Conserved Protein Domain Family
HemN

?
COG0635: HemN 
Coproporphyrinogen III oxidase or related Fe-S oxidoreductase [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 223708
Aligned: 85 rows
Threshold Bit Score: 222.531
Threshold Setting Gi: 16081159
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17548001  53 QRFDTHg-PRYTSYPTADRFHT-----GFGTDTYLDALHrraai---------------------apalhAPLSLYVHLP 105 Ralstonia solanacearum
15595001   1 --------------------------------------------------------------------------MRVDLL 6   Lyme disease spiroc...
15613715  26 EPEILWg-EQEADLHVSFELLSn---lKARASLRHASLEqplttl-------------------fsypewSMFDRADEQK 82  Bacillus halodurans
15833637  21 FKDRRAmmPFRGAIPVAKEQLA-----QTWQEMINQTASp------------------------------RKRLVYLHIP 65  Escherichia coli O1...
19704106   6 YKSHHDvgNIISKFTENLKASK-----NDFLDLLNRENKn------------------------------KQLGIYFHTP 50  Fusobacterium nucle...
19704933  74 KISLLKllDKKYDWGSLMGVRPtkilrRLLINGCDYKEArkilkdfylvtdekinlmetvvkkelelldkEHINLYIGIP 153 Fusobacterium nucle...
16767277   1 MNNNDIyrQYMYSYPHKTAYREl----ENVSFSEVKPRIye-----------------------------hDTHLYVHMP 47  Salmonella typhimur...
15601663  20 DPLRFAfqNKHSAHAGGIAMPVpsheqANVWQHITQQVSqr----------------------------qQVRCLYIHVP 71  Vibrio cholerae
16120625  17 FPKRWAtmPWRDSRPLPAESLQ-----DSWQSLLQKALPr------------------------------NKRLLYLHIP 61  Yersinia pestis
15804047  21 FKDRRAmmPFRGAIPVAKEQLA-----QTWQEMINQTASp------------------------------RKRLVYLHIP 65  Escherichia coli O1...
17548001 106 FCANLCYYCGCNKVVTKDH--TRSARYIGALAREMAMVARHIGPL-----RQATQLHWGGGTPTFLSHDEMRDVMAATRE 178 Ralstonia solanacearum
15595001   7 PLVELSLYINLSFCCKDFS-------IFNRILEELKCHLILLGHP------IIKTLYIKHVDFCLSRQDNLKFIFTSLSK 73  Lyme disease spiroc...
15613715  83 LMKRVLNYLFVDVMEQWSGlkQPWGVLTGVRPTKLMHQMRRAGLNreqirKELKDLYRVSEEKVGLLERIVERQLAVLPD 162 Bacillus halodurans
15833637  66 FCATHCTFCGFYQNRFNED---ACAHYTDALIREIEMEADSVLHQs----APIHAVYFGGGTPSALSAHDLARIITTLRE 138 Escherichia coli O1...
19704106  51 YCDKICSFCNMNRKQLDND----LEEYTKYLCEEIKKYGAYEFCKt----SEIDVVFFGGGTPTIFKKEQLERILKTLNE 122 Fusobacterium nucle...
19704933 154 FCPTKCKYCSFASYEINGGvgRFYNDFVEALLKEIQIVGDFLKTYs----KKVSSIYFGGGTPSTLTEEDLERVLKKLLE 229 Fusobacterium nucle...
16767277  48 FCQSRCGFCNLFTCTGADN--TFIDSYIDAIITQGRQMALAPAH--------WASFTVGGGTPLLLNIAQLEKLFFSVFD 117 Salmonella typhimur...
15601663  72 FCRVRCTFCNFFQNAASR---QLVDAYFAALLEEIKQKAALPWTQt----GVFHAVYIGGGTPTELSPEQIRQLGTAIRE 144 Vibrio cholerae
16120625  62 FCATHCTFCGFYQNPLQSG---STERYTDYLLRELSMEADSPLLQg----GPIHAIYFGGGTPSALSAQQLHSIISQLRK 134 Yersinia pestis
15804047  66 FCATHCTFCGFYQNRFNED---ACAHYTDALIREIEMEADSVLHQs----APIHAVYFGGGTPSALSAHDLARIITTLRE 138 Escherichia coli O1...
17548001 179 HFAlTSD--AEVSVEL-DPRHASDATLEVLAGLGFN-RASLGIQDFDADVQRAIHRVQSVEQTRRVVDSARR--LGFESI 252 Ralstonia solanacearum
15595001  74 YIN--LEllEEFTLEI-IPGYVDFEKFKLLDEFCIT-RINLNVQSFSLEFRKIVGIPEISYKKLNILINNIR--KFPFDL 147 Lyme disease spiroc...
15613715 163 LDElDRGvsVYIGIPF-CPTKCAYCTFPAYAINGKNgSVEAFLAGLHYEIEATGKWLTDHQIPVTTVYFGGGtpTSITAE 241 Bacillus halodurans
15833637 139 KLP--LApdCEITIEG-RVLNFDAERIDACLDAGAN-RFSIGIQSFNSKIRKKMARTSDGPTAIAFMESLVK--RDRAAV 212 Escherichia coli O1...
19704106 123 NFK--FAkdYEMTFETtLHN-LSFEKLKVMEENGVN-RISVGIQTFSNRGRKLLNRTYDKDYVVERLKEIKK--RFSGLV 196 Fusobacterium nucle...
19704933 230 NI--DMSdvKEFTFEAgREDSLNAKKLEIMKKYSVD-RISLNPQSFNLETLKRVNRRFNRENFDLIFKEAKK---LNFII 303 Fusobacterium nucle...
16767277 118 VLN--VDwnIYKTIET-SPTDTTAEKVALLNAFSVN-RVSIGVQSFHDSELHTLHRRHNAASAHQALEWLKA--GHFPSL 191 Salmonella typhimur...
15601663 145 SFP--LTpdCEITLEG-RIHRFSDEMFENALEGGFN-RFSFGVQSFNTQVRRRAKRLDDREVVMERIASLAA--TQQAPI 218 Vibrio cholerae
16120625 135 SLP--LApdCEITVEG-RIFNFDDERIDACLEAGAN-RFSIGVQTFNTRIRQRMGRKADRDQAIRFLTDLAT--RDRAAV 208 Yersinia pestis
15804047 139 KLP--LApdCEITIEG-RVLNFDAERIDACLDAGAN-RFSIGIQSFNSKIRKKMARTSDGPTAIAFMESLVK--RDRAAV 212 Escherichia coli O1...
17548001 253 SFDLIYGLPHQHTATFNATLDRVLEMA-PDRLSVYSYAHLPHLFKPQRRIDAL-ALPSAD-EKLDLLAMTVERLVAAGY- 328 Ralstonia solanacearum
15595001 148 NIDMTVNMPLQKKSHLKRDLKELLSYM-PEHICFSDFICEEEGFVLRDFDN----SIDSE----KLWFCALECLESNGY- 217 Lyme disease spiroc...
15613715 242 QMDALYETLYDSFPAMNQVRELTVEAGrPDTITPEKIEVLKKWNVDRISINPQsFENETL-QAIGRHHSVEETIEKYKMa 320 Bacillus halodurans
15833637 213 VCDLLFGLPGQDAQTWGEDLAIARDIG-LDGVDLYALNVLSNTPLGKAVENGRtTVPSPA-ERRDLYLQGCDFMDDAGW- 289 Escherichia coli O1...
19704106 197 CIDIIYNYANQTDEEVLQDADLLAEVG-ADSASFYSLMIHDGSNISKEREKDKsVYIYNLaRDEKLHNLFYNRCIEKGY- 274 Fusobacterium nucle...
19704933 304 NMDLIIGLPEETTEEILDTLSQLKDYD-IDNLTIHCLAFKRASKLFKESQERN--SIDRAlIEKNIQKIVEEKAMKPYY- 379 Fusobacterium nucle...
16767277 192 NIDIIYGIPGQTHASLTESLHQALVYQ-PEELFLYPLYNMPRQENMHSYY-----------------VLARDLLRNAGY- 252 Salmonella typhimur...
15601663 219 VIDLLYGLPYQTAQVFEQDLQDFMQTG-AQGIDLYQLVVGGSAPMLNLVEKGKlPPPATTpDKASLYQIGVEFMAKHHL- 296 Vibrio cholerae
16120625 209 VCDLMFGLPHQTPEIWQEDLAIVRQLP-LDGVDLYALNLLPTTPLAKSVENNRvELPTLA-QQCDFYCSGADSLAQAGW- 285 Yersinia pestis
15804047 213 VCDLLFGLPGQDAQTWGEDLAIARDIG-LDGVDLYALNVLSNTPLGKAVENGRtTVPSPA-ERRDLYLQGCDFMDDAGW- 289 Escherichia coli O1...
17548001 329 VYIGMDHFARpddalaiaqREGRLQRNFQGYSTHadcDLLAFGMSAISRVGD-----VYAQNEKELDAYYARID--AGEL 401 Ralstonia solanacearum
15595001 218 INYEITNFAL---------KGHESRHNKLNWELK---PHLGLGLYAVSLLFCn----DKNNNVRALIRKTGSFV--KANN 279 Lyme disease spiroc...
15613715 321 RDLGMENINMdliiglpgeGPKEMARSLEETEKLm-pESLTVHTLSFKRASTm----TKNRDKYKVATRDEIAEmmAMTS 395 Bacillus halodurans
15833637 290 RCISNSHWGR-----------TTRERNLYNLLIKqgaDCLAFGSGAGGSING-----YSWMNERNLQTWHESVA--AGKK 351 Escherichia coli O1...
19704106 275 KLLELTKITNg-------rDAYKYIRNNNGLRNL-----LPIGAGAGGHIQD-----IGAYNMNQQMSFYSKTT------ 331 Fusobacterium nucle...
19704933 380 -MYRQKNIIEwgenigyskEGRESIFNIEMIEENq--NTMALGGGGISKIVI-----EERNGIDYIERYVNPKD------ 445 Fusobacterium nucle...
16767277 253 TQTSMRRFVLn--------PAPSAAAESCGFENS-----LALGAGGRSYLGNlhycsPWSSNLQTSRKIIQAFIdsPDKT 319 Salmonella typhimur...
15601663 297 RPLSVNHWTR-----------DNRERSLYNSLAKtyaEVLPIGCGAGGNMGG-----YSLMQHRQLDTYLDAMK--NGQP 358 Vibrio cholerae
16120625 286 HQLSNSHWAR-----------TTRERNLYNLLIKqgaDCLALGSGAGGSLQG-----HAYMQHRSLDNYYRLID--SGQK 347 Yersinia pestis
15804047 290 RCISNSHWGR-----------TTRERNLYNLLIKqgaDCLAFGSGAGGSING-----YSWMNERNLQTWHESVA--AGKK 351 Escherichia coli O1...
17548001 402 PVLRGLTLTPDDHVRRALIGELMCGFELDMRLFGTRHGLnFRq----sFASELTALAPLEDAGLVKVGD----ERIVITP 473 Ralstonia solanacearum
15595001 280 HLVTFELLEDLEFFVYHFIQGLGTIQGVSLRALRLRFEYnEKqffqfiNYCSTLSKKFVFDDNIMLLKGr---ERFKLNF 356 Lyme disease spiroc...
15613715 396 SWTEDHEYAPYYLYRQKNILGNLENVGYALPEKESLYN-----------IVIMEEVQTIIGLGCGATSKwvepGTGNISR 464 Bacillus halodurans
15833637 352 PLMLIMRNAERNAQWRHTLQSGVETARVPLDELTPHA------------EKLAPLLAQWHQKGLSRDAS----TCLRLTN 415 Escherichia coli O1...
19704106 332 EISHNLSMISGLMQFDKFDLEVIKKYCNEESYKIIYR-----------------KLKEFEKEGYIKIEN----N-FAIYQ 389 Fusobacterium nucle...
19704933 446 PALYIRELDKRCKEKIEMFKKEKI-------------------------------------------------------- 469 Fusobacterium nucle...
16767277 320 VINHGYLLPPDEMKRRFIIKNLFFWQGLSLSDYQQYFASd--------ALRDFPDLERFIRQGYCYQNG----SRLRLTE 387 Salmonella typhimur...
15601663 359 LVAMMARQHEYDPLFAALKAGFDAG-VIAKQRLPKFYHH-QT------FDWLMPLFLRWQQIGLVEVEQ----DYLTLTT 426 Vibrio cholerae
16120625 348 PLMMMTQ-ASGEHPWRAKLQSGIEVGRLDLSELIADP------------YPLMPLISQWYQSNLLKDNS----FCLRLTD 410 Yersinia pestis
15804047 352 PLMLIMRNAERNAQWRHTLQSGVETARVPLDELTPHA------------EKLAPLLAQWHQKGLSRDAS----TCLRLTN 415 Escherichia coli O1...
17548001 474 QG-RLLVRRIAMVFDAHLHAV 493 Ralstonia solanacearum
15595001 357 YLvKIINHFNDNFFKVKLRLP 377 Lyme disease spirochete
15613715 465 HAnPKDPRTYNERFKQYTEEK 485 Bacillus halodurans
15833637 416 Eg-RFWASNILQSLNELIQVL 435 Escherichia coli O157:H7
19704106 390 LKgIFWGNSLVADIIEEIGRH 410 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
19704933     ---------------------     Fusobacterium nucleatum subsp. nucleatum ATCC 25586
16767277 388 Tg-MALSDCLAPVFVSPEVML 407 Salmonella typhimurium LT2
15601663 427 Ag-RFWSVSLAQACIQVLIHS 446 Vibrio cholerae
16120625 411 Sg-RFWASNIMQALQNIIPSL 430 Yersinia pestis
15804047 416 Eg-RFWASNILQSLNELIQVL 435 Escherichia coli O157:H7 EDL933
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap