Conserved Protein Domain Family
PRK08599

?
PRK08599: PRK08599 (this model, PSSM-Id:236309 is obsolete)
oxygen-independent coproporphyrinogen III oxidase
Statistics
?
PSSM-Id: 236309
Aligned: 128 rows
Threshold Bit Score: 636.908
Threshold Setting Gi: 222151482
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154686810   1 MKSAYIHIPFCEHICHYCDFNKYFIQSQPVDEYLNSLEKEMiNTIERTgrpDLRTIFIGGGTPTSLSPVQLEKLMDSIHR 80 
57867040    3 VKSAYIHIPFCYRICTYCDFNKYFIDKQPVDEYLDALISEM-QVKNNR---DLETMYVGGGTPTALNMRQLEKLLRAINQ 78 
27468188    3 VKSAYIHIPFCYRICTYCDFNKYFIDKQPVDEYLDALISEM-QVKNNR---DLETMYVGGGTPTALNMRQLEKLLRAINQ 78 
70726334    3 VKSAYIHIPFCVRICTYCDFNKYFIDKQPVDEYIAALIKEM-SFSKTK---QLETMYVGGGTPTALSEMQLERLLQAINS 78 
289550646   3 INSAYIHIPFCVRICTYCDFNKYFIAKQPVDDYLDALIKEM-HTRLNP---NIETMYVGGGTPTALNIKQLEKLLKAINK 78 
49483831    3 VQSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLDALITEM-STAKYR---NLKTMYVGGGTPTALSINQLERLLKAIRD 78 
224476691   3 TKSAYIHIPFCVRICTYCDFNKYFIQNQPVDEYLNCLIKEL-SQPNKK---ELNTMFVGGGTPTALSTQQLEKLLKAIND 78 
73662483    3 VKSAYIHIPFCVRICTYCDFNKYFIHNQPVDEYLDCLIKEM-QYSKTK---VLETVFVGGGTPTALSYEQLKRLLKAITD 78 
229916350   2 AKAVYLHIPFCEHICYYCDFNKVFLKNQPVDDYLDALKREMvLTLEAFpteRIDTIFIGGGTPTALNEEQMARLMDMVRQ 81 
222151482   1 MRSLYIHIPFCNRICTYCDFNKFLIKNQPVDEYLDCLIKEL-SFIDER---DLLTVFIGGGTPTALNEGQLERLLSYIEQ 76 
154686810  81 VLkPSDGl-iEFAAEANPDDLSPEKLKIMKNAGVNRLSFGVQTFEDELLQKIGRVHKQKDVFTSFERARALGFDNISLDL 159
57867040   79 TF-TISG---EFSFEANPDELTYEKVALLKQYGVNRISMGVQTFKPELLKILGRTHKTEDIYDAVSHARKAGIESISLDL 154
27468188   79 TF-TISG---EFSFEANPDELTYEKVALLKQYGVNRISMGVQTFKPELLKILGRTHKTEDIYDAVSHARKAGIESISLDL 154
70726334   79 KF-SING---EFSFEANPDELTLNKVKLLKQYGVNRISMGVQTFKPELLKILGRTHNTQDIYNAVNNARKAGINSISLDL 154
289550646  79 LF-TISG---EYTFEANPDELTFQKVKLLKDYGVNRISMGVQTFKPELLTILGRTHNTQDIYQAVDYANKADISSISLDL 154
49483831   79 TF-TITG---EYTFEANPDELTKEKVQLLEKYGVNRISMGVQTFKPELLSVLGRTHNTEDIYTSVLNAKNAGIKSISLDL 154
224476691  79 NY-IIKN---EYTFEANPDELTNEKVQLLKDYGVNRLSMGVQTFDQSLLKILGRTHNTNDIYQAVNLANKFDINSISLDL 154
73662483   79 IF-EIKG---EFSFEANPDELTLEKVQLLKDFGVNRLSMGVQTFKPELLEILGRTHNTSDIYQAVTNARAVGIPSISLDL 154
229916350  82 HLlPLASddlEYSVEANPNFVSAEKLDTMKAGGVNRLSFGVQTFDDGGLERIGRTHRADDVFETVSEAAKR-FDNISIDL 160
222151482  77 SF-TIHE---EFTMEANPDELTRNKIALMKQYGVNRLSLGVQTFDNDLLKSLGRTHQEQDIFNAVSAANELGIESISLDL 152
154686810 160 MFGLPGQTLADLDNSVKTALSLDAEHYSVYSLIVEPKTVFYNLMQKGRLHLPAQEQEAEMYETVMRQMSEAGIRQYEISN 239
57867040  155 MYHLPQQTIDDFKDSLERAIALDIDHISSYGLILEPKTQFYNLYRKGHLKLPNEDLGAEMYRFLMERMKNSPFHQYEISN 234
27468188  155 MYHLPQQTIDDFKDSLERAIALDIDHISSYGLILEPKTQFYNLYRKGHLKLPNEDLGAEMYRFLMERMKNSPFHQYEISN 234
70726334  155 MYHLPEQTIDDFADSLNQAINMDIDHISSYGLILEPKTQFYNMYRKGKLKLPNEDLGAEMYQYLMKTLNQTDFKQYEISN 234
289550646 155 MYHLPQQTLDDFKDSIERALSMDINHISSYGLILEPKTQFYNLYRKGKLKLPNEDLGADMYQYLMHRLNHSKFQQYEISN 234
49483831  155 MYHLPKQTIEDFEQSLDLALDMDIQHISSYGLILEPKTQFYNMYRKGLLKLPNEDLGADMYQLLMSKIEQSPFHQYEISN 234
224476691 155 MYHLPGQTIHQFEESLDIALSMDINHISSYGLILEPKTQFYNMYRKGKLKLPNEDLGEEMYDLLLDKIQNSNMHQYEISN 234
73662483  155 MYHLPKQTIDDFKDSLEKALAMDIDHISSYGLILEPKTQFYNMYKKGKLKIPNEDIGEEMYEYLLERMQRSELHQYEISN 234
229916350 161 MFGLPEQTLEQIDRDLALALQLPIQHVSSYSLILEPHTVFAIQDRKGKLRLPGEDVEVEMYLKVMETLERHGLKQYEISN 240
222151482 153 MYHLPTQTLEQCRRDLALATSLDIHHISSYSLILEPKTQFYNMYKKGMLQLPDEQLAAEMYTLTMNTLSAQGFHQYEISN 232
154686810 240 FAKPGYESQHNLTYWSNEEYFGFGAGAHGYISGTRTVNAGPVKHYMQLIEEKGLPYRDTHEVTREEQIEEEMFLGLRKMS 319
57867040  235 FGKLNHESNHNKVYWLNEEYYGFGAGASGYVNGVRYTNLNPVNHYIKAINEGKKPILSETSPTYNERMEEEMFLGLRMNQ 314
27468188  235 FGKLNHESNHNKVYWLNEEYYGFGAGASGYVNGVRYTNLNPVNHYIKAINEGKKPILSETSPTYNERMEEEMFLGLRMNQ 314
70726334  235 FAKTNHESDHNKVYWFNEEYYGFGAGASGYVEGERYTNLNPVRHYIDAINNGKRPVLTSSCPTLNEKMEEEMFLGLRMNQ 314
289550646 235 FAEKGHASTHNMTYWKNEEYYGFGAGASGYVNGKRYTNVNPVNHYIKAVQADKPPMLSFTIPTIKEQMEEEMFLGLRMNK 314
49483831  235 FALDGHESEHNKVYWFNEEYYGFGAGASGYVDGVRYTNINPVNHYIKAINKESKAILVSNKPSLTERMEEEMFLGLRLNE 314
224476691 235 FSQVNHESEHNKVYWKNEYYYGFGAGASGYVDGVRYSNVNPVNHYIKKIKNGEKPILQSTIPNFKEQIEEQMFLGLRMNK 314
73662483  235 FGKMGHESEHNKVYWKNEGYYGFGAGASGYVDGERYSNVNPVNHYIKKIKNNERPLLESTRPTKNEQMEEEMFLGLRMNQ 314
229916350 241 YGLPGRESRHNQVYWRNEEYYGFGAGAHSYLNGTRRANIAPIPHYIKA---EGIPVKRVTELEEVEKMEEELFLGLRMRS 317
222151482 233 YAKGHHESTHNKVYWQNKEYYGAGAGSHGYIDGVRYYNIAPVPHYIKAM-HKGDAVKERIPVTVDAAMEEFMFLGLRLNE 311
154686810 320 GVQKQAFLDKFGRSVDELFPDVLKDLTEKGLICDTEESVALTHEGKLLGNEVFGAFLGEL 379
57867040  315 GVSKSRFKKKFNKLIDEVFGETIKDLRCRGLIKEEGEFISLTERGKVIGNEVFEAFLLNS 374
27468188  315 GVSKSRFKKKFNKLIDEVFVETIKDLRCRGLIKEEGEFISLTERGKVIGNEVFEAFLLNS 374
70726334  315 GVNRERFKLKFGQTLDDIFGETIYDLKSKQLLIETDGNISLTERGKVIGNEVFEAFLLN- 373
289550646 315 GVNIIRFKQKFDQSIYQVFGQTIHDLSQKELIKQNSNYLALTERGKVIGNEVFEAFLLS- 373
49483831  315 GVSSRRFKKKFDQSIESVFGQTINNLKEKKLIVEKNDAIALTNRGKVIGNEVFEAFLIND 374
224476691 315 GVSKKTFENRFDKRLDDIYSNELNDLISKGLIEDKGEYVKLTERGKVIGNEVFEAFLID- 373
73662483  315 GVNKARFKEKFDLSIDEVYGTTIEDLLKRELIVDNQGFISMTERGKVIGNLVFESFLLNV 374
229916350 318 GVSLQTFEQKYGVSLDDVFGHVIEELVKKSLIERTDTHIRLTASGLPLANEAFAAFIGEA 377
222151482 312 GISKNEFLARYKTSYDDVFKDVTTELVKEGYLIEMNDRISLTALGRMRGNDVFEKFLLTV 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap