Conserved Protein Domain Family
MrcA

?
COG5009: MrcA 
Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 227342
View PSSM: COG5009
Aligned: 24 rows
Threshold Bit Score: 885.503
Threshold Setting Gi: 15639692
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15595077   8 LKKIN---THKLLIYLTYFAVSFSiITLSLAVSKTINIQKDKNFGYVNPAVPSRLLDINGKQITQFISdENRELMPLRKM 84   Lyme disease spiro...
15888667   1 MIRLi---GYFFGLASVLFLCAAV-VGAIYLHGVTKDLPDYAVLSTYEPPVTTRVHAGNGALMAEYAH-EKRLFLPIQAI 75   Agrobacterium tume...
17987338   1 MVRLi---GYFFGIGTVLMLLVAG-GAALYIGSLAKDLPDYEVLAKYEPPVMTRVHASDGSLMAEFAR-ERRLYLPIQAV 75   Brucella melitensis
16126118   1 --------MAIAGVAVLSAIAVAGfAIAIYAAWLFHDMPDAGELQDYRPPTATRVYAWDGTLIGEYSK-ERRIFIPYDQI 71   Caulobacter cresce...
15893168   1 MYKSl---LFCLKIFVFLILVGCG-ITAYIIYHYSRDLPDYSQLARYYPPSVTRIYSRDGKLMEEYAF-ERRVFVPINSV 75   Rickettsia conorii
14548189   1 MYKSl---FLCLKIFAVLILIGCS-VTAYIIYHYSHDLPDYSQLARYYPPSVTRIYSRDGKLIEEYAF-ERRVFVPINNV 75   Rickettsia prowazekii
16263688   1 -MKLi---GYIFGITSAALVGIFG-IGAVYLWEVANDLPDHRKLAEWEPALMTRFYAYDGTPIAEYAR-ERRLYLPIAAI 74   Sinorhizobium meli...
15965083   1 MIRLi---GYFFGIGAFLLLGTAA-AVAIYLGAITKDLPDYEVLANYAPPVTTRFHAGNGALMAEYAR-ERRLYLPIQAI 75   Sinorhizobium meli...
15836970  23 MYRLRgwlGWLLTILIILTLVGIL-AAGGMYYAISSKLPDIRNLKQVELQEPMYVYSHDGLLMAIFGE-IRRYPVQIKEV 100  Xylella fastidiosa...
14548174   1 -MKK-----LVIGILGIVIALFVG--LLVFLIPIYKNLPDPKLLESWTPPQASEVYDAKGRLYGTIGI-QKRFYVSIDKI 71   Aquifex aeolicus
15595077  85 PDNLINTLLIREDIGFFSHRGFSLIGIFRAAFNIVLGR----YFSGGSTLTQQLAKLLYTNqARRSILRKLHEIWWAIQL 160  Lyme disease spiro...
15888667  76 PDRVKAAFLSAEDKNFYNHPGVDIWGLGRAILVNLQNLgsgrRPVGASTITQQVAKNFLLT-NDQTIDRKLKEAILSFRI 154  Agrobacterium tume...
17987338  76 PNRVKAAFVSAEDKTFYEHHGLDFGGLARAVVTNLKNIgsgrRPVGASTITQQVAKNFLLS-SKQTYDRKIKEAILAMRI 154  Brucella melitensis
16126118  72 PPQLAQAFLAAEDRNFFQHGGVDVGGLSRAMIKNVGNAvrgrRLEGGSTITQQVAKNVLLT-SDATVGRKFKEAILAHRL 150  Caulobacter cresce...
15893168  76 PSSLIESFIAAEDKNFYNHPGVDLFGIVRAAFLNISNYlhhrRMEGASTITQQVVKNFLLT-NEVSLERKIKEAILSYMI 154  Rickettsia conorii
14548189  76 PSSLIESFIAAEDKNFYTHPGIDLLGIVRAAFLNISNYlhnrRMEGASTITQQVVKNFLLT-NEVSLERKIKEVIISYMI 154  Rickettsia prowazekii
16263688  75 PERVKAAFLSAEDKSFYSHSGIDVLSVVKAAWSNAVNLssgqRLIGASTITQQLAKNFLLS-SDRTLRRKIKEAVLSIRI 153  Sinorhizobium meli...
15965083  76 PDRVKAAFISAEDKNFYQHPGIDVTGLARAIAVNLQNFgsgrRPVGASTITQQVAKNFLLS-SDQTLDRKIKEAILSFRI 154  Sinorhizobium meli...
15836970 101 PEQLKQAFLATEDARFYEHSGIDYKGIARAIWLLATTNe--kRVPGGSTITQQVARQFFLN-SEYSYKRKLAEILLARKI 177  Xylella fastidiosa...
14548174  72 PEHVINAFVATEDRNFWHHFGIDPVAIVRAAIVNYRAGr---IVQGGSTITQQLAKNLFLT-RERTLERKIKEALLAIKI 147  Aquifex aeolicus
15595077 161 EKKLSKYEILEKYLNKVYFGNGNYGIVAASKFFFGKSVNKINTAESVMMIIqLPNAK-LYSPLYNPEFSKKIQR-AVLNQ 238  Lyme disease spiro...
15888667 155 EQTYSKDKILELYLNEIFFGLNSYGIAGAALTYFNKSVTELTIAETAYLAS-LPKGPaNYHPIRREKAALERRD-WVIDR 232  Agrobacterium tume...
17987338 155 EQAYSKDRILELYLNEIFFGLGSYGIASAALTYFDKSVGELTIAESAYLAA-LPKGPnNYHPFRQPERAIERRN-WVIDR 232  Brucella melitensis
16126118 151 EQSLTKQQILELYLNEIWLGYRSFGVGAAAYNYFGKALPDLTLAECAYLAS-LPKGPdNYHPIRNRAKAITRRN-WVLGQ 228  Caulobacter cresce...
15893168 155 SRVFTKDQILELYLNQTFFGRGAYGVAVAAQNYFNKSVEELTIAESAFIAA-LPKAPsELNPERNYARVKARRD-YVITR 232  Rickettsia conorii
14548189 155 SRIFTKHQILELYLNQTFFGRGAYGVAAAAQNYFNKSVEELTIAESAFIAA-LPKAPsELNPDKNYSRVKARRD-YVIER 232  Rickettsia prowazekii
16263688 154 ERSLSKDRILELYLNDIYLGLGAYGIAAGALTYFEKSVSELTVAEAAYLAA-LPKGPnNYNPHRHPERAVSRRN-WVIGQ 231  Sinorhizobium meli...
15965083 155 EQAYSKDRILELYLNEIFFGLNSYGIAGAALTYFDKSVTELTIAETAYLAA-LPKGPaNYHPFRKVEAAIERRN-WVIDR 232  Sinorhizobium meli...
15836970 178 ESQLKKDEILELYLNKSFFGNRAYGIAAAAEFYYGKKLNELNLDEMASLAG-IPKFPsSGNPITNPARARERRDlYVLQR 256  Xylella fastidiosa...
14548174 148 ERTFDKKKIMELYLNQIYLGSGAYGVEAAAQVYFGKHVWELSLDEAALLAA-LPKAPaKYNPFYHPERALQRRN-LVLKR 225  Aquifex aeolicus
15595077 239 VVSNGIVKAEIAEKefneywqNYDWTRMADtSAISNKKDQAPYFSEYIRQKILKYLPDGAnIYKDGYSIYSTLDLEAQKY 318  Lyme disease spiro...
15888667 233 MAENGYITVADATD-------AKKQPLGVNlRRGGAHIAASDYFAEEVRRQIVEKYGEEA-LLEGGLSVRTSFDPQIQME 304  Agrobacterium tume...
17987338 233 MAENGYITTAEAED-------AKKQPLGVTpRTATHYLFASEYFTEEVRRQIIQKYGVDA-LYEGGLSVRTTLNPKLQLE 304  Brucella melitensis
16126118 229 MAEQGWVSKADAQK-------AMAEPLVVQaAPKRAAYRDADYFVEEVRQRGMATLGPR--LNEGGYYMRTTLDPRLQTA 299  Caulobacter cresce...
15893168 233 MFEDGYITRDAAKE-------AMDSPIVLR-KRAKEETVTADYYAAQVREEVIRMLNSKEvFYTGGLTIITSLDAKMQQL 304  Rickettsia conorii
14548189 233 MFEDGYITRDTMKE-------AIGSPIVLR-KRAKEETVTADYYAEQVREEVIRMLNSKEeFYRGGLTIITSLDAKMQQL 304  Rickettsia prowazekii
16263688 232 MQRNGFVSAAQASN-------MMARPLGVKpQAKNPVMAEANYFVEEVRREVAGQYGEAA-LYDGGLSVRTTLDPTLQAA 303  Sinorhizobium meli...
15965083 233 MVENGYVTKADGEE-------AKQQPLGVKpRRGGAHLFASDFFAEEVRRQIIQKYGDKA-LYEGGLSVRTSLDPRLQIA 304  Sinorhizobium meli...
15836970 257 MVDLNFITQDQANA-------AKAIPMHAK-PHEPPVQVYAPYAAEMVRQEMIAKYGGA--ALNKGYHVTTTIDGTLQMA 326  Xylella fastidiosa...
14548174 226 MLEEGYITPEQYEE-------AVNKPLTVK--KENKYKFS-DYFLDMVKSYVFNKYGEI--AYKGRLKIYTTIDLDYQKI 293  Aquifex aeolicus
15595077 319 ADKVTNDMINKARTMHNLNRSSETIIINSEIVPVVDAISDLLG----IKNLRINGRQYKKL-RKRKFYEDNIDLIA---- 389  Lyme disease spiro...
15888667 305 ARKALQDGLVQYDERRGFRGPIEKIETA-GDWTAALAKVKGLRd---VPEWKVAVVLAVAA-DGVDIGVQADPDAEdgdk 379  Agrobacterium tume...
17987338 305 ARKSLQAALIRYDEARGWRGPLKNVELG-GDWGTAFGNMEPYSd---VPEWQLAVVLNVTP-AGADIGLQPQFDASgsrs 379  Brucella melitensis
16126118 300 ARVALMDGLEKYDRRHGWRGAWGRVEPSDLNWEKKALAKAAPSe---RRQWRAALVTGND-------GRVRLVKGEgeg- 368  Caulobacter cresce...
15893168 305 AENSLRKGLREFDRRCGFRKPIANISLD--NWQGELKKLPTPPs---LLEYKLAVVLDVAD-NHVEIGLIDGSKSKm--- 375  Rickettsia conorii
14548189 305 AENSLRKGLREFDRKSGFRKPIANIPLD--NWQEELKKLPTPSs---LLEYKLAVVLDVSD-NHAKIGLIDGSKAKi--- 375  Rickettsia prowazekii
16263688 304 ALMALRAGLVDYDQARGFRGPVAHIDIS-GDWATALAKHETFTd---MKEWQLAVVLSCSD-AGVGIGLRRAKLGPehsp 378  Sinorhizobium meli...
15965083 305 ARKALQDGLLSYDERRGFHGPVKTIEIG-GDWGEPLSKIPMLSd---VPEWKLAVVLSVDS-EGAEIGIQPDKEVSgkiv 379  Sinorhizobium meli...
15836970 327 AETSVRNGLALYEHRHRWRGAEQHIEVD--ANADTATLAAHLSgissQGGMFPVIVARTTPeGSAVVVRSDRSELTl--- 401  Xylella fastidiosa...
14548174 294 AQKSLEEGLKRVAKIIGLPF-LPKSEEDMELAYEKEAQLKRLK----RGKIYVAKILKYDG--NFMKVEIHGKKLK---- 362  Aquifex aeolicus
15595077 390 --------SFGAILGIDK-----------------IDKATKEYIIKN-----KLTPKLIAQPEGAMIAIDTTSGAIRAMV 439  Lyme disease spiro...
15888667 380 r--trghiSAENMRWAFRdasgkkat--skspvgvVTAGDVVYAQPLsgsgnEYRLRQPPKVQGGMVVMDPHTGRVLAMV 455  Agrobacterium tume...
17987338 380 kerkrafiAADDMKWAMRivniggkrtsakspegvLKPGDIIYVSKTgd--sRYSLQQPPKLEGALVAMDPHTGRVLAMV 457  Brucella melitensis
16126118 369 ------qiVSEDMTWAKAgk--------------gLKAGDLVFVEKAaq--gGYRLRQIPAVNGALVAMEPYTGRIVALV 426  Caulobacter cresce...
15893168 376 -------pIAE-MKWARSnfks---------vktlLKKGDVIVVEAIk---eGYALRQIPEVNGAIMVMNPNTGQVLASV 435  Rickettsia conorii
14548189 376 -------pIVE-MQWARSnlks---------vktlLKKGDVIVVEPIk---dCYALRQIPEVNGAIMVMNPHTGQVLASV 435  Rickettsia prowazekii
16263688 379 tspetgliGRNTMRWALKlaaggkir-qvdsidkvLSPGDVIYVEKVg---nGYLLRQIPEVQGAIVSMDPNTGRVLASV 454  Sinorhizobium meli...
15965083 380 pervtgriAAKNMQWAHRsaggkrks--akspeevFGPGDVVYVEPLee-agEYRLRQPPKVQGGLVAMDPHTGRVLAMV 456  Sinorhizobium meli...
15836970 402 --------PPAAARWTGtpl------------nklLKRGDVVRVRPGek-wgEWTLEQLPSAQSTLVSLDANNGALRALV 460  Xylella fastidiosa...
14548174 363 ----------GEIKGLN------------------TEGHKYVFVKYLg----GNRAEIIPDLEGSLVSIDVKTGEIKAIV 410  Aquifex aeolicus
15595077 440 GGSGHTKDnEFNRATQAKVQPGSAFKALYFAAAIDLKkITAATMFSDSPVAFLNKNGE-VYAPGNYGGKWRGNVLTRQAL 518  Lyme disease spiro...
15888667 456 GGFSYAQS-EFNRSTQAMRQPGSSFKPFIYAAALDNG-YTPASVILDAPIEVVSGGQV--WKPQNYGGGSAGPSTLRLGI 531  Agrobacterium tume...
17987338 458 GGFSFGES-EFNRATQAYRQPGSSFKPFVYAAALDNG-YTPASVVLDGPLEIDQGGSLgIWAPKNFSGKFAGPSTLRYGI 535  Brucella melitensis
16126118 427 GGYSYSLS-NFNRATQAMRQPGSSFKPFVYAAALENG-YTPASVIVDSAITFKGANGE-EWSPENYHKEFYGAQPLRKGL 503  Caulobacter cresce...
15893168 436 GGYDFSTS-KFDRVTQALRQPGSLSKTFVYLAALENG-VKPNQIFNDGPIEISQGPGMpSWRPKNYEGKFLGEITMRTGL 513  Rickettsia conorii
14548189 436 GGYDFSTS-KFDRVTQALRQPGSLSKTFVYLAALENG-VKPNQIFNDGPIEIIQGPGMpSWCPKNYEGQFLGDMTMRTGF 513  Rickettsia prowazekii
16263688 455 GGFSFAQS-RFNRATQASRQPGSAFKPFVYAAALDTG-YTPATLVMDAPFSMPDGAGR-LWKPKNYDGKFGGPSTLRTGL 531  Sinorhizobium meli...
15965083 457 GGFSYGQS-EFNRATQAMRQPGSAFKPFVYAAALDNG-YTPASVILDAPIEIVAGGQV--WRPENYGGGSAGPSTLRLGI 532  Sinorhizobium meli...
15836970 461 GGFSFTAN-KFNRATQARRQPGSSFKPFVYSAALEKG-FNPASIVPDAPVIFRDRRGH-TWSPQNDDGKFQGPMRIRDAL 537  Xylella fastidiosa...
14548174 411 GGRSYAYS-QFNRAVKALRQPGSAIKPVIYLSALLKG-MTQISTIDASSKPYYDPSKGeDWIPKNYDEKEYGNVTLRYAL 488  Aquifex aeolicus
15595077 519 ALSLNIPALRILDRLGFDSAISYSSKLLGITDpkeiekTFPKVYPLALGVISVSPIQMARAFAILGNSGSEIEPYGIRYI 598  Lyme disease spiro...
15888667 532 EKSRNLMTVRLAQDMGMNLVAEYAERFGIY-D------KMPPLLSMSLGSGETTVMRMVSAYSVLANGGKQIKPTLIDRI 604  Agrobacterium tume...
17987338 536 EQSRNVMTVRLAQDMGMKLVVEYAERFGIY-D------KMLPVLSMVLGAGETTVLRMVTAYSIIANGGQSITPSMIDRI 608  Brucella melitensis
16126118 504 EQSINAMTVRLAQGVGMKKIVDFAKRTGVV-R------DMDPVLAMALGAGETTPFKLTAAYAPFVNGGRRVEPHLIELV 576  Caulobacter cresce...
15893168 514 EKSRNLITVRVATAVGLTKIVDIIKRFGIN-N------EPKKVYSMVLGSIETTLSRMTNAYAIIANGGKKVEPHFVELI 586  Rickettsia conorii
14548189 514 EKSRNLITVRVATAVGLTKIVDIIKRFGIN-N------EPKKVYSMVLGSIETTLSRITNAYAIIANGGKKVEPHFVELI 586  Rickettsia prowazekii
16263688 532 EMSRNLMTVRLARHLGMDLVAEYGRAFGLY-D------KLAPYLPMSLGAGETTLTRLVSAYAVLANGGHAVQPSMIDRI 604  Sinorhizobium meli...
15965083 533 EKSRNLMTVRLANDLGMNIVAEYAERFGIY-D------KMAPLLAMSLGSGETTVLRLVSAYAVIANGGKQIKPSLIDRI 605  Sinorhizobium meli...
15836970 538 VQSRNLVSVRLLDAIGVDFARNYITQFGFEEN------EIPPNLSMSLGTASLTPLSIARGYAVFANGGFRIDPWLIDEI 611  Xylella fastidiosa...
14548174 489 AHSINTAAVNLLDKVGFELVLEVGKKVGLD--------NLKPYYSLALGTVEVTPLQLTAAYQVFANLGTECKPFFIKKI 560  Aquifex aeolicus
15595077 599 EDRAGRIITNEEASILAK-----------------------------------IKNKEHQT------------QIVSPQT 631  Lyme disease spiro...
15888667 605 QDRYGKTIFRHEERGCEGcna------------------------------tsWQNQDEPVivd------nreQVLDPMT 648  Agrobacterium tume...
17987338 609 QDRYGKTVFKHDNRQCEGcna------------------------------qeWANQDEPTlid------nrdQVLDPMT 652  Brucella melitensis
16126118 577 QDREGKVIFRADKRDCERce-------------------------------agFNGDESPRfaa------pgeQVMDPIT 619  Caulobacter cresce...
15893168 587 KDRNGKIIYRRDDRECLAcn-------------------------------vsDSNLDTAIleipk---eyiyRVTDEAS 632  Rickettsia conorii
14548189 587 QDRNGKIIYRRDNRECFScn-------------------------------iaDSDLDTAIleipk---ediyRVTDEAS 632  Rickettsia prowazekii
16263688 605 QDRHGRTIFRHDDRACDRcna------------------------------trWLHQEEPVlrd------trkQVLDPMT 648  Sinorhizobium meli...
15965083 606 QDRYGKTIFRHEDRACENcna------------------------------ddWEAQEEPVlid------nreQVLDPMT 649  Sinorhizobium meli...
15836970 612 HDREHKLIFKNTPKVACRsctsantnvtqstsqlvdgfnfgaptktepskpvkNNNEPPQTipspdpntpmapRAIDERV 691  Xylella fastidiosa...
14548174 561 VDENGEVLEENVP-ECEE--------------------------------------------------------VLPKPE 583  Aquifex aeolicus
15595077 632 AYIITDMMKSTIQYGTLANQRYtnLKnfKSDIAGKSGTTQNWADGWAIGYSPYITTAFWVGFDkKGYSLGISGTGTGLAG 711  Lyme disease spiro...
15888667 649 AYQTTSMLEGVVKRGTAAGKIK--VD--LP-VAGKTGTTNDEKDAWFVGYTPDMVAGLYIGFD-SPAPLGRGGTGGSLSA 722  Agrobacterium tume...
17987338 653 AYQITSMMEGVVQRGTAQILKS--LD--RP-LAGKTGTTNEEKDAWFVGFTPDLVVGVFMGYD-TPTPLGRGNTGGGLAA 726  Brucella melitensis
16126118 620 AYQVTSMLQGVVQRGTAAAASS--LG--RP-LAGKTGTTNEYRSAWFVGYSPNLIVGVFIGFD-DNRSLGDGETGATGPV 693  Caulobacter cresce...
15893168 633 DYQITSFLTGAIDRGTGYAAKK--LG--KI-IGGKTGTSNDSKDTWFVGFTPKIVVGSYVGYD-TPKELGKRATGSNVVL 706  Rickettsia conorii
14548189 633 NYQITSFLTGAIDSGTGYAARK--LG--KI-IAGKTGTSNDSKDTWFIGFTPKIVVGSYVGYD-TPKELGKKATGSNVVL 706  Rickettsia prowazekii
16263688 649 AYQVTSMLRGVVERGTAHRVSQ--LG--AP-VAGKTGTTNDEKDVWFVGYTPTLVTGIFMGYD-APKPMGYAKRAADLRP 722  Sinorhizobium meli...
15965083 650 SYQITSMMEGVVARGTAAGKIK--LD--RP-VAGKTGTTNDEKDAWFVGYTPDLVAGLYLGFD-DPAPLGRGATGGGLSA 723  Sinorhizobium meli...
15836970 692 VFQLVSMMRDVVLRGTATAARS--LN--RQDIAGKTGSTNEHRDAWFSGFGGPYVTTVWVGRD-DFQSLGYREYGGKAAL 766  Xylella fastidiosa...
14548174 584 TRVPVDMLRAVVLEGTARRASV--LD--RI-VAGKTGTTDDFQDAWFVGFSPYIVTGVWVGYD-VKKSLGKHMSGSRVAL 657  Aquifex aeolicus
15595077 712 PSWGEFMAEYHKNLPKKVFVKPAGIISIPVQAETGLLPEEIADeKIINELFISG-TQPVEKSKYYEnKQEFKntiefniy 790  Lyme disease spiro...
15888667 723 PIFGEFIADAAKHLEPSKFIVPAGMNFVAVNRKTGMAAAEGEP-DTIMEAFKPG-TGPASTFSVIG-AEGYM-------- 791  Agrobacterium tume...
17987338 727 PVFKSFMEQALARTPKVDFRVPEGMTVIAIDRKTGMRANPGDP-NVIMEAFKPG-TGPSDSYSVIG-MDTFR-------- 795  Brucella melitensis
16126118 694 PMFMDFMKVALEGQPVVDFKPPKNAKFAMVR---GVREAFRPG-TEPKVEVAPT-DGPIPYQDLPP----GL-------- 756  Caulobacter cresce...
15893168 707 PIFIDFMSNAYKDKPSLPFKVPDSIKLIAVDSATGKITPGG----TVIEAFKVNnVQMLENEDMIDnQ---D-------- 771  Rickettsia conorii
14548189 707 PIFIDFMNHAYKDEPSLPFKVPDSIKLIAVDRITGKMIPNG----TVIEAFKVNnIQMLENDYMIDn------------- 769  Rickettsia prowazekii
16263688 723 RSSLSS-------------------------------------------------------------------------- 728  Sinorhizobium meli...
15965083 724 PIFNAFMQKAVEGTRPGKFVVPEGMSLIPVNRKTGMAAVEGEP-DTIIEAFKPG-TGPADTFSVIGdLDEYA-------- 793  Sinorhizobium meli...
15836970 767 PIWIEYMRTALKDKPIARNVPPQGMTQTTLNGATEWVKNED------INHLQDHdFKLHEEESDEQ-------------- 826  Xylella fastidiosa...
14548174 658 PIWIDYMKVVTRMYPNEDFELPPENIVVNINPKDLVLADETc--EGVPMVFVKG-TEPHITCSDLN-------------- 720  Aquifex aeolicus
15595077 791 gideinNNDEinfDTPefeyldnNLesfnnNSNNDNNLESF 831  Lyme disease spirochete
15888667 792 ------SQEDilkTSP-------QAq----QAITGGGGGLY 815  Agrobacterium tumefaciens str. C58 (Cereon)
17987338 796 ------EGSPvapQSP-------QAt----RAINSGSGGLY 819  Brucella melitensis
16126118 757 ------PPVPppaAQP-------GKp----TQKPDPLSGLY 780  Caulobacter crescentus CB15
15893168 772 ------N-NDifdYVP-------SKe----DQSQE----IY 790  Rickettsia conorii
14548189 770 --------HDifdYVP-------GMl----DQSQE----IY 787  Rickettsia prowazekii
16263688     ----------------------------------------- Sinorhizobium meliloti
15965083 794 ------PPEEilrTSP-------QAn----QAVTSGSNGLF 817  Sinorhizobium meliloti
15836970 827 ------------------------------------TFDIF 831  Xylella fastidiosa 9a5c
14548174 721 -----------------------------------AILGLR 726  Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap