Conserved Protein Domain Family
PepO

?
COG3590: PepO 
Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 226118
View PSSM: COG3590
Aligned: 10 rows
Threshold Bit Score: 889.463
Threshold Setting Gi: 13432245
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16127734  38 SLLpSITAGgaaadvaslesprfgtwgFDLSGMDTTVKPGEDFYKFANGAWDARTQIPSDRTRYGNFDKLAELSEARTKA 117 Caulobacter crescen...
19551404   1 ---------------------------------------MKDLYRFVNGLWLDTHIIPDDRAVDGTFHKLRDDAEEDVHE 41  Corynebacterium glu...
13432245   1 -----------------------------------MTRIQDDLFATVNAEWLENAEIPADKPRISAFDELVLKNEKNLAK 45  Lactococcus lactis ...
20090849   2 SMGnTSTSGhe--------------kaFDPGNMNLSVKPGDDFYEYAEGAWIKSRPVPADKSRYGEFEIVKDRTSDSVKK 67  Methanosarcina acet...
15828409   1 MNIeAIRSG------------------IDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFRHLFDQTEEQVRD 62  Mycobacterium leprae
15839578   1 MTL-AIPSG------------------IDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRSLFDRAETQVRD 61  Mycobacterium tuber...
15607339   1 MTL-AIPSG------------------IDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRSLFDRAETQVRD 61  Mycobacterium tuber...
15901483   1 -----------------------------------MTRYQDDFYDAINGEWQQTAEIPADKSQTGGFVDLDQEIEDLMLA 45  Streptococcus pneum...
15675851   1 -----------------------------------MTTYQDDFYQAVNGKWAETAVIPDDKPRTGGFSDLADEIEALMLD 45  Streptococcus pyoge...
15837178  40 TNTnDIDLStlpp-----------virFTASDLDPTGNPCTDLHTYVNGNWLKANPVPSDRTSWGAFQMLDERSNAIQRQ 108 Xylella fastidiosa ...
16127734 118 IIEAAAANKAATG----DTAKVGAAYRAFMDEAGIEKLDAKPIAPYLAEIRKVKSKDEFTTLMGKSSTTPF-TSLLGLGI 192 Caulobacter crescen...
19551404  42 IVKEDTG-------------RAGTLYASFMDTDAINAAGVAPLDADLNRLS-VANSSFFAAALGELDREGV-GAPVGFWV 106 Corynebacterium glu...
13432245  46 --DLADLSQNLPTdn-pELLEAIKFYNKAGDWQTREKADFSAVKNELAKVETLNTFEDFKNNLTQLVFHSQaPLPFSFSV 122 Lactococcus lactis ...
20090849  68 IVEDAASNTSAPeg--sLEQKIGEFYRVGMDNSTLEKQRLDPIKAEMRMIDDISSTSDVQAVSTQMMDYGM-DPFFSMYA 144 Methanosarcina acet...
15828409  63 LITEASGTAAAGEtaeaDAQRIGDLYASFLDEQTVERRGTQPLLEELALIDNATDTSDLAAVLGALQRTGM-GGGVEVYV 141 Mycobacterium leprae
15839578  62 LIIQAS---QAGAavgtDAQRIGDLYASFLDEEAVERAGVQPLHDELATIDSAADATELAAALGTLQRAGV-GGGIGVYV 137 Mycobacterium tuber...
15607339  62 LIIQAS---QAGAavgtDAQRIGDLYASFLDEEAVERAGVQPLHDELATIDSAADATELAAALGTLQRAGV-GGGIGVYV 137 Mycobacterium tuber...
15901483  46 TTDKWLAGEEVPed--aILENFVKYHRLVRDFDKREADGITPVLPLLKEFQELETFADFTAKLAEFELAGK-PNFLPFGV 122 Streptococcus pneum...
15675851  46 TTDAWLAGENIPdd--aILKNFVKFHRLVADYAKRDEVGVSPILPLIEEYQSLKSFSEFVANIAKYELAGL-PNEFPFSV 122 Streptococcus pyoge...
15837178 109 LIEHAAADPQSSg----IKKILSDLWNTGMDEAKIETQGIDPLKTDLAAIDAITNQDTLVNYLRSTAAKGQ-GELFTLSA 183 Xylella fastidiosa ...
16127734 193 STDAKNPKAYAVYAGAGGLSLPDRDYYLDA--KFADKKAAYLAYVEKLLTMAGWDK-------PAEHAKAVVDFETKLAE 263 Caulobacter crescen...
19551404 107 EKDS-SSNESVAYVIQSGLGLPDEAYYREE--AHAETLAAYKEHVERMLGYLDNSRlfg--lsAASAAARIVALETEIAA 181 Corynebacterium glu...
13432245 123 EPDMKDAIHYSLGFSGPGLILPDTTYYNDEhpRKKELLDFWAKNTSEILKTFDVena----eeIAKSALKFDALLVPSAN 198 Lactococcus lactis ...
20090849 145 SPDKKNSKVMIATLTQGGLGLPDRDFYLRQdsESIRIREQYLTHVTRMFVFLGDNPe-----tAENNARTVMRIETRLAN 219 Methanosarcina acet...
15828409 142 DTDSKDSTRYLLHFSQSGIGLPDESYFHDD--QHAEVLAAYPEHIARMFTLVYRGEryqdprcHAKTAARIVALETKLAD 219 Mycobacterium leprae
15839578 138 DTDSKDSTRYLVHFTQSGIGLPDESYYRDE--QHAAVLAAYPGHIARMFGLVYGGEsr----dHAKTADRIVALETKLAD 211 Mycobacterium tuber...
15607339 138 DTDSKDSTRYLVHFTQSGIGLPDESYYRDE--QHAAVLAAYPGHIARMFGLVYGGEsr----dHAKTADRIVALETKLAD 211 Mycobacterium tuber...
15901483 123 SPDFMDARINVLWASAPSTILPDTTYYAEEhpQREELLTLWKESSANLLKAYDFSDeei--edLLEKRLELDRRVAAVVL 200 Streptococcus pneum...
15675851 123 APDFMNAQLNVLWAEAPSILLPDTTYYEEGneKAEELRGIWRQSQEKLLPQFGFSTeei--kdLLDKVIELDKQLAKYVL 200 Streptococcus pyoge...
15837178 184 SPDFKDPTRNIAYISQSGLGLPDPEYYTKP--ANKDKLLAYKAHIAKVLELSGMAAa-----dATQHAEKVIAFETRLAK 256 Xylella fastidiosa ...
16127734 264 VTWTRAER-RDRDKTYNPATLAELQAMSPGYDWNRYIAASG--LPKvdRFVVTTNTTF-PKYAKIYAETPLDTLKAWQAF 339 Caulobacter crescen...
19551404 182 GHWDVVKT-RDAVATYNPTELGALPPK---VR--TLLSSAG--LPD--QRLVSMMPSYlDHLNGLLVDDRLPDWQLWATW 251 Corynebacterium glu...
13432245 199 TSEEWAKY-AELYHPISTDSFVSKVKNLDLKS--LIKDLVKt-EPD--KVIVYEDRFY-ESFDSLINEENWSLIKAWMLT 271 Lactococcus lactis ...
20090849 220 ASFNNVDD-NDEVKTYNRMSLEELQVFAPGMNWSCLFSVLG--RPDv-AEVNVRNPSYfKELSIALQEESTADWKTFLRW 295 Methanosarcina acet...
15828409 220 AHWDVVKR-RDADLSYNLRTFAELQSDGVGFDWSAWVTALGn-TPEsvTELVVRQPDYlTAFAALWETINLEDWKCWARW 297 Mycobacterium leprae
15839578 212 AHWDVVKR-RDADLGYNLRTFAQLQTEGAGFDWVSWVTALGs-APDamTELVVRQPDYlVTFASLWASVNVEDWKCWARW 289 Mycobacterium tuber...
15607339 212 AHWDVVKR-RDADLGYNLRTFAQLQTEGAGFDWVSWVTALGs-APDamTELVVRQPDYlVTFASLWASVNVEDWKCWARW 289 Mycobacterium tuber...
15901483 201 SNEESSEY-AKLYHPYSYEDFKKFAPALPLDD--FFKAVIGq-LPD--KVIVDEERFW-QAAEQFYSEEAWSLLKATLIL 273 Streptococcus pneum...
15675851 201 SREEGSEY-AKLYHPYVWADFKKLAPELPLDS--IFEKILGq-VPD--KVIVPEERFWtEFAATYYSEANWDLLKANLIV 274 Streptococcus pyoge...
15837178 257 VSKTQQQLaRDTALQYNPVTPTQANKLTPHWSWTEAFKAQGvpLPD---MFSLAIPAFhKEVDRMLADTDVAIWRAYLRF 333 Xylella fastidiosa ...
16127734 340 KVTDNAAPLLSKRFVDAGFEFRNKTLAGQPEQRPRWKRGVGAVNGLLGEAVGKDYVAAYFPPESKAKMLELVANVRGAMK 419 Caulobacter crescen...
19551404 252 HILRSRAGLLTEEISQANFDFYGTKLSGATEQKDRWKRAVGLAERMVGEEIGQRFVERHFPASSKEHMLELVDYLVAAYR 331 Corynebacterium glu...
13432245 272 KIARGATSFFNEDLRILGG-AYGRFLSNVQEARSQEKHQLDLTESYFSQVIGLFYGKKYFGEAAKADVKRMVTAMIKVYQ 350 Lactococcus lactis ...
20090849 296 KLISATSPYLSSDLEKEHFDFYERKLNGQKEMEPRWKRVLNAENRAIGEAIGRVYVDRYFDPGSRARMQELVSNLKKAFR 375 Methanosarcina acet...
15828409 298 RLIRARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGKLYVQRHFPLHAKARVDALADNLQQAYR 377 Mycobacterium leprae
15839578 290 RLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFPPDAKSRIDTLVDNLQEAYR 369 Mycobacterium tuber...
15607339 290 RLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFPPDAKSRIDTLVDNLQEAYR 369 Mycobacterium tuber...
15901483 274 SVVNLSTSYLTEDIRVLSG-AYSRALSGVPEAKDKVKAAYHLAQEPFKQALGLWYAREKFSPEAKADVEKKVATMIDVYK 352 Streptococcus pneum...
15675851 275 DAANAYNAYLTDDIRVESG-AYSRALSGTPQAMDKQKAAFYLAQGPFSQALGLWYAGQKFSPEAKADVESKVARMIEVYK 353 Streptococcus pyoge...
15837178 334 HTVDNASPYLSRPFVDEHFAFWNNTMRGQKEIKPRWKRVLNTINEQTGEALGQLYVKAAFPTESKVKMEALVAQLRTALK 413 Xylella fastidiosa ...
16127734 420 VRIDNLDWMSAETKVKAQEKLAKFTVKIGYP--DVWEDYSKLEIKDNDAYGNVQRAGAWAFAK---DVERLFKPVDKTEW 494 Caulobacter crescen...
19551404 332 DRISNLEWMTPATRERALEKLGKFNAKIGYP--DKWRSYEGLEFG-SDLVDNSRKGSAFLHDY---ELGKIGKPADRDEW 405 Corynebacterium glu...
13432245 351 ARLSKNEWLSQETAEKAIEKLDAITPFIGFPdkLPEIYS-RLKTTSGSLYEDALKFDEILTAR---TFEKFSEDVDKTSW 426 Lactococcus lactis ...
20090849 376 ERIQSLTWMEPETKKEALMKLESLDVQVGYP--DEWLNYSELEVKNDSYVMNVLRASKFRFHHgpnGLDRIGKPVDRKLW 453 Methanosarcina acet...
15828409 378 ISISELAWMTPQTRERALAKLTKFTAKVGYP--KKWRDYSQLVIDRDDLYGNCQRGYAVNHDR---ELAKLGGPVDRDEW 452 Mycobacterium leprae
15839578 370 ISISELDWMTPQTRQRALAKLNKFTAKVGYP--IKWRDYSKLAIDRDDLYGNVQRGYAVNHDR---ELAKLFGPVDRDEW 444 Mycobacterium tuber...
15607339 370 ISISELDWMTPQTRQRALAKLNKFTAKVGYP--IKWRDYSKLAIDRDDLYGNVQRGYAVNHDR---ELAKLFGPVDRDEW 444 Mycobacterium tuber...
15901483 353 ERLLKNDWLTPETCKQAIVKLNVIKPYIGYPeeLPARYKDKVVNETASLFENALAFARVEIKH---SWSKWNQPVDYKEW 429 Streptococcus pneum...
15675851 354 SRLETADWLAPATREKAITKLNVITPHIGYPekLPETYAKKVIDESLSLVENAQNLAKITIAH---TWSKWNKPVDRSEW 430 Streptococcus pyoge...
15837178 414 ARIEKLDWMSPATKSKALAKWESFTAKIGYP--DQWRSWDNLHTSRDSYLGNVLTAQQFNYTW---NLSKIGKPVDKSEW 488 Xylella fastidiosa ...
16127734 495 GMTPQTVNAYYNSVNNEIVFPAAILQAPFFHPDADPAINYGGIGGVIGHEIGHGFDDQGRKSDGDGVLRDWWTAEDAAKF 574 Caulobacter crescen...
19551404 406 VTTPQTVNAFYNPVVNDITFPAAILRAPFFDPEAEAAENFGAIGAVIGHEIGHGFDDQGSQYDGDGNLNSWWTDEDRSAF 485 Corynebacterium glu...
13432245 427 HMPAHMVNAYYSPDSNTIVFPAAILQAPFYSLEQSSSQNYGGIGTVIAHEISHAFDNNGAQFDKEGNLNKWWLDEDYEAF 506 Lactococcus lactis ...
20090849 454 EMNPQETNAYADCNKVIIVFPAGILQPPFFNEEADDAVNYGAIGSIIGHEMTHHFDSQGRKFDASGNLADWWTPEDADNF 533 Methanosarcina acet...
15828409 453 FMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIGHEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEF 532 Mycobacterium leprae
15839578 445 FMTPQTVNAYYNPGMNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTDDDRTEF 524 Mycobacterium tuber...
15607339 445 FMTPQTVNAYYNPGMNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTDDDRTEF 524 Mycobacterium tuber...
15901483 430 GMPAHMVNAYYNPQKNLIVFPAAILQAPFYDLHQSSSANYGGIGAVIAHEISHAFDTNGASFDENGSLKDWWTESDYAAF 509 Streptococcus pneum...
15675851 431 HMPAHLVNAYYDLQQNQIVFPAAILQEPFYSLDQSSSANYGGIGAVIAHEISHAFDTNGASFDEHGSLNDWWTQEDYAAF 510 Streptococcus pyoge...
15837178 489 EMPPQMVNAYYDPQKNEIVFPAAILQPPFFDPDAPLESNYGGIVAVIGHEMTHGYDDQGSRFGPTGKFEQWWTKADAKAF 568 Xylella fastidiosa ...
16127734 575 KAQADRLGAQYGAFEPLPGMKL------NG-ALTMGENIGDMGGLAFALDAYRASLKg-----qPAPVLDG--------- 633 Caulobacter crescen...
19551404 486 EQLTSRLVTQFSGLVPAVLTSEgidtdgVNgEFTLGENIGDLGGLGIAVVAYEKYLAdrgqtfeTSPVQKFeaegaeegl 565 Corynebacterium glu...
13432245 507 EEKQKEMIALFDGVETEAGPAN------GK--LIVSENIADQGGITAALTAAKDEKD----------------------- 555 Lactococcus lactis ...
20090849 534 NRSTEVLVDEYNKFEVLPGLHVn-----GN--LTLQENIADFGGLTIAYHAYKLSSKe------EPEMVDG--------- 591 Methanosarcina acet...
15828409 533 NTRTKALIEQYNVYTPRGLDDHh-----VNgAFTVGENIGDLGGLSIALLAYQLSLNg-----qSAPVIDG--------- 593 Mycobacterium leprae
15839578 525 AARTKALIEQYHAYTPRDLVDHpgp-phVQgAFTIGENIGDLGGLSIALLAYQLSLNg-----nPAPVIDG--------- 589 Mycobacterium tuber...
15607339 525 AARTKALIEQYHAYTPRDLVDHpgp-phVQgAFTIGENIGDLGGLSIALLAYQLSLNg-----nPAPVIDG--------- 589 Mycobacterium tuber...
15901483 510 KEKTQKVIDQFDGQDSYGATIN------GK--LTVSENVADLGGIAAALEAAKREAD----------------------- 558 Streptococcus pneum...
15675851 511 KERTDKIVAQFDGLESHGAKVN------GK--LTVSENVADLGGVACALEAAQSEED----------------------- 559 Streptococcus pyoge...
15837178 569 STRTAKLVAQFNSYRTEDGKQV-------NgLLTLGENIADLGGLNTAYDAMKTATAg-----qADPKTDG--------- 627 Xylella fastidiosa ...
16127734 634 ----FTGDQRVYLGWAQVWRGKQRDEALKQQIIAGPHSPGYYRVNGTIRNMEGWYSAY-DVKPGDKLYIAPENRVKIW 706 Caulobacter crescentu...
19551404 566 aeqeFNGLQRLFLSWARVWRTKIRPQMAVQYLAIDPHSPAEFRCNVIAGNVAEFYEAF-DVPEDAPVYIKPEERLAIW 642 Corynebacterium gluta...
13432245 556 -----VDLKAFFSQWAKIWRMKASKEFQQMLLSMDVHAPAKLRANIPPTNLEEFYETF-DVKETDKMYRAPENRLKIW 627 Lactococcus lactis su...
20090849 592 ----FTGDQRFFLSFAQIWRESDTDDSLRTRALTDTHSPARFRVNGAVFNMPEFYRAFpSVKPADKLYRPESERPVIW 665 Methanosarcina acetiv...
15828409 594 ----LTGVQRVFFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAF-DVDEDDALFLEPQLRVRIW 666 Mycobacterium leprae
15839578 590 ----LTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYQAF-DVTEDDALFLDPQRRVRIW 662 Mycobacterium tubercu...
15607339 590 ----LTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYQAF-DVTEDDALFLDPQRRVRIW 662 Mycobacterium tubercu...
15901483 559 -----FSAEEFFYNFGRIWRMKGRPEFMKLLASVDVHAPAKLRVNVQVPNFDDFFTTY-DVKEGDGMWRSPEERVIIW 630 Streptococcus pneumon...
15675851 560 -----FSARDFFINFATIWRMKAREEYMQMLASIDVHAPGELRTNVTLTNFDAFHETF-DIKEGDAMWRAPKDRVIIW 631 Streptococcus pyogene...
15837178 628 ----MTREQRFFYNWATVWRAQYTPEEQAMRLKTDPHAPPHFRTIGPPSNMPSFAEAF-NCKPGDAMVRRSDQQVVIW 700 Xylella fastidiosa 9a5c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap