Conserved Protein Domain Family
ELP3

?
COG1243: ELP3 
Histone acetyltransferase, component of the RNA polymerase elongator complex [Transcription, Chromatin structure and dynamics]
Statistics
?
PSSM-Id: 224164
Aligned: 18 rows
Threshold Bit Score: 362.833
Threshold Setting Gi: 15643860
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14591614  36 IVEIVEALLSGKVK-SREeLNKLKIEVARKYHLPKLPKNSDIWKALP--KDKRekFRDLLKKKPARTISGVAVVAMMTKP 112 Pyrococcus horikoshii
15895026   1 ------------------------------------------------------------------MGKSHYIIPIFVPH 14  Clostridium acetobu...
19173436  61 CNEISSEIVELYKQeKRIdVSAIKSRVCRKYRLGCTPRIVDIISFIPp---EHgrLIEQLRAKPVRTASGVAVVAVMCKP 137 Encephalitozoon cun...
19703498   1 --------------------------------------------------------------------MKHYNIPVFISH 12  Fusobacterium nucle...
20089710  10 CRNILEKVLAGEIK-DEDqLNKVKKDVSKLYHLASLPRNGDIIMQGT--PEEQavIKEFLRRKPVRTISGVAVIAVMTSP 86  Methanosarcina acet...
20094488  27 CRELVEKMLSGEIR-TKGeLQEAKREVCRKYGLSKFPTDADVLERAT--PEERekLREIVVKKPVRSISGVAVVAVMTKP 103 Methanopyrus kandle...
15678839  15 sRLIINGIISGEIR-TRKdLERFKHRVCREMGLERFMSNSEILEHAT--PEEKkvIEGLLRKKPTRTISGVAVVAVMCQP 91  Methanothermobacter...
18312276   1 ------------------------------------------------------------------MASGVHVVALMTQP 14  Pyrobaculum aerophilum
19115774  14 CAEIVAELIASENQnKVInLNALKMRISKKHQLSESPRLTDIIAAIPpdAYLKesLMRKLRAKPVRTASGIAVVAVMCKP 93  fission yeast
15790500  14 CEELVSRILAGDVG-KDD-IEDAKLDVCGEYAASKVPKHSDLLDVAP--DGRRdeLEDVLQRKPVRTASGVTPVAIMTSP 89  Halobacterium sp. N...
14591614 113 FPCPH-----GRCIYCPGGPS---VGSPQSYTGKEPSALRASQYGYHPYIIMMARLKQLYDIGHPIDKVEVIIQGGTFPA 184 Pyrococcus horikoshii
15895026  15 EGCPH------DCVFCNQN---------TITGEESKVNGDYVKSTVEDY---------LDTIPNKSATIEISFFGGTFTA 70  Clostridium acetobu...
19173436 138 HRCPHialtgNICVYCPGGPDsdfEYSTQSYTGYEPTSMRAIRSRYDPFEQARERLRQLKALGHNTDKVEYIIMGGTFMS 217 Encephalitozoon cun...
19703498  13 FGCPN------ACVFCNQK---------KINGRETDVSLDDLKNIIDSY---------LKTLPKNSIK-QVAFFGGTFTG 67  Fusobacterium nucle...
20089710  87 APCPH-----GVCLPCPGGPNs-aFKSPQSYMGREPAAMRAIQHEFDPYAQVQSRLSQLKEIGHDVEKVELIVMGGTFSA 160 Methanosarcina acet...
20094488 104 YPCPH-----GRCAYCPGGPe---KGVPQSYTGKEPAGRRAKEHEFHPRKQVEARIRQLEISGHPTDKIELIVMGGTFPA 175 Methanopyrus kandle...
15678839  92 RECPH-----GRCLYCPESe----K-APPSYTGEEPAALRARMYDFHPYRQVYNRLEQLHSIGHPVDKVELIVMGGTFPS 161 Methanothermobacter...
18312276  15 FPCP------GRCTFCPSS-----ADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVIMGGTFSA 83  Pyrobaculum aerophilum
19115774  94 HRCPHiamtgNVCVYCPGGPDsdfEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLRSLGHTVDKVEYIIMGGTFMS 173 fission yeast
15790500  90 HTCPH-----GKCLYCPGGPAs-eFTSSQSYTGHEPAAARGVQNDYDPYGQVTLRLHQLRQIGHPVDKVELILMGGTMTA 163 Halobacterium sp. N...
14591614 185 VDLDYQEWFVKCAFKAMNDFhYFKdidnleeklvrlilkgdksvfkedpefkrawerthrkpyyyLEDEQRKNEKAKVRM 264 Pyrococcus horikoshii
15895026  71 INIEKQKELLSVARHYKE----------------------------------------------------------IGKI 92  Clostridium acetobu...
19173436 218 LPESYRDRFISRLHDALSGHtSPT-----------------------------------------VEEAIRVGAEGRLKC 256 Encephalitozoon cun...
19703498  68 ISMNLQKEYLEVVKKYID----------------------------------------------------------NNDV 89  Fusobacterium nucle...
20089710 161 RSLDYQEWFSKRCLEAMNDFtGtewrenvrq-------------------------igkaspyipLEEVQKANEVADIRN 215 Methanosarcina acet...
20094488 176 TPLCYQEWFVRECLNAMTGK-DALt----------------------------------------IEEAQKYAETSERRP 214 Methanopyrus kandle...
15678839 162 HSLCYQEWFISMCLKAMVDFgAELrgirvdvp--------------------------ehhgyvkVEDAQRLNESSPVRC 215 Methanothermobacter...
18312276  84 LPRGYREWFVANIYKALNDFpHWTssad---------------------------------ptpnLEAEQIRNETAELRM 130 Pyrobaculum aerophilum
19115774 174 LPESYRHTFIANLHNALSGAtTED-----------------------------------------LDEAVKFSEQSETKC 212 fission yeast
15790500 164 RSHDYQEWFVKRALQALNDFdPDQepapnqtesfa--------------------qdpaeydfryLEDVIADNEHGALRN 223 Halobacterium sp. N...
14591614 265 VGLTIETRPDWAFERQIDRMLSFGTTRVELGVQTIFNFIHERTKRGHGVEEIIKATQLLKDAGLKVNYHIMPGLPGSNFD 344 Pyrococcus horikoshii
15895026  93 KYIRLSTRPDYIDDEILTNLKNYSVDIIELGVQSLDSEVLLKSGRGHTKEDVVKASRLIKKYGFTLGHQIMLGLPGDNAE 172 Clostridium acetobu...
19173436 257 VGITIETRPDFCVRPHLSKMLGYGCTRIEVGVQSVYEDVARDTNRGHTVESVCESFALAKDAGFKIVAHMMPNLPNVPMK 336 Encephalitozoon cun...
19703498  90 EGVRISTRPECIDDEILTQLKKYGVKTIELGIQSLDDKVLKATGRNYTYDIVKKSCDLIKSYGFELGVQLMIGLPKSDFK 169 Fusobacterium nucle...
20089710 216 VGITFETRPDWAAEEHVDEFLRLGGTKVELGVQSVYDFILTRMQRGHGVAEIVRANRVLRDSAFKVGFHMMPHLPGANSE 295 Methanosarcina acet...
20094488 215 VGITFETRPDYCKEEHVDHMLKLGATRVEVGVQTIYDFILKRVDRGHTVKDTVEATRILKDAGLKVCYHIMPGLPGSNPE 294 Methanopyrus kandle...
15678839 216 VGMTFETRPDYCREEDVDRMLGLGVTRVELGVQTIYNYIYQRIKRGHSIRDVVESNRILRDSGVKVAMHLMPGLF-SDFE 294 Methanothermobacter...
18312276 131 VALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD 210 Pyrobaculum aerophilum
19115774 213 VGITIETRPDYCLDQHLDEMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFQLAKDTGYKVVTHMMPDLPNVGME 292 fission yeast
15790500 224 IGTTFETKPDWCDPEQVDRMLDLGATKVEVGVQTTFERVNREMHRGHGVQASVDANRRLRDAAFKVGFHMMPGQPGMSKE 303 Halobacterium sp. N...
14591614 345 RDLYTFRTIFEDPRFRPDMLKIYPTLVTRDAPLYAWYKAGLYRPYTTEEALELLVEAY-KIFPKWVRVMRIQRDIPAHLI 423 Pyrococcus horikoshii
15895026 173 KDIETTRKVICMK---PNICRIYPALVIKDTAMEKMYNRGIYKPYDIEECVEISKIVFgMLFANDIEVIRIGLQPTEEIN 249 Clostridium acetobu...
19173436 337 RDLAQFREYFDNPGFRSDGLKIYPTLVIKGTGLFELWKNNKYRNYSPDELIDLLARIL-SLVPPWMRIYRVQRDIPMTLV 415 Encephalitozoon cun...
19703498 170 SDLQSAIKSLDLN---PDIARIYPTLVIKGTELEFMYKKNLYQSLTVEEAVERTVPIYsLLELKNINVIRVGLQPVEDLT 246 Fusobacterium nucle...
20089710 296 LDLRGFKKLFEDPRFRPDYLKIYPTLVTEGTALYRMWEAGEYQALSDEEAAELVADIK-SVLPKWVRLQRIQRDIPAHQI 374 Methanosarcina acet...
20094488 295 RDLRMLKRLFKDPRFKPDMLKIYPCMVFEDTPLYDAWKRGEYEPYDEETAVKVIAEAKhRYVPEYCRIMRVQRDIPAHLA 374 Methanopyrus kandle...
15678839 295 RDLRIFRRIFRDPSFRPDMIKIYPCLVTRGSELYSLWERGLYKPYSTEEAVELIVEIK-KMMPKWVRTMRIQRDIPSRLI 373 Methanothermobacter...
18312276 211 RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIY-ASIPRWVRVMRFGRDIPLHHV 289 Pyrobaculum aerophilum
19115774 293 RDIFQFQEYFENPAFRTDGLKLYPTLVIRGTGLYELWKTGRYKNYTPNALVDLIARIL-ALVPPWTRIYRIQRDIPMPLV 371 fission yeast
15790500 304 MVLEDFRRLFDDERWKPDYLKIYPTLVVRDTITYDMWRNGDFEPLHNEEAADLVAEIK-DMIPRYTRLQRVQRDIPADFI 382 Halobacterium sp. N...
14591614 424 VAGVKHSN-----LGQLVFNELVRRGIRPREIRFREVGHQMQKFGKIPEVEHIKLLREDYEASEGQEIFLSFEDVKNDIL 498 Pyrococcus horikoshii
15895026 250 TDGELVAGpfhpaFRELVEGSIMNEMIFDNLKECESNTVDIYLN-------P---KDISKLYSNKKTFFYSMKDKLNNLR 319 Clostridium acetobu...
19173436 416 SSGVEHGN-----IRELALARMKDYRTRCRDIRTREVGIRNIHENILP--EEVELVRRDYVANKGWETFLSYEDVKQDIL 488 Encephalitozoon cun...
19703498 247 ADGVIISGpfhpaFRDLVENKIYFNFLSKFYDKEKKLNIEVNERNVSKIVGQKAINKKTFYPNFKILINNNLSLDELMVN 326 Fusobacterium nucle...
20089710 375 FAGVRKSN-----LRQLAEEKLREKGGKCRCIRCREVGHNSLKGRRINEKDIEL-TMESYEACNGTEHFIAFEDLSADVL 448 Methanosarcina acet...
20094488 375 AAGIRKTN-----LRQLVHDYLEEKGWECRCIRCREAGHRMRQGVEVDPGRAELRIIKERTWKGGMDYFLAYEDPEADAI 449 Methanopyrus kandle...
15678839 374 VDGVRKSN-----LGEMVYRRLEEEGVRCRCIRCREVGHMSRRGVRVDEDAVTL-MVEEYAATGGREFFLSQEDPENDVL 447 Methanothermobacter...
18312276 290 LDGPRWGN-----MRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEV-KKTEYEASGGLEIFLEAVGPD-DTL 362 Pyrobaculum aerophilum
19115774 372 SSGVETGN-----LRELALNRMRDLGTKCRDIRAREVGMQEVHHKIHP--EQVELLRRDYTANGGWETFLSYEDPKQDIL 444 fission yeast
15790500 383 DAGVWKSN-----LRQLARQRMAEHGYTCDCIRCREAGMNDD-----DPENVSL-DVETYAAGGGTEQFISIEDFQQDLL 451 Halobacterium sp. N...
14591614 499 IGFLRLRIPSEKAHRKEINCc-----------------------PSAIVRELHVYGPLVPIGE-KpKYEWQHRGYGRELL 554 Pyrococcus horikoshii
15895026 320 INVIQNPEVEKDTLKMNFDDn------------------------CKIVSKYEYLKVKYKEGK----------------- 358 Clostridium acetobu...
19173436 489 IGLLRLRKCSVDTFRTELRGlglqpaanegsleadghhpavvneHSSIIRELHVYGSAAAISK-SdGTKYQHQGYGTLLI 567 Encephalitozoon cun...
19703498 327 SKKYTRKEILEGEFNEKISDfi---------------------------------------------------------- 348 Fusobacterium nucle...
20089710 449 IGFTRLRFPAA-PHRQELQ-------------------------DSALIRELHVYGSMVPVGKgAkQKEWQHRGYGKELI 502 Methanosarcina acet...
20094488 450 LGYLRLRKPTELAHRPEIDP------------------------ETAIVRELKVVGPTVPIGErD-TDAVQHRGLGERLM 504 Methanopyrus kandle...
15678839 448 VGFLRLRFPSEEAHRPEVDD------------------------KTALVRELHVYGSMLPIGErG-DAVGQHRGYGEELL 502 Methanothermobacter...
18312276 363 YAILRLRIPNR-PHRPELY-------------------------KAALVRELHVYGPAVPVGKqG--IWWQHSGMGRELM 414 Pyrobaculum aerophilum
19115774 445 IGLLRLRQCSDKTYRPEFTs-----------------------qPTSLVRELHVYGSAVPVHS-RdPKKFQHQGFGTLLL 500 fission yeast
15790500 452 VGFARLRFPNE-PAREELT-------------------------DAALLRELHVYGSEVSVGDdTgDDQHQHQGYGRQLM 505 Halobacterium sp. N...
14591614 555 SEAERIAREEFdAKKILVISGVGVREYYR-KFGYRKDGPYVSKRL 598 Pyrococcus horikoshii
15895026     ---------------------------------------------     Clostridium acetobutylicum
19173436 568 AEAERIARDEHkSAKIAIISGVGTRNYYA-RFGYVLEGPYMVKSL 611 Encephalitozoon cuniculi
19703498     ---------------------------------------------     Fusobacterium nucleatum subsp. nucleatum ATCC 25586
20089710 503 EHAEKIASEAG-YGKLAIISGIGAREYYR-KLGYNLDGLYMAKTL 545 Methanosarcina acetivorans C2A
20094488 505 RKAEELAASELdADKIIVISAIGTREYYR-KLGYERVGPYMGKDL 548 Methanopyrus kandleri AV19
15678839 503 ARAESLAADNG-MEKILVTSGIGAREYYS-KFGYLKEGPYMAKKL 545 Methanothermobacter thermautotrophicus str. Delta H
18312276 415 RLAEEIAGEFG-ALKIAVISGVGVREYYR-KLGYERCGPYMCKPL 457 Pyrobaculum aerophilum
19115774 501 EEAERIAKYEHgSKKISVISGVGVRKYYQ-KLGYTLDGPYMSKWL 544 fission yeast
15790500 506 ERAEHLAADSG-FEKLSVISGIGARQYYKqQLGYHQDGPYVSKRL 549 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap