Conserved Protein Domain Family
COG1244

?
COG1244: COG1244 
Uncharacterized Fe-S cluster-containing protein. MiaB family [General function prediction only]
Statistics
?
PSSM-Id: 224165
Aligned: 11 rows
Threshold Bit Score: 417.186
Threshold Setting Gi: 15679743
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15004876   6 SDKNKILTHFNEVLKIK-------KRNLNREFSFDKVANSTINKGYLNGS-KIDRIIFYLRSTGCEWSCTkMGgCFMCGH 77  Clostridium acetobu...
11498617   1 ------------------------------MTSTSKPI-VWKEKERLDGE-IVGCLTAILRTRGCRWDR-----CYMCGY 43  Archaeoglobus fulgidus
20093298   3 IASSKPMSLNKAVLEIR-------QRIKVKPSPTNEPAASWTGTDLVNGV-QTKTLTVIFKSAGCRWGKA-GG-CTMCGY 72  Methanosarcina acet...
2496037    1 MNQIINDNYREFLKKLRe-----rHLKKRKVKDKNKPIAVWMQDDIYRDFsIGKSLTIILRTEGCYYAKE-GG-CLMCSY 73  Methanocaldococcus ...
20093778   7 RGRDERPASRILWMKIEpgtdsvrVFTVRFRGRPDRYVAAWKQPDRVTGA--DRSVVIVLSTRGCRWFHE-TGgCVFCSY 83  Methanopyrus kandle...
15679743   1 ---------------------------------------------------------MILPTMGCSWALSeSGgCNMCSY 23  Methanothermobacter...
14520506   1 --------------------------------------MYWIGEDNVAGE-PGKVLYVILPTIGCYRYRI-GKpCYMCSY 40  Pyrococcus abyssi
14591633   1 --------------------------------------MYWVSEDNVAGK-PGKVLYVILPTIGCYRYRI-GKpCYMCSY 40  Pyrococcus horikoshii
13541835   1 ------MVNRELALFIKs-----lMPSYSSKVEKDKPVSIWNEMDRLRGY-PEKSTVAILRTRGCSWYRF-SA-CSMCGY 66  Thermoplasma volcanium
16081638   1 ------MVNKELALFVRs-----lMPEGKGRGDPDRPVSMWNELDRLRGY-PEKTTVVIFRTRGCSWYKF-SS-CSMCGY 66  Thermoplasma acidop...
15790821  10 EQGRGMDAHNKVMRELR-------DEKGAKDYDPREPTRVWLDEDNTPDG-VYNSLTIILNTGGCRWARA-GG-CTMCGY 79  Halobacterium sp. N...
15004876  78 YFGTNmGDTLPKNSFYNQFLSEYNKYDFSKYP----MICIYNAGSILNDNEIPREELYRILNVIKRNNDIKRVVLESRPE 153 Clostridium acetobu...
11498617  44 TSD---AYPASEEELIQQVDYVFEQLE---DEs---VLKIFTSGSFFDDAEVPPKVRGYLLEKFQQRG-LKKLIVESRPE 113 Archaeoglobus fulgidus
20093298  73 VYDCA-SEPPSLEDYMAQLEKAMRKAE-KFPEf---MVKIFTSGSFLDEQEVLPEARDAILKNLTEDPRVTKVLVETRPN 147 Methanosarcina acet...
2496037   74 LMDSS-PEKITAENIINQFNYAIEKYKEKIKDlkdfSVKIFTSGSFLDDREVPKEARNYIFKKLSEFDNLKEVAIESRPE 152 Methanocaldococcus ...
20093778  84 PLEGA-GTRVPPELLIRQFERAYSRHRPDSPHg----VKLFTSGSFLDPEEVPDEAVREILGRLAENELVTEVSFESRPE 158 Methanopyrus kandle...
15679743  24 ISD-SfLEPVKSSEITEIFDEIMSRHE--FDDr--mAVKIFTSGSFLNPEEFPEDARTHILERLSRIDAVEEIIFESRPE 98  Methanothermobacter...
14520506  41 PAQ-A-PKKTSQERILSHFLEAVHKIKGKDDRf---SIRIFTSGSFFDSAEVRRDTRIRIFREISKLDNVYEVVVETRSE 115 Pyrococcus abyssi
14591633  41 PAQ-A-PRKTSQERIFGYFLEAIGKIKGKEGRf---GIRIFTSGSFFDSSEVRRGTRIKIFQEIAKLDNVFEVVVETRSE 115 Pyrococcus horikoshii
13541835  67 FND---TADVSNENLFKQIDHLSSVLN---TE----VLKVFTSGSFLDPIEVPDEVRAYFYDSISNK--VEKLLIESRTE 134 Thermoplasma volcanium
16081638  67 FND---TQDVTEENLYHQIDHVASTMN---SD----VLKVFTSGSFLDPMEIPDGVRSYFYERIGQK--ISKLLVESRTE 134 Thermoplasma acidop...
15790821  80 VAESVeGGSVAHEDLLAQIDECLAHERAEGDEqa-gLIKIYTSGSFLDEREVPAETRRAIAETFADR---ERIVVESLPD 155 Halobacterium sp. N...
15004876 154 FINVEVLNQISNILNDKIVEIGIGLETSNDKVREYCINKGFNFKNYLEKVKLIKn---YSNIKTLTYVTVKLLFLTIDES 230 Clostridium acetobu...
11498617 114 YITDERIEPFK----GVNLEVGIGLETASDRVRELCINKGFSFEDFKDAATKLR----NYGFRVKCYLLLKPPFLSESEA 185 Archaeoglobus fulgidus
20093298 148 YVTEENVQACLSILKNKPFELAFGLETSSDKIRRDSINKGFTFQDFVHAAETAK----KYGVTVKVYLMLKPLFLSERQA 223 Methanosarcina acet...
2496037  153 FIDEDKLNEIRKY-LDVNVEIGVGIESFNEEIREKAINKGITNEQIIRAIELAK----NYNIGIKAYLLIKPLFITEKEA 227 Methanocaldococcus ...
20093778 159 FITDERLELITEVLDGKSFEVGIGLETSDDELR-ASMNKGFSFREFAKAVKKVR----EYGGIPKAYVMLKLPFLSEAEA 233 Methanopyrus kandle...
15679743  99 YIEENVLRECCELVPDKIVEVSIGLETCDEKTRLLKINKGFTGSEFERGISIISglkeEFMLKSKAYILVKPVLVSEKRA 178 Methanothermobacter...
14520506 116 IIREDWVRELAEMVEDKWFEVAIGLESANDDIADVSINKGSTFNDFVRASEIIH----NAGAKVKTYLLLKPIFLSERDA 191 Pyrococcus abyssi
14591633 116 IIREEWVRELVEIIEGKWFEVALGLETANDDIADISINKGSTFRDFVRASEIIH----KAGAKVKTYLLFKPIFLSEGDA 191 Pyrococcus horikoshii
13541835 135 YIRDERLEEIKKY--GFETRIAIGLESANDYIVENSINKGSSFTKYVDAAKRIR----NNGLELRTYLLLKPPFISEKSA 208 Thermoplasma volcanium
16081638 135 YIRPERLEELRKI--GIPVRIAIGLESANDYIIENSINKGSSFKKYMDAASAAR----KYGMEVRTYLLFKPPFISEKAA 208 Thermoplasma acidop...
15790821 156 FVDREKITDFTTV--GLETDVAVGLETATDRVRHDCVNKYFDFEDFEAACAEAR----AADAGIKAYLLMKPPFLAESEA 229 Halobacterium sp. N...
15004876 231 IRDVIQTMK--DLSGLTDIISLEPISIQKNTLVELLYTNKLYDPPKGWIIKEILANLHNTNLMknfeLRIGGFEFFPIPD 308 Clostridium acetobu...
11498617 186 IDDAIKSIV--AAKPYADVFSLNLTNVQKGTLVERFWRAKLYRPPWLWSAVEVLREATAIGV------EILSDPVAAGKQ 257 Archaeoglobus fulgidus
20093298 224 MEDIIRSID--DAAPYADTISINLCNVQKGTLVEALWEKGQYRPPWLWSIIEILRQAKAAHPE----LPLMSDPVGAGSK 297 Methanosarcina acet...
2496037  228 IYDSISSANk-CIELGCSRISFCPATVHKGSVMEFFFNKNQYRPPFLWSIIEILKEVKKSNPK----ALIMCDTSGVGSE 302 Methanocaldococcus ...
20093778 234 IRDAYMSCVd-AHLAGCTRISICPTTVHRETVLEKAWRVGLYRPPWLWTCVEVARKVKGTLGDr---VDLLVDTSGAGTP 309 Methanopyrus kandle...
15679743 179 IDEAISTAVy-AEKTGVDRVSFCPSTVHRGTIMEDLWRRGSYRPPWIWSLVEIINRTRETVS-----IPSIMDTSGFGTS 252 Methanothermobacter...
14520506 192 IEDVKFSIE--KAEPYTDTFSINLTNIQKGTLYESLWQRGEYRTPWLWSVVEVLRWAKKKFPH----KRFLSDPVGAGSA 265 Pyrococcus abyssi
14591633 192 IEEMKRSIE--LAEPYTDTFSINMTNIQKGTLYEKIWERGEYRTPWLWSVVEVLKWAKRKFPG----KRFLSDPVGAGSV 265 Pyrococcus horikoshii
13541835 209 IKDVLDSIR--AVKDLTNDVSINPTNVQKNTLVEYLWKRGLYRPPRLWSLARVLIDGMKIGP------EVISYPTGGNKE 280 Thermoplasma volcanium
16081638 209 IADVLDSIR--KVRDVTTDVSINPTNIQKNTLVEYLWKNGLYRPPRLYSLAKVLIEGMKIGP------EVISYPTGGNKD 280 Thermoplasma acidop...
15790821 230 IADMQSSIRrcAAVDGCHTVSMNPTNVQRYTMVDQLHFRGGYRPPWLWSVAEVLESTADVDA------IVVSDPVGHGSD 303 Halobacterium sp. N...
15004876 309 LFISNCN--KCNKKLYDAIDIYNSTKDVNSILTLSC-DCYEEFKKKIYieNNTVSHIPLEERICNSL 372 Clostridium acetobutylicum
11498617 258 RGPHNCg--KCDAEVAAAIREFSLTQDTSKLEG-LHcECIEKWKKAVE--LEKYSRAPL-F------ 312 Archaeoglobus fulgidus
20093298 298 RGPHNCKi-CSS-EVADSLRTFSLTQNPADLSTADC-ECKELWKKVLE--IEDFTYG----TPILD- 354 Methanosarcina acetivorans C2A
2496037  303 RGAHNLYncKCNKLIKERLERFTLTQDINVLNVEC--ECKNIWNAYIE--VENKNIVPLGDERKLLL 365 Methanocaldococcus jannaschii
20093778 310 RGPSNCP--RCSRRVARALREFTRTQDIGRLEGLKC-SCLAVWRTHIVc------------------ 355 Methanopyrus kandleri AV19
15679743 253 RGPYNCR--KCNRDLKKLIIKSNLEQEM--VPPYEC-ECRERWSAELKf-SELTGSTDIRYKDYS-- 311 Methanothermobacter thermautotro...
14520506 266 RGPHNCGg-SKDKAIERAIRKFSATQDLKFLEVEE--NCLEEWEYIKSegLLDWQLLKSQVSPFSEL 329 Pyrococcus abyssi
14591633 266 RGPHNCGd-SRDKPVERAIRKFSTTQDLRYLEVSG--DCIEEWKYIVSqgLLDWQLIKSQVSPFSTE 329 Pyrococcus horikoshii
13541835 281 RGIHNd---EFDYDLLDLIVKSSLNQDTTELERYMKsQDLSKYMEELE--IEDRSLFQCDFGKLIDQ 342 Thermoplasma volcanium
16081638 281 RGVHNd---TFDDRLLDLIVKSSLNQDVAELEQYMEsLDLSEFWSMIE--EEDRSMVQVDFERMIKQ 342 Thermoplasma acidophilum
15790821 304 RGAHNCg--ECDDRVQKAIKDFDLRQDPSVFSEVAC-ECEATHEAVVE---RETAYN----LPLAE- 359 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap