Conserved Protein Domain Family
PRK08207

?
PRK08207: PRK08207 
coproporphyrinogen III oxidase; Provisional
Statistics
?
PSSM-Id: 236187
Aligned: 90 rows
Threshold Bit Score: 495.938
Threshold Setting Gi: 257065831
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289450473   1 MKIFFNSEVDAygiqDLLRLFFGTCTRlveptnnvllgfavdladnlaegsakEFaedl----twaiLAEDDDCRIfe-- 74 
51893563    4 ILLRGNSPVFAsdltQMGHVFFPGEPFavw---------------------vpGS------------PEPAGGDAVwqv- 49 
269798269   1 ---MVNGYLYTgplpLGSVVAHNCGAA--------------------------GLfsdkvhpevileAHEVEGIYTltv- 50 
257065831   1 MKFYVANNKKRkqvyDILNIFYDHDDL--------------------------VFd------------------------ 30 
167629916   3 VCLRGMPPGYGvtlqEILWIYFPDAQF----------------------------------------VEDDDFSTEggcv 42 
89895194    5 LRSHTLSRSELeaglSLSRAFFPEAQI--------------------------EVed--------lsGENNAAGCGvgii 50 
258516508   4 VFLTAHDKDFLpgmqDVLRLFFQDQSI------------------------------------------HTASTAVpaee 41 
134300714   3 IGLSNTAFEYKgtiqDIIWLFYPGAEL--------------------------VA------------EDKGDFLLQlnl- 43 
297616959   3 LLLQTDPPTMTawlhDVVRLYYPGWKI--------------------------EV------------EDSGQAEGRmriv 44 
296133429   2 KVRIDAEKGFDrvchDILRALLGPVEFva-----------------------pGF--------------LSQADLDisi- 43 
289450473  75 --------------------lSGMHGWTSDCLNTTDACLNLNLaenraavlasarllacrddslnlliqiglvgkpaefc 134
51893563   50 ------------------dvtARPGGAPAADPGADAAVPLPPAarpwrvvvtargpggsrra-egelvqgaeesprtfeh 110
269798269  51 ------------------tigDTIKIFEGPVSSMG--------------------------------------------- 67 
257065831  31 ---------------------EDASLKVYDKEIIFRERKIEYE------------------------------------- 52 
167629916  43 a----------------aaagTAEVCFCEKAKDEGLPMLAARFchagrvglgqallspdgekeggdsdtayddhrreren 106
89895194   51 hidihypdtpwqiegsfrglsCGTKLGSGKSSVILNEEQIKFIlshpya---------------------------gked 103
258516508  42 d---------------lqiraNATKQNNRLTAVVSLKKDRQTIthyetaedn----------------------pvdsqn 84 
134300714  44 ------------------sqeVEFNLWAEAQLYVNGASLAQREeghplip-------------------------aevpn 80 
297616959  45 ------------------rsqSKGKVEVALTVEDRNGTIRERImleagdekn----------------------sedvek 84 
296133429  44 ------------------tatSGRKLFAGATAVKGGSRDMECIkedvlia-------------------------geahn 80 
289450473 135 rpKRDNKRLLYFALCKlt-gkTFP--WGSLTGIRPTLIAAEAMKITPNHAAAENLLVRYYGVSLFKAQLALTTAREEQHI 211
51893563  111 rlRRLAKGLLVDALAPla-gfRPK--WGILTGVRPTKLVHQMLDE--DEPDPVARLTGEFRLAREKAELVTGVARLQRPF 185
269798269  68 --RRQIGQALLRYLREyq-glPAEapWGTMVGVRPTKLLHKYIDTYGSVHAATRHIRDEFSVSMEKLATLGAIGEYQRPF 144
257065831  53 --EADLKRTLYELLVKet-gyQSP--WGYLTGSKPSKLLEKM---------SLADLKEKYLISDKKLKILEDIRNLQESM 118
167629916 107 arRRAAKLALLRALEDysgarPNT--WGILTGVRPAKIVHRRLDQGKDLRSIRAELLRDYALLPEKADLLLEIALRQRPF 184
89895194  104 krKFLLKRGLLSLLAQvt-ghTPP--WGILTGIRPSKILHRLKEAGYSSEERAASLGEVYAIREDKSQLLQEVVDIQQPF 180
258516508  85 esKRLVRLALFRLLEKttgetPSP--WGILTGIRPTKVLQRLFDTGYERREIINKLVAEYAVFPNKAELITSIASVQRKF 162
134300714  81 elKRLARMAVYKILVSysgttPSP--WGIMTGIRPTKVVHRLLDLGWSKQNVENYLLDKYALRPDKTQLITSVTEIQRPL 158
297616959  85 evRRQIRLITYRLLARhtgkeGNP--YGILTGVRPTKLVQRWLDEDLPTEQVETRLENQYAIRRDKAKLLTEIALRERPY 162
296133429  81 qlKRMVKQAVYRSVLKvcglkPLP--YGILTGIRPTKIVHRLLDMGWDKETIREHLLKSYDMDEVKAEGLLKVALNNRKY 158
289450473 212 Lrq--lPPDTCGVYIAIPFCPTRCLYCSFSTNEgIDPPNDLINRYIDALSEEIELT---FAQLPFKISTLYVGGGTPGIL 286
51893563  186 Lg---rDPRAVSLYIGIPFCPSICSFCSFSIYP-INQHRDQISPFLEALGREMAIIgqaIRDLGLRVESIYFGGGTPTSP 261
269798269 145 Lsd--tdDKKVSLYCGIPFCDTRCVYCSFPYGL-YQDYAGK-SQFLRALNRDIEDMksiVDSYGLTVDTLYMGGGTPTVL 220
257065831 119 Sf----DPQDFSLYINIPFCPTRCKYCSYPT---IVGDRKEKGEYISSLIYEIENI-----NLPEGLDAIYIGGGTPSFI 186
167629916 185 FysspdARRKVGVYIGIPFCPTRCLYCSFPGYD-VKKFKGWLEPFLDSLRKEIEAVgsaLCQAGQQVQHIYIGGGTPTAL 263
89895194  181 LedmksHPQDVAVYIGIPFCPTRCSYCSFPAYS-LKQGREPLEHYLQGLGEEIRTAgawMKAGGLTADSLYLGGGTPTIL 259
258516508 163 LpantqAEKTVSIYIGIPFCPTRCLYCSFTAYP-VKKFKAWVEPYLNALIKEIKETgraLKENGLSVQTIYFGGGTPTSI 241
134300714 159 LlskkqAKKLVGVYIGIPFCPSRCLYCSFPSYS-IKRHRDMVDPFLKALLQEIQVIgetLRSQGLLVQSIYLGGGTPTSL 237
297616959 163 LmdndaASRYLSVYVGIPFCPSRCHYCSFLGAT-VTDYSRQVTPFMEALGREVEVFgqvTKDLGFKVQSIYVGGGTPTVL 241
296133429 159 IlgpeeAEQTVSLYVGIPFCPTRCAYCSFPAYP-VSKYAGMIAPFVVALKKEIAGIagfLRAEGWQVQTIYLGGGTPTAL 237
289450473 287 SAEQIARLGQIIHRNIeFIPGA-ELTFEAGRPDRVDQPALSAVYEAGFQKICLNPQTFHDRTLALVNRQHTVEQLISTYE 365
51893563  262 RDEDFAWMLRTAAETLlKGQSPaEYTIEGGRPETFNRYKLDVMAAHGVTRVSVNPQTTVQATLMHLGRIHTVEKFYRAYD 341
269798269 221 EDEDFHQVLKQLSLLV---SEGhEFTVEAGRPDSVNPTKLRSMLELGVNRISINPQTMQDDILRRIGRGHSVRDVDELLQ 297
257065831 187 DEDDLERLLYAINNKF----SYkEFTFEAGREDTLNTRKLEILKAGGVGRISLNPQSFNKEVVERAGRTYDYDHLLEIYQ 262
167629916 264 SSEQLERLFCWVNRHLrGPETV-EFTLEGGRPDTLDRDKLQRAFVGGVNRLSINPQSMNAATLKRIGRCHRPDDVVEAVE 342
89895194  260 TIREMEGLIALMMTHIpH-REAgEFTVEAGRPDTLSEGKLLALRASGVNRLSVNPQTMHNRTLQRIGRAHTVEDIIKAYE 338
258516508 242 NPEQLASLLNNANSCLrGPQTI-EVTMEGGRPDTLTEEVLHICSAAGVDRLSINPQTMLDQTLKLIGRNHSVEDIYRAMQ 320
134300714 238 NCEQLQSLLEAIQLSLkDDSTI-EMTVEGGRPDTLNEDVFALLANAGVNRLSINPQSMNQKTLDIIGRAHTVEDIYRSVE 316
297616959 242 ACNDLEVLLEWLNRYFvS-AATrEITVEAGRPDTLTAEKLRLLREAGVTRISINPQTMNDATLRAIGRSHSVEEVVRAFE 320
296133429 238 EEKILSELLESLDKAIp-FTTVrEITLEAGRPDTLTREKLAVSRKLGVTRLSINPQSMNPRTLNNIGRLHTPEDIESAFK 316
289450473 366 MARRMPFt-NINMDLILGLPGETEADMRYTLKKLESLAPDSFTLHSLAIKRASNLKLQaedwlDVGavHRR------NKV 438
51893563  342 LVRSHPAgfTVNTDIIIGLPGEGPAEVHHTLEDMRRLAPDNLTVHTLAVKRGSRIHAAgaageVLR--ALT------PAE 413
269798269 298 YVKNNTSl-AVNMDFIAGLPNQTMSNMIENMDYVCQNLPENVTIHTLALKRGSPLYDLh---mEDD--IPE------ENL 365
257065831 263 GAKDLGF--IVNMDFIIGLIGESSELFRRNFEVLEALRPDNITFHALAMKVGSKYFEGk---vKAE-----------RGE 326
167629916 343 LARAIGFp-IINMDMIIGLPGENADSVRATLDRIAPLCPENLTVHTMAIKRASRLMAEr---eQWS--LPA------ADE 410
89895194  339 LAREIPGw-VINMDLIMGLPGEGAKDIQETLERIRALEPDNLTVHALAIKRGSKEHEQgstqnL-------------GRE 404
258516508 321 SARAAGFp-VINMDIIVGLPGENETSVMQTIELLKPLKPENLTVHALALKNASLLKQEi---aQHN--MPA------AKE 388
134300714 317 TARNYKFp-TLNMDLIIGLPGETVQDVARTMESILQLKPENLTVHALALKRASNLKQRlaefpLLQ-----------AEE 384
297616959 321 LARHEGLr-QINMDLIVGLPGEGMKEYTNTADRILQLKPENVTVHVLAVKRGSVLAET----------ERGvgareqIEQ 389
296133429 317 MARQAGFn-NINMDIIIGLPGETAPDVENTLLKIEPLAPENLTVHTLAVKRASQIRENr---eRYE--LPE------ETE 384
289450473 439 LESLQEEGRALANRLWLVPYYMYRQKDGVGGLENLGYARPGCGNRYNLAMMGDGLSILSFGAGAMSKAVSGD------KV 512
51893563  414 AEALVQDAAETARAMGQRPYYLYRQKFMVGSLENVGYALPGKESLYNIQMMEERQTVIGLGGGATSKWFKPLgegrgwLL 493
269798269 366 VAEMVQYGKERLEAAGYMPYYLYRQQYMRGQLENIGYTLPGKACEYNIQIMEERQSILSMGPGSSSKWMRAPe----yRQ 441
257065831 327 SLKISQMIEDFVEENSYKPYYLYRQKNIVSNLENIGYERGDSSQRYNIIINEEKESIIGLGMNANTKLMNGKk------- 399
167629916 411 VEAMLAVTRSGARDLGLVPYYLYRQKRILANQENVGYTVPGRECIYNIHVMEERQTIWGIGAGAATKIVCAEdg---eIL 487
89895194  405 LEGMQEDIMAAVRSMGMEPYYLYRQKHIAGNLENIGFAKPGLACRYNIGIMEERQTVIGLGAGASSKIVDPRd----fSL 480
258516508 389 VLKMWEIAQKGCGDMGMLPYYLYRQKRITGNLENIGYALPGKECIYNIQMIEERQTIIGLGTGGSSKLVQADk----qHL 464
134300714 385 AVAMWQETARGATALGQHPYYMYRQKQMVGNLENIGYALPGHECIYNIQMIEERQTIIGLGVGAGSKWMDPDt----wTL 460
297616959 390 VERGIEMFRNRLTGTGYEPYYLYRQRYMAANMENLGYSLPGCYCLYNILMIEERQTILGLGAGTASKFVNPGs----wTL 465
296133429 385 ITKMLAITEEYTEKWGMHPYYLYRQKYMVGPTENRGYAVEGYDCIYNIQVIEERQTIIGLGAGAGSKFVNPAd----wTL 460
289450473 513 ERSPNVRSIQAYIERHREMSERKIILFRQMND 544
51893563  494 KAPANPNDPQAYVERVEELARRKVAELRLLYG 525
269798269 442 LKQHMPKDVDVYHVTIDALLEKRHKICERFWE 473
257065831 400 --FRNSRNLRDYFDKVQEEIWAKNEMINEYNI 429
167629916 488 DTWHNPKDPMNYVERLDGIIGRKLKKLEGT-- 517
89895194  481 VSFHHPANWQVYLKRWRETQRKREEAEKSLAK 512
258516508 465 NRY-NPKDPLLYIERIDELISRKLKEITDQGS 495
134300714 461 VNEYNAKDPRQYVERLDEYIERKLHHIRELST 492
297616959 466 TSLYSPKNPLSYVESLSRLIRNKVDKLGALT- 496
296133429 461 TNLYNPKDPEAYINRVDELLEKKISRLEQVKN 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap