Conserved Protein Domain Family
YhcC

?
COG1242: YhcC 
Radical SAM superfamily enzyme [General function prediction only]
Statistics
?
PSSM-Id: 224163
Aligned: 18 rows
Threshold Bit Score: 430.206
Threshold Setting Gi: 2496003
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20093484   1 MYEDGEKFAAFGAYYRREKGCKVMKAAVDAGFVCPNKDGRISREGCLFCPKMGRTiiTPNVDPRKKLEEQARKQMEVFRE 80  Methanopyrus kandle...
2851640    1 -MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFA--DEAQQHR-SIAEQLAHQAN---- 72  Escherichia coli
2851640    1 -MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFA--DEAQQHR-SIAEQLAHQAN---- 72  Escherichia coli
2851640    1 -MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFA--DEAQQHR-SIAEQLAHQAN---- 72  Escherichia coli
2496003   17 IYSEGYLFAQYGIYIKKKFKQKIFKIPVDIGLGCPHKKN----GGCIFCPEMGRPisVKYCSAKIPLKEQIKKQME-NQK 91  Methanocaldococcus ...
15927337   7 YAFENKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGSG--DFAGNRADSIAVQFKEIKEKMHE 84  Staphylococcus aure...
16766624   1 -MQLQKLVNMFGGDLLRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFA--DEAQQHH-SIAEQLAHQAH---- 72  Salmonella typhimur...
15643281   1 -----MRYRKLSDYLKERYGERVQRIVIHGGFSCPNRDGTKGKGGCIYC-DATG----SGFTTLMRLP--IREQVMEMKK 68  Thermotoga maritima
15642368   4 PMHLHQLVNTIGQDLQRRYGEKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFA--DENTQQQ-SIQAQLKDRAG---- 76  Vibrio cholerae
16800838   9 YSNDNKRYHTWNYCLREEFGQKTYKVALDGGFDCPNRDGTVAHGGCTFCSAAGSG--DFAGNRALDLKVQFQQVRDKMQT 86  Listeria innocua
20093484  81 RYGAEK---FLVYFYPATNTYAPPDVLEELYNRALEMEDVVGLSIGTRPDCLPDEVLDILEGYVKEgYDVWLEIGVQSYH 157 Methanopyrus kandle...
2851640   73 LVNRAKr--YLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPDCVPDAVLDLLCEYKDQgYEVWLELGLQTAH 150 Escherichia coli
2851640   73 LVNRAKr--YLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPDCVPDAVLDLLCEYKDQgYEVWLELGLQTAH 150 Escherichia coli
2851640   73 LVNRAKr--YLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPDCVPDAVLDLLCEYKDQgYEVWLELGLQTAH 150 Escherichia coli
2496003   92 KKGFKK---FYIYFYPGTNTYAPAEKLKEIWDFSLSYKEVIGLSIGTRPDCLEKEKLDILAEYVENgYDIWIDLGVQSMH 168 Methanocaldococcus ...
15927337  85 KWHEGk---YIAYFQAFTNTHAPVEVLKEKFEPVLKEPGVVGLSIGTRPDCLPDDVVEYLADLNQR-TYLWVELGLQTIH 160 Staphylococcus aure...
16766624  73 LVNRAKr--YLAYFQAYTSTFAEVQVLRSMYQQAVSQASIVGLCVGTRPDCVPQAVVDLLCEYKDQgYEVWLELGLQTAH 150 Salmonella typhimur...
15643281  69 KYEKRGikkFIAYFQSFSNTYAPVEMLRERYEEALVDDSIVQLSVSTRPDLVPERVLDLFEEFKKR-VDVSVELGLQTAN 147 Thermotoga maritima
15642368  77 EIKRAKk--YLAYFQAYTSTYAEVQVLKSMYEQALEEADIVGLCVGTRPDCVPDAVLKLLADYVQQgYEIWLELGLQTAH 154 Vibrio cholerae
16800838  87 KWKDGk---CIAYFQAFTNTHAPVAELREKFETVLNEPGVVGLSIATRPDCLPDDVVEYLAELNER-TYLWLELGLQSAH 162 Listeria innocua
20093484 158 HRTLRRTRRGHGLAEVIDAITRAKERGIRIVNHIIFGLPGETRDEMLETVRVLSVLGVEAVKLYPLVVLERTDLERMYYD 237 Methanopyrus kandle...
2851640  151 DKTLHRINRGHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEA 230 Escherichia coli
2851640  151 DKTLHRINRGHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEA 230 Escherichia coli
2851640  151 DKTLHRINRGHDFACYQRTTQLARQRGLKVCSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEA 230 Escherichia coli
2496003  169 QKTLEILNRGHDVSDIIKAIKDCHKRGIKVCGHVILGLPGESWKEMMETAKILSLLEIEAVKIYPLVVVKGTKLEEMYWK 248 Methanocaldococcus ...
15927337 161 QSTSDLINRAHDMKTYYDGVAKLRKHNINVCTHIINGLPGEDYDMMMATAKEVAQMDVQGIKIHLLHLLKGTPMVKQYDK 240 Staphylococcus aure...
16766624 151 DKTLRRINRGHDFACYQRTTRIARERGLKVCAHLIVGLPGEGQAECLQTMERVVETGVDGIKLHPLHIVKGSTMAKAWEA 230 Salmonella typhimur...
15643281 148 YRTLKKINRGHTLAEFVDAAVRVKKRGIELVVHVILNLPWDDMEDVVETAKILSALDVDGVKLHSLYVVEGTKLAEMYKK 227 Thermotoga maritima
15642368 155 DQTLKRINRGHDFACYAEITAKARALGIKVCTHLIVGLPGEERTENLTTLQQVLKVGTDGIKLHGLHIVEGSTMAKAWRA 234 Vibrio cholerae
16800838 163 DETGRLINRAHDYDCYLEGVRKLQKHNIRICTHIINGLPKETPEMMMETAQKVVESGVDGIKIHLLHLLKGTPMVEDYKK 242 Listeria innocua
20093484 238 RRYKPLSYREYIRLLADALERMAPTVLIQRLSKDrAPDEERIEPEWDLYRMRVISDVRKELARRESRQGELYKVGLSAE 316 Methanopyrus kandler...
2851640  231 GRLNGIELEDYTLTAGEMIRHTPPEVIYHRISAS-ARRPTLLAPLWCENRWTGMVELDRYLNEHG-VQGSALGRPWLPP 307 Escherichia coli
2851640  231 GRLNGIELEDYTLTAGEMIRHTPPEVIYHRISAS-ARRPTLLAPLWCENRWTGMVELDRYLNEHG-VQGSALGRPWLPP 307 Escherichia coli
2851640  231 GRLNGIELEDYTLTAGEMIRHTPPEVIYHRISAS-ARRPTLLAPLWCENRWTGMVELDRYLNEHG-VQGSALGRPWLPP 307 Escherichia coli
2496003  249 GEYRTLDENQYISLVCDFLEHLSPYVLIQRLSKDkVPESIKVSPEWYLGRLKIMNKVSEILKKRGTKQGARFFR----- 322 Methanocaldococcus j...
15927337 241 GLLTFMTQEEYTNLVVDQLEVIPPEMIVHRITGD-GPIDIMVGPMWSVNKWEVLNGIDAELARRNSYQGLRYKSKVKQ- 317 Staphylococcus aureu...
16766624 231 GRLNGIELDDYTLTAGEMIRHTPPEVIYHRISAS-ARRPTLLAPLWCENRWTGMVELDKYLNEHG-VQGSALARPWIPP 307 Salmonella typhimuri...
15643281 228 GEVKICSLEEYIDRAITFLEYLSPNVVIHRLVAD-PPRKGTIFGNWGKSKIEIINMIEEELERRDTYQGKKFDYLNR-- 303 Thermotoga maritima
15642368 235 GRLTVLDQDQYVSIACEMIRSTPPEIVYHRVSSA-ARRPTLLAPLWCENRWWAMTAIGQRLEKEG-AQGSLLGTPFEYS 311 Vibrio cholerae
16800838 243 GDLEFLTRDGYVNLVADQLEILPPEMVIHRITGD-GGVDDLIGPVWSLNKFEVLNAIDAELVRRDSWQGKLYQPVEVSS 320 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap