Conserved Protein Domain Family
NtpC

?
COG1527: NtpC 
Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 [Energy production and conversion]
Statistics
?
PSSM-Id: 224444
View PSSM: COG1527
Aligned: 18 rows
Threshold Bit Score: 249.958
Threshold Setting Gi: 19173477
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15668392  47 KMVIDLAPYAYVNARIRSKEAKLFDDAKLNELIESGSLEELVGLLEDTDYGQYVIEVMNelKDPVAVEKALDMYLADLYG 126 Methanocaldococcus ...
12585485  24 GKDCMPDDYSYINTRVRVMRTKLLDGRALDAALASGSYQEFLRVLSETDFAPNMRETTAegAGLPELDRALSQNLFDTTQ 103 Deinococcus radiodu...
19173477  15 KQFSHVERYGYIISEINGKKEEMLKEEDYNALKRCENLEEVAIKLSKT-YRSLSEGIAY---TKPELKKRLLETLKADFD 90  Encephalitozoon cun...
19705059   1 --MMDRELFIQPSVRIRNFEKKLLTKIQFERLYEADNLQDSIRHLNETVYSEDLAKID----MEENFELALLNSLNKTYS 74  Fusobacterium nucle...
18312156   1 --MSSVIKRPSLGPRVRGLRIRELPREKLLSVIYANTLEEFLNVLKTTTYSVTLDRLTR--ENLSELRKNLIKIYIDRIK 76  Pyrobaculum aerophilum
15901173   1 ---MDTNLFSKINTTISVKENDFITEEKFQKIIQSKDTETLAFILESTPYHLSIDILE----DPSQTEISLMTKLVNDYR 73  Streptococcus pneum...
15674361   1 ---MPT--FLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVYHLTVDDLN----DLDRLESILMAELTKTYR 71  Streptococcus pyoge...
21264117   1 ---MDAT-YVGAYGRLKVYEVDFLKKDFLEHLISLDKPSDFSSVLYASVYKEDYDALTSiyREPDLTEMAINRHLVRMNR 76  Thermoplasma volcanium
12585463   1 ---MDST-YIGSYGRLRVYQTEFFSRQQIDQMLSMTDPKDVSAFLYNGPYREDYDSLSAvfKDPDLTEMAINRHMVRNNR 76  Thermoplasma acidop...
12585467   1 MSASGPANYEYVVARIRHRRAGLFGDDEYRKLLRMGTG-EIARFMEDSTYKDAVDSLASrhRGMDLVEYALNEGLAAEFD 79  Halobacterium sp. N...
15668392 127 LIYRISPDSAKKVLKVFAKKFDIKNIKTLIRAKFVGl-----SAEETYALLIPLGn-iPVEKLKELAEVKTVEEVVRGLD 200 Methanocaldococcus ...
12585485 104 RVLGFADGDAKREIETLLMKWDLTNLKTLARGIVSGr-----GAETIQQNLIPGGt--IKPSVLQTASQSTDLASAATAL 176 Deinococcus radiodu...
19173477  91 HYRDVEDKGIRTILDYYMDFHKIQNFFYLLQCKLQD------PNLGRSFEKIEIG---DFSALRTIKFSNNMDDVQRYCM 161 Encephalitozoon cun...
19705059  75 EILSISP--IKELVDVLTYKFAFHNIKVVVKEKIL--------QENFEHIYSKVH---YEDLDNLRKQFETEKGEKETWY 141 Fusobacterium nucle...
18312156  77 SIFLGSSNEVKLVILQSIKYFEYENIRNLSIAIKAG------KSPEDFLLWEPLEfsrRRHVIAGLLGAKNLEEIGERLR 150 Pyrobaculum aerophilum
15901173  74 WAYAESP--SDIIVTLFALRYVYHNIKVLLKSKAAI-------KKDFSKLLIPIG---IFDIESLKHLVSSLHSDTLPDF 141 Streptococcus pneum...
15674361  72 WAFAETP--QPDIVQLFTLRYTYHNVKVLLKAKAS--------QADLSHLLLPIG---DKPLVALEHLIRTMTSDEFPKE 138 Streptococcus pyoge...
21264117  77 IAAFAIPPLAKNALTAYISKWDIENIKTVISSKFLGhglketEMFIVSFRDIPMG---LIGGVLTNEDYRNMMNLPNVEA 153 Thermoplasma volcanium
12585463  77 LVLFAIPPLAKNAVVAYLSKWDIENIKTVISAKFLGhgireaEPFLVSFRDIPLG---IMSGTLTNEDYRNMINLPNIEA 153 Thermoplasma acidop...
12585467  80 ALLSWSEGRLYDQLAKYLRKFDAWNVKTVFRGLYSHa-----DTDAIRADLVDAGe-fDAAFLDELLSADSVETVVDALS 153 Halobacterium sp. N...
15668392 201 GTEYFKILQEELS------NYDQTSNIIGFELALDKYYLESLRKTIMTEGKEEd---IFREFVGTIIDVENLKVILKGKA 271 Methanocaldococcus ...
12585485 177 GVGGHPLAKVFRNav---tAYNTTGRLLDLEVLLDQGYYRYATQVSRDTSLR-------R-YLSREIDITNALIARNSRG 245 Deinococcus radiodu...
19173477 162 ENSFLKKFEERVRf----kKEFSANNFQVLQTLFFKFHIEETYRNLNDDMEH------MREILRLEGDRQIIEIAMNTLN 231 Encephalitozoon cun...
19705059 142 EDTVIQAYK----------IFEKTKDPEKIEVFIDKKYFEKVLEISKTFELD-----LIEEYFRTMIDFINIRTFIRCKR 206 Fusobacterium nucle...
18312156 151 QMRHPAYKA-F--------DMAFKYGEDKLSIFLDRQWVEDFSTSPLAEKDK-----TLRMFTADIKEYFNTLIALRARI 216 Pyrobaculum aerophilum
15901173 142 MVREVESI--WN-------EYETFNNIRVLDVGADLAYFKHLKLLSNELDE------VLSQVIVEMIDFYNIITVKRGLS 206 Streptococcus pneum...
15674361 139 VVTEIQSI--WA-------EYQDYQDIRVLEIGTDLAYFKALKQIAQRLEDP-----VFQQAVLIVIDLYNLITVRRAKS 204 Streptococcus pyoge...
21264117 154 IINYLTRYGYGSYmlqfieDYRKTGDISPMLYSLDRYYYARLLESLKYYNGDEg---PVINYIRSDIDRINLNTILKGKK 230 Thermoplasma volcanium
12585463 154 ILNYLARFGYGTYmmqfleDYRKTGDISPMLYSLDRYYYMNLLSALKYYRGDEa---PVLNYVRSDIDRQNIVTMLKGKV 230 Thermoplasma acidop...
12585467 154 GTIFDTYLEPAFA------DYEDEDSLVPLENAVDRAYYENLNPSQPATAAQDspeaLYAEFLTAEIDFRNARNALRLAR 227 Halobacterium sp. N...
15668392 272 dGLSAEELSKYVTLTGYELADWKLKDLMSAGGIEGVLSGLEGTSYAEVLAEAMEEYEKTKSIYAFEKALDKFVLEKGKKL 351 Methanocaldococcus ...
12585485 246 ----GT-LDTNLFVPGGSLDAAGYGRLGAGD-------AG--------GNADITAILEAPSIEDAEVAARTALDRAARSS 305 Deinococcus radiodu...
19173477 232 sKDLVGRKRMSLFPDVHSMDLRTRELLSHVEG----LEDMKS------VLSTRYNFDKD----ISNVLIRAELQKYQESF 297 Encephalitozoon cun...
19705059 207 -QEQEIAVLKEALIQGGYIDTDDILTYFYKE-IQDLVNAHKNSKIGKSLFLGLKGYNETGRLLLFEKHMENYLTNLLKER 284 Fusobacterium nucle...
18312156 217 -WGLTEELGELIIGKPTPIVQSAVRDPPTRF-----LENAEAAPWGKILLDMVAEAPSLENIAVAMDNIYPAYIKRLSDI 290 Pyrobaculum aerophilum
15901173 207 -QNKSHGDILQLLSDEGSISAKEFIYIVENQEIFVWFNKINP-SLDSIFSTYELKMQDATISSSELEFLCDLLLYKTLDQ 284 Streptococcus pneum...
15674361 205 -QNKPISFMMQLLSDEASRPSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLFAK 283 Streptococcus pyoge...
21264117 231 -LNISYERFFSGLVDGGNIPINAIHDFYGNSDILSMIDSIKR--YYDLEDAKNKYASDGNLYHFDVS-MRNIMITKYMGT 306 Thermoplasma volcanium
12585463 231 -LKIPFERMSSGIIDGGNIGVNRLREIYSSQDAVSVADALKQ--YYDLEEPKKKYMETGDLYHFDIA-IRNIIARRFLDT 306 Thermoplasma acidop...
12585467 228 -SGVSVDPAAYFIEGGTLFEASEMTTLVERQ--SDLVSRIQDSTYGDELSTALTALEESDSLIGFEHALDRALLSYSDHL 304 Halobacterium sp. N...
15668392 352 --STRKPFGVGPIIGLIVSKELEVKNLKAIIKGKIENLKPEEIRSLLISL 399 Methanocaldococcus jannaschii
12585485 306 --AVSDVEGVGIILDFLRRKEIEVAKLRLIGRGKYYDLPTDEIRREVQA- 352 Deinococcus radiodurans
19173477 298 --SMYGDLS--CVYSYFKIKEQEIKNILWVAECIIQNR-RDAMDHLFVV- 341 Encephalitozoon cuniculi
19705059 285 --VKRMPYGPEIIFAYVHAKEIEIKNLRIALVGRANGLSADFIKERLRET 332 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
18312156 291 ytARFSEFSLGALAAHLEYMRAEVLTLIRAASLLAEGVPAEKRRKIFEPL 340 Pyrobaculum aerophilum
15901173 285 --GRYNVEGPLVLARYLLGCEFEVKNLRMIISALQNTIPFESIKERIRPH 332 Streptococcus pneumoniae TIGR4
15674361 284 --AKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPI 331 Streptococcus pyogenes M1 GAS
21264117 307 --MSMLPLSLDSIFYFIIRAEIERQNLRTIYEAKLHGAPKESIYDLMING 354 Thermoplasma volcanium
12585463 307 --MSMLPLSLDSLFYFILRSEIERHNLRTIYLSKVNGMPREITESLLITE 354 Thermoplasma acidophilum
12585467 305 --SYVYPTSVCPVLAYVLAKEREVDNIRAIARGREAGMSEDEIQAELVML 352 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap