755 CTDIGKTHFNIYDAVGIYDNLKSYTDMKPVVKQQHYSIDDLYQSLAN--------ANDEKEADFYRDQLIAKIQRKKQSL 826 
218901961  755 CTDIGKTHFNIYDAVGIYDNLKSYTDMKPVVKQQNYSIDDLYQSLAN--------ANDEKEADFYRDQLIAKIQRKKQRL 826 
302874004  768 CDDINKTHFEIFDCVRLYEALKDMTNMKPVAANQNTSFKILKETLER--------TDSKEEKEQTIKKVIAKLQRK---K 836 
161507780  757 CPEIHKDKFRIFDAVGIYDAMNKVTNMKPVVQNPGHNVNYFLHHKEDyfe---iaEDSHQYQVDMAGAVERKIKRLDDQG 833 
251798710  761 CDEIGKDHFMIYDAVGIYETLKPYTDMKPVVTKPTVSLDVLTSELAQ--------LEDEGQGKPHKDQIIAKMQRKKRTW 832 
150388682  767 CPEIGKTHFEIYDPIGVYESLQPVNTMKPVVANPSTSFEDLLTGLEV--------LPTEKQIKNQIDMIIAKLQRK---K 835 
261419105  758 CDEIGKDHFNIFDAVGIYETLKPYTSMKPVVARPQATLTELFDELEQ--------LEQTAHLEYQKEQIIAKMQRKKRTW 829 
297530926  758 CDEIGKDHFNIFDAVGIYETLKPYTSMKPVVARPQATLTELFDELEQ--------LEQTAHLEYQKEQIIAKMQRKKRTW 829 
138894433  758 CEEIQKDHFKVFDAVGIYESLKPYTSMKPVVTRPNISLTQLVEELEG--------LEKTEHLQYQKEQIIAKIQRKKRKW 829 
218709367  928 EFNRLKSREIDSQIKRfdeicqdsAGCNFASLAKTLKQKGPKWSAEVFNKVTNMVGRLEQLKQeINDLRDMPIFTDVDDS 1007
42779916   827 PEEAKQKFTELT------------HGKSIDDWAHELKSVTPEAARE--------QELLFEYVSqYRTQGEKIYISNHDDR 886 
218901961  827 PEEAKQKFTELTN------------GKSIDDWAHELQSVTPEAARE--------QELLFEYVSqYRTQGEKIYVSNHDDR 886 
302874004  837 KLIDENEKLIFKNLCN---------NKTPEEFIKDLKEGDIEVATKAIIRNNALIEYLDE----KYSSDEIIIISDKKDK 903 
161507780  834 RNKFERLAEIPS-------------------VDEWAGKLSKMSKADFMKQWPKF-EQLDQVHPaKKQF-----ISNEQDE 888 
251798710  833 TQKDHDDFKALS------------GGMSIEKFIDDLKSMSVLQASADLQTKKPLVAYIDE----NRGRGHRIYISEHEDK 896 
150388682  836 RSMNEKTMAHFIDLSG---------GQDPTEFIGKIKGMSAEDAKEHIIKNKKLFDMLKEG---TNDPRRAVVISDKEDE 903 
261419105  830 SDRQHEDFRVLS------------GGKTVDEFIDWLKSLPSDELKDGLKEYKSMFRYLDE----NRYRERKQYISHHEDK 893 
297530926  830 SDRQHEDFRVLS------------GGKTVDEFIDWLKSLPSDELKDGLKEYKSMFRYLDE----NRYRERKQYISHHEDK 893 
138894433  830 SDRQHQDFKVLS------------GGKTVDEFIDWVKSLQPDELPVQLKEYKSMFRYMDE----NRYRENKQYISKHEDK 893 
218709367 1008 LLRVETVYGEH-ETAQDFLEAFDALVDKSSNQQEALDVIINRPRDLTRKGLLELQEWFDAQNFNEPTLKKAWKETKNQDV 1086
42779916   887 VTKVERGYGEGnNRPEDYLEGFERFVKENINLIPALQIVCTRPKELTRQDLRELITILETKGFKQSHLQTAWKQTKNEDI 966 
218901961  887 VTKVERGYGEGnNRPEDYLEGFEHFVKENINLIPALQIVCTRPKELTRQDLRELITILETKGFKQSHLQTAWKQTKNEDI 966 
302874004  904 VVSHARGYGKG-KKPQDYINEFKKYIEENKNTIQALEVVCTRPQELTKESLKQLKAILDKDGFNEEYLKTAWKDLKNEEI 982 
161507780  889 VIGTTRGYGQGnNKPEDYIDSFNKFVKENVNVIPALQIVATRPKDLTFDELKDIKLKLEQNGFKENDLQSAWKTTKHEQT 968 
251798710  897 LISTSRGYGNA-DKPEDYLEGFHAFITENLNLIPALTIICTRPNDLTRDELRRLRVELDQKGYSEKMLQAAWRDAKNEDI 975 
150388682  904 LLSHTRGYGEG-KKPEDYLEEFKTFITNNFNKIVALNIVCTRPKELTRDSLKSLKLELDRHMFTEQQLNTAWKEVKNQDI 982 
261419105  894 LLGVKRGYGNA-EKPDDYLEAFGEFIRTNMNKIPALMIVCQRPSELTREELKQLRLELDRRGFSEKKLQAAWREAKNDDI 972 
297530926  894 LLGVKRGYGNA-EKPDDYLEAFGEFIRTNMNKIPALMIVCQRPSELTREELKQLRLELDRRGFSEKKLQAAWREAKNEDI 972 
138894433  894 LIAVKRGYGNA-EKPDDYLQSFGEFIRNNMNKIPALMIVCQRPTELTREELKKLLLELDQKGFSEKKLQAAWREAKNEDI 972 
218709367 1087 AARLIGHIRQAAIGDALLPFEERVDQALEKIKAQKEWSEEQLNWLDRLASSIKDKVVLD---DDTFKTGnYKR-KGGKRK 1162
42779916   967 AADIITFIRQAALGDALVDHEARIKRAMQKVYSLHDWTPRQEKWLERIEKQLLQVPVLApnpEDAFSEEpFRS-RGGYNM 1045
218901961  967 AADIITFIRQAALGDALVDHEARIKRAMQKVYSLHDWTPRQQKWLERIEKQLLQVPVLAptpEDAFSEEpFRS-RGGYNM 1045
302874004  983 VADIIAFIRQQALGSPLESNEERVKRAITKIKKEYKLTKPQENWITRIEKVMLKEVVID---KETLDTGsFKTqGGGFDR 1059
161507780  969 TADIISFIRQAASGSKLVDHDVRIHNAMQKVYGMADWNIMQKKWLKRIENQLLSSTVLGpdaEHAFDDNfYFKrQGGYKQ 1048
251798710  976 AADIISFIRQQALGDPLISHEERIEGAMKKIYDMKVWSKVQKDWLKRIEKQLLQESVLDpnpEKAFEVEpFKS-KGGYKQ 1054
150388682  983 AADIISFIRQQAIGSTLLSHEERIKNAVDRLKKNHDFNKMELGWIERIEKNLLLESILD---QATFETGsFKT-AGGYNK 1058
261419105  973 AADIIAFIRQQALGDPLISHEERIRRAMNAIYRMKPWPPLQKKWLERIEKQLLQEYVLHpdpEKAFDYEpFKS-HGGFKQ 1051
297530926  973 AADIIAFIRQQALGDPLISHEERIRRAMNAIYRMKPWPPLQKKWLERIEKQLLQEYVLHpdpEKAFDYEpFKS-HGGFKQ 1051
138894433  973 AADIIAFIRQQALGDPLISHEDRIKNAMKKIYQMKAWPPVQKKWLERIEKQLLQEYVLHpdpEKAFEYEpFKS-HGGFKQ 1051
218709367 1163 LM-NVFNDELDSILTQFNEFMWDEP 1186
42779916  1046 LK-REFGEEIDKIVYTINDYLYIS- 1068
218901961 1046 LK-REFGEEIDKIVYTINDYLYIS- 1068
302874004 1060 LNeKLFNSNLGDIIKKIKTYMFESI 1084
161507780 1049 IK-KIFPKYADQIIYVLNENLYV-- 1070
251798710 1055 LN-KIFDGEMDTIVTTINTALYTPR 1078
150388682 1059 IN-KIFKNQLDDIIQELNEYLYDDG 1082
261419105 1052 LN-NIFGGQLPQIVREINENLYNYA 1075
297530926 1052 LN-NIFGGQLPQIVREINENLYNYA 1075
138894433 1052 LN-KIFDGQLPHIVREINYNLYNYH 1075
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap