Conserved Protein Domain Family
PRK05904

?
PRK05904: PRK05904 
coproporphyrinogen III oxidase; Provisional
Statistics
?
PSSM-Id: 235641
Aligned: 5 rows
Threshold Bit Score: 457.348
Threshold Setting Gi: 26553953
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13357834    2 IFNKKTKHLYIHIPFCNYICIFSDFKRi-lKTPQTKKFFKNFLENIKMHINNfKIKQFKTIYLGGGVPNCLNNQELEILL 80 
26553953    1 MTKNKVEHLYIHIPFCQEICTYCDFYR---TKTKDPNIINSYVKKIVSEIKE-DNNQYKTIYIEGGTPNFLNDNLLDELL 76 
31544373    1 ----MTKHLYIHLPLCQKICTFCDFKReliDRHNPKKVVQDLIDEIER--KQfSDEQFSSIYLGGGTPNVFDDELLDYFL 74 
170762029   2 IFNKKTKHLYIHIPFCNYICIFSDFKRi-lKTPQTKKFFKNFLENIKMHINNfKIKQFKTIYLGGGVPNCLNNQELEILL 80 
209554476   2 IFSQNTKHLYIHIPFCNHICTYSDFKRi-lKTVQSKDIFKDFLKDVQMRIKNfKTKQFETIYLGGGVPNCLSNCELKQLL 80 
13357834   81 KTISPYVDDNCEYTIECNPELINQTQINLFKKYKINRISLNVQSMNNDVLKQMNFIHTNQDSKKAINLLHKNGLYNVSCD 160
26553953   77 SPLKNKLQNNYEFTIEANPEFITSSQIETLLKNNVNRISMGVQTTNNNILKLLRRTHNIENVIEAINLLHKHNMKNISCD 156
31544373   75 SKIKKYAAKKCEFTIECNPDLVTKSQAQILKKNLVNRASVGIQIVNNKILKYLNRTHDINHCYEAMQNLYDAGITNINID 154
170762029  81 KTISPYVDDNCEYTIECNPELINQTQINLFKKYKINRISLNVQSMNNDVLKQMNFIHTNQDSKKAINLLHKNGLYNVSCD 160
209554476  81 QTIFPYVSNNCEYTIECNPELINQTQINLFKKYKINRISLNAQSLNNNILKKMNYIHTNQDIKNAIDLFYKNKIFNISCD 160
13357834  161 FLFCISILTLKDLDDVFNFILNHKINHVSFYSLEIKEQSLLKKYHITIDEEKEIEQMNYIINKFAGLNFHRYEVCNWTNN 240
26553953  157 FIYNLPLLKNSDLEETFNFIEKYKINHISFYSLEIKEGSILNKQKYQINVDKEEHHLEQIKAYFNKLNYYRYEISNWALE 236
31544373  155 LMYALPHMKKEDVLENIKFIKKTKPNHISFYGLDLKPGAYLTKTPYKIDLDQEAMQLRVMKAELNKINYKRYEVANWCRL 234
170762029 161 FLFCISILTLKDLDDVFNFILNHKINHVSFYSLEIKEQSLLKKYHITIDEEKEIEQMNYIINKFAGLNFHRYEVCNWTNN 240
209554476 161 FLYCLTMLTLKDLDDIFDFIVQNKINHVSFYGLEIKDESILKKLNISINEDQDAEQMSYVNNKFASLNFKHYEVSNWVSD 240
13357834  241 FRYIAKHNLAYWRTEDWAAIGWGAHGYEKNIVYFFDGSIKNPILIKKVLTKHELYQQILMMGLRLKDGLNLNKKINYEAY 320
26553953  237 PAYYSKHNIAYWDLKDWKAIGISGFGLENNIYYKNNGTILDWKKEESEWDDNELFENIFIMGLRKTNGIDLSVERNKKAY 316
31544373  235 KKYQSVHNKAYWLTKDYAAIGWGAHGFENKVEYYYDGSIQNWQIKKNRLTDDQFYQRVLIMGLRLKDGVDITKEPYKTAY 314
170762029 241 FRYIAKHNLAYWRTEDWAAIGWGAHGYEKNIVYFFDGSIKNPILIKKVLTKHELYQQILMMGLRLKDGLNLNKKINYEAY 320
209554476 241 LKYVAKHNLAYWQTKDWAAIGWGAHGFENNIEYFFDAPVQKPVLIKKMLTKYDIYQQILMMGLRLKEGLNLNEKINNDAY 320
13357834  321 SYFKNQLKH-VSINKKNHLLIDDLNLLNLTILDIF 354
26553953  317 LYLKNKINHnLVIIENNYIRAKNIDLLNDILIDII 351
31544373  315 EKYQNKLKF-ITV-KNNHLRADNIDLLNNSIIDIL 347
170762029 321 SYFKNQLKH-VSINKKNHLLIDDLNLLNLTILDIF 354
209554476 321 LYFKDKLKY-ISINKKNHLVVDDLNLLNSSILDIF 354
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap