Conserved Protein Domain Family
PRK04195

?
PRK04195: PRK04195 
replication factor C large subunit; Provisional
Statistics
?
PSSM-Id: 235250
View PSSM: PRK04195
Aligned: 82 rows
Threshold Bit Score: 410.081
Threshold Setting Gi: 48477945
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20093445    2 VPWVEKYRPRSLKELVNQDEAKKELAAWANEWA-RGSIpePRAVLLHGPPGTGKTSAAYALAHDFGwDVIELNASDKRTR 80 
124485323   1 MDWAEKYRPMHLADILGNGSAVRQIVDWAKTWTpD-----SRPLLFTGKPGIGKTSAALALARDMDwEVLELNASDARTK 75 
88602207    1 MDWAEKYRPRHLNEMVGNREALHQMSEWATRWTvE-----SPPLILYGKPGIGKTSSAWALAHDMNwEVVELNASDQRTK 75 
292656553   2 VDWTEKYRPSTLSEVRGNNKARDALAEWAKTWDdH-----REAVVVHGSPGIGKTSAAHALAADMGwETVELNASDQRTG 76 
16082282    2 MSWADKYRPKNIDDVILNSEIRKQITEWIESWK-EGIPk-KRSLILYGSQGTGKTTTAYAIAGTFGvPVVEMNASDQRNR 79 
13541365    1 MEWADKYRPKRIEDLIVSEEIRQKIQSWIDAWE-EGSPk-KRALILYGVQGSGKTSAAYAIAGTFGlPVVEMNASEQRNR 78 
126178781   1 MDWVEKYRPQHLQDVVGNSGAVRLIYEWARDWSrQ-----KKPLILYGKPGTGKTSSAYALANDMNwEVVELNASDQRTK 75 
222480222   2 ADWTEKYRPSTLSEVRGNDKARDAFADWARSWDdH-----HEAVVLHGSPGVGKTSAAHALANDMGwETVELNASDQRTA 76 
110668631   2 TDWTERYRPTTLSAVRGNNAARDEFIEWAESWDdH-----HESVVLHGAPGVGKTSAAHALASDMGwETVELNASDQRTS 76 
154150617   1 MEWAEKYRPEHLADIVGNTSAVRQMADWAKTWTaR-----SKPLLLYGKPGIGKTSSVYALARDMNwDVIELNASDQRTA 75 
20093445   81 NVIEKIVGGASTSRSLLrmtReaggdyehveghSDRVLVLVDEVDGIDP------REDRGGVTALTRAVRQARNPMVLVA 154
124485323  76 TIIERVAGNSSTTTSLF---G------------AGRKLIIIDEVDNLEG------NADRGGARAIADILKEAKQPIVLIA 134
88602207   76 AVIEKVAGGSASTGSLT---G------------AARKLIILDEADNLQG------NADRGGARAIAEVIRQARQPLILIA 134
292656553  77 DVIERFAGRAAKNATLA---Gssa-------gtSTRQLVILDEADNIHG------NYDRGGASAVTRLVKSSSQPIVLIA 140
16082282   80 DSMRGTALMASLYGDLFves-----------akRPSKVILIDEADNMFEr-----GGDTGGIYELSKIIKNSANPIVITM 143
13541365   79 ESMKATALMASLYADLGasd-----------frKPSKVILIDEADNIFEsnnpkrGGDTGGVYELSKIVKETRNPVIITM 147
126178781  76 AALERVAGAGSTTASLS---G------------ASRKLILLDEADNLHG------QADRGGAKAIVEIIAAAQQPIILIA 134
222480222  77 DVIERFAGRAARNATLG---GsaagggaaggdtASRQLVILDEADNIHG------NYDRGGASAITELVKESGQPIVLIA 147
110668631  77 DVIERLAGRAAKNATLA---Gavs------gttSTRQLIIMDEADNIHY------QYDRGGKQAVTTLLKDANQPIVLIA 141
154150617  76 AVIERIAGAGSTTASLT---G------------SARKLIIMDEADNLQG------TADRGGAKAILECIKNARQPIVLIA 134
20093445  155 NDPWVLPK-----SLRDAVRMIEFRRLRVN----------DIVEALRRICEREGIEYEEVALRRIAKRARGDLRAAINDL 219
124485323 135 NDAYGVSD-----SIRRLCDPVPFRAIGVS----------TLQKRMKEICRFEDIACGEDALSAIAESSAGDMRTAVNML 199
88602207  135 NDLYGLDG-----TIRNLCTKVQFKALPAK----------SLVPRLREICSREQLTCSAQALTDIAEQSGGDIRSAVTML 199
292656553 141 NEFYDMSR-----GLRNACQEIEFRDVSAR----------SIVPVLRDICRKEGLEFESDALDRIAEMNSGDLRSAVNDL 205
16082282  144 NDIFEFRKknyasDVISASLTIEMKQYGRKldknynefrrNIKARLIFILKNEGYTLPDQVVDRIIDRNMPDIRSMINDL 223
13541365  148 NDFYEFRKknyssEVINNSESIEFKPYARRldrnynefkkNVRNRIKWIINQEGFSLPDDIINSIIDKNAPDIRSIINDV 227
126178781 135 NDYYSLTR-----ELKAVTEPVQFRALQAR----------SIVPRLRQICAAEGVACDPAALDDIANRAGGDMRAAVNML 199
222480222 148 NDYYDMAR-----GLRNATQEIEFRDVSAR----------SIVPVLRDICRKEGIEFESDALERIAERNRGDLRGAINDL 212
110668631 142 NEYYDMSR-----GLRNAAQDIEFRDISAR----------SIVPVLRNILRKENIEFEEAALKQIAEVNSGDLRAAIKDL 206
154150617 135 NDLYGLAA-----ELRLRCEPVQFRALPAR----------SIAPRLKYICSSEKIACSESAVHEIAESAEGDMRSAVNML 199
20093445  220 EALARPTGRVTSDDVEALGW-RDKEITIFEALGRIF-NKPPRQARRALWnLDEDPDDVILWIAQNIPRAYRDPEEIARAY 297
124485323 200 FGSSTGKTSISVGDINTAQ--KDERATIFDLVGGVFaGAPDRELQKLSFeCDEKPDSVMQWIEESIPLMHDP-KRRIRAY 276
88602207  200 YASAIGKDTVGEDDVSISA--KDSRASIFDLVAATLgYRQVPSLLDMSMsVDETPDTILQWIEGNLGVLPDR-KKTAQAY 276
292656553 206 QAIAEGREKITEEDV--VMGdRDRSVGLFEFLDAVLkEESAQDALYTAYdVDETPDDLTKWVEDKVSLVYEP-DELARAY 282
16082282  224 EASAVSGTNISDQSS------RDVPEIVYYMVDKAFk-RNYDDTLRSIYgSDIDDSYYVSWIDENLPLKTVDLQDLVSAY 296
13541365  228 EAAAVSQSSISQNND------RDTVESVYYLVDKAFk-KNYDDTLKSIYgSDVDSDYFINWVEENLPSKTDDISDLNSAY 300
126178781 200 YAAAIGKEHLAAGDVHTSA--KDERSTIFELVGATFkGKRDADLLRMAVeVEDTPDAIEQWLEGNLDHM-PDLASRAEGY 276
222480222 213 QAATEGRDSIAVEDV--VTGdRDKALGLFPYLDAVLkEESAEEALQSAYaVDETPDDLTKWIENNVLDVYDP-SEVVRAY 289
110668631 207 QTTVEGSDRITVDDVKTGG--RDRAMGLFSFLDSVLkEDAAEEALQNSYdVDETPDDLLKWVEDKVPLVYDD-AELARAY 283
154150617 200 YASAIGRQSLDGKNVHTSQ--KDERVSIFSLVTAVFgKTSDEELIRLSRdVDEFPEDIEQWVEGSVHTI-TDPAGLGLAY 276
20093445  298 DYLSKADVFSSRAIETG-DWRFkYVYATDLMTSGVAAARKGKPPGFV-RFQPPKILRKLGTTRKEREVRNSIAKKIAERM 375
124485323 277 GRISRADVYLGRTMRRQ-YFTL-WRYATSMMTLGVA--SENAGAGFRtRIMPPSRWKRMSTAKKQKTVRRTLAASLAEGY 352
88602207  277 AALSRADMYLGYTFLTQ-YYTL-WRYATSVMLYGVHDVMKGRPSGYA-KIMPPSRWRQMSVAKKQKTIREQLLSDMGTSM 353
292656553 283 DFLANADRWLGRVRATQ-NYSY-WRYATDNLAAGVAASRDRTRGGWT-RYGGAPY------RSTRDKTRDTVVRKIAQNG 353
16082282  297 EVISYADHILWAMERRR-HYEL-MAFPME-IAGGVAYYIENMKHEYV-KYQSPSYISQMSKTKEKRHAMMSLALKIGLLI 372
13541365  301 EQLSFADHILWAIERKR-HFDL-MTFPME-IAGGLAYYIENPKHEYV-KFHSPSYINSMSRSKERRHALNAVSLKIGLLL 376
126178781 277 ACLARADEYIGRTYRRQ-YYTL-WRYASAVMLLGVADA--AGGHGVHgRIMPPSRWQKMGASKKQKAVRAGLSRKLSEMT 352
222480222 290 DFLANADVWLGRVRATQ-NYSY-WRYATDNAAAGVAAARDGTKGGWT-RYGRPQFWS------PSDATADEVVGQIAAKS 360
110668631 284 EFLSNADIWTNRVYATDyNYRW-WRYATDNLAGGVAAARETQRGGWT-RYGGAPY------RSTRDSTRDTVVREVAKTG 355
154150617 277 RSLSRADEYIGYTYRRQ-YHTL-WRYATAVMLLGVADA--SAGKGIHsRILPPERWQKMSVAKKQKAIRAAVLSRLAATM 352
20093445  376 HVStRRAKMDVISVLEIAFRKvadNptdrglEILGGIAGYLELSKREIGFLCGDPQVAQRVYQRALRVREKLRKIRRERV 455
124485323 353 SIPeRQIQSEYLDLLSRFAEK-----------DPAAFCERHNLDVDQMGIILHDKAAAAAAVKTVQQAAKERDMKVKKMA 421
88602207  354 HMSaSTVRNLYLCPISLLAKQ-----------FPEQFAKSYDLDVDKLDILIHDPATSKSIIKKIEDEKKQIEKELKKKK 422
292656553 354 GFSmATARREALPYLSAITHHckpR------ELTVAMAAYYEFDESHVSFVTGSGETTNKVQSIVEDAGELREELVEEHA 427
16082282  373 HMG-AQRTSEDLWFYSLLYQHn--E------KLRTFFEEKLNLTQGEENVLTRSE------------------------- 418
13541365  377 HMS-GVESLNYVWFYRLMFKVn--A------GFRDTVYERLNLTQGEEAVLES--------------------------- 420
126178781 353 HIPqDALREDFFTAITILVER-----------DPATYVREFDLDADELNLFIHDKARATKVVKEVAKEEKEKAKKAAAKE 421
222480222 361 GCSvATARREVLPFLEAVTHHckpR------ELTVAMAAAYDLDEAGIAFVTGSGESTNKVASIAEDAQALREERMEDHA 434
110668631 356 GFSmATARTAVIPFLSAITHLckpR------SLTVGMAAWYELDEAGVSYITGSGETTKKVASIVEDAAERRSEAVEAHA 429
154150617 353 QLPqATLREKYMDIITLLVDL-----------DPETFARELALDADGLNFFLNDKSRAQEILKSLAKVEREKEPEPKKKG 421
20093445  456 KGAMESMLERKREESEVEEEAKEIEEAVEKAEEEEEREEKKke--------------------------------gGGEQ 503
124485323 422 ASKKAEMRKLEEQLEALRMQEPPVPETPPAAEEQPLEEPQEek-------------------------------klAPKQ 470
88602207  423 KEEDAKGKKARGSKKEKEPIVEETPSIDSFSSQEPGNPPEQpstep-------------------------vekdkKSSQ 477
292656553 428 AGAFAGMEGVSVDDDAAADDGGDGTDDVLDRDADTDADESAesdds--------------------------daatDDGQ 481
16082282      --------------------------------------------------------------------------------    
13541365      --------------------------------------------------------------------------------    
126178781 422 KAPTKGKKSRDDDPPADTGESRRDP---------------------------------------------------SPGQ 450
222480222 435 EGAFAGGRHAADDLGASDGETTNASGTASSSGDDGDADGTTdgdgsda---------------------ndgndddDDGQ 493
110668631 430 GSAFAETETEEKTNFTGNQDSDVDVQSHKSAESGDDTVRTAntpaedhaqsgasetasatesasdsdastdtdaddDDGQ 509
154150617 422 RKKAESPAKDADPAPAVDPVPKEELPVKSAPEERPADPPAPeepg---------------------------rktvAHNQ 474
20093445  504 RTLDAF 509
124485323 471 ATLDFF 476
88602207  478 STLFSF 483
292656553 482 SGLDDF 487
16082282      ------    
13541365      ------    
126178781 451 ATLF-- 454
222480222 494 AGLSDF 499
110668631 510 AGLSEF 515
154150617 475 STLFDG 480
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap