Conserved Protein Domain Family
PRK08446

?
PRK08446: PRK08446 (this model, PSSM-Id:181428 is obsolete)
coproporphyrinogen III oxidase family protein
Statistics
?
PSSM-Id: 181428
Aligned: 28 rows
Threshold Bit Score: 527.218
Threshold Setting Gi: 222823673
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157737443   1 MLLYIHIPFCDSKCFYCAFNSYtDKFSLKNDYMKALKIQLKNNIEKYvknRNKKIETVFIGGGTPSTIKAFEYKEIFEII 80 
218562231   1 MHFYIHIPFCESKCNYCAFTSL-KKNDYEKAYFKALKEDIVFQLKQFn-iQSNQIKTLFIGGGTPSCVNAYNYEDIFKIL 78 
57238224    1 MHFYIHIPFCESKCNYCAFTSL-KKNDYEKAYFKALKEDIVFQLKQFn-iQSNQIKTLFIGGGTPSCVNAYNYEDIFKIL 78 
154148889   1 MHIYIHIPFCESKCKYCAFGSFsDKFDLVNDYFKALVLEISHFN------FDEKISTLFIGGGTPSVVEAKFYAPVFEIL 74 
118475057   1 MQIYIHIPFCESKCPYCAFGSHsDKFSLTKRYFSALKSEIKESILN----LNKKISTIFIGGGTPSSVEAGFYSDIFEII 76 
121613561   1 MHFYIHIPFCESKCNYCAFTSL-KKNDYEKAYFQALKEDIVFQLKQFn-iQSNQIKTLFIGGGTPSCVDAYNYEDIFKIL 78 
154174156   1 MLLYIHIPFCESKCPYCAFGSVtNAQALTGGYFDALLTDIKFQIDKF---KISKFSSVFIGGGTPSAVSAKFYKKIFAEI 77 
157414862   1 MHFYIHIPFCESKCNYCAFTSL-KKNDYEKAYFKALKEDIVFQLKQFn-iQSNQIKTLFIGGGTPSCVDAYNYEDIFKIL 78 
153951392   1 MHFYIHIPFCESKCNYCAFTSL-KKNDYEKAYFKALKKDIIFQLKQFn-iQSNQIKTLFIGGGTPSCVDAYNYEDIFKIL 78 
222823673   1 MHLYIHIPFCESKCFYCSFTSL-KKKDFEKDYLNALMQDIKYQLDFFk-lDKNSIKTVFIGGGTPSLMDASFYEKIFIFL 78 
157737443  81 NPYLEEKVEITTEANPNSASFEWLETMKSLGVSRVSFGVQSFQNEKLKFLGRSHNSNSAIKAIQNASEIGFKEINCDIIY 160
218562231  79 YPLLDKNVEISCEANPNSATLNWLKNMKNLGVNRISFGVQSFHPKKLHFLGRIHNQEMIIKTLENANKVGFKNINLDLIY 158
57238224   79 YPLLDKNVEISCEANPNSATLNWLKNMKNLGVNRISFGVQSFHPKKLHFLGRIHNQEMIIKTLENANKVGFKNINLDLIY 158
154148889  75 RPHFKNLTEISIEANPNSANLKWLKEMRNLGVNRISFGAQSFNDEKLKFLGRIHSAKQIENAVQNAKIAGFDNINIDLIY 154
118475057  77 KPKLAKNCEITTEANPNSASLKWLLEMRELGVNRVSFGAQSFNEKKLKLLGRIHSKNGISKAVQNAKIAKFNNINIDLMY 156
121613561  79 YPLLDKNVEISCEANPNSATLNWLKNMKNLGVNRISFGAQSFHPKKLHFLGRIHNQEMIIKALENANKVGFKNINLDLIY 158
154174156  78 SPFCNDKTEITSEANPNSTNLRWLKDMRNLGVNRISFGAQSFFDDKLELLGRAHNCTQIYKAVQNAKNAGFRNINIDLIY 157
157414862  79 YPLLDKNVEISCEANPNSATLNWLKNMKNLGVNRISFGAQSFHPKKLHFLGRIHNQEMIIKALENANKVGFKNINLDLIY 158
153951392  79 YPLLDKNVEISCEANPNSATLNWLKNMKNLGVNRISFGAQSFHPKKLHFLGRIHNQEMIIKALENANKAGFKNINLDLIY 158
222823673  79 QYYLQKDSEVSIEANPNSSNLSWLKEIKNLGFNRISFGAQSFHEKKLQFLGRIHDQKSIFTSIENAKKAGFDIINLDLIY 158
157737443 161 GVKNDTLNSIKEDLDIAFSLP--ITHISAYSLTIEEGTKFFklDKNSVKIDDEDLSYEIFDYFSKNGFTQYEISNFSRnk 238
218562231 159 DTKLDNKKMLEFELLHLKQIKdlITHLSAYNLTIESNTAFA--KKEHFKKNAPNLMKFFIKQLLELDFFQYEISNFSKtk 236
57238224  159 DTKLDNKKMLEFELLHLKQIKdlITHLSAYNLTIESNTAFA--KKEHFKKNAPNLMKFFIKQLLELDFFQYEISNFSKtk 236
154148889 155 DTKFDTKDNLKFELKNISNLK--ISHISAYSLILEKGTEFY--GKKSYKKDSSVLAGFLFKNLAEIGFKQYEISNFGR-- 228
118475057 157 GTKLDTKKLILTEVENIFNLN--ISHVSAYSLMLEENTPFF--ERINLKKDSPALAKFMIQELENIGHKQYEISNFGK-- 230
121613561 159 DTKLDNKKMLEFELLHLKQIKalITHLSAYNLTIESNTAFA--KKEHFKKNAPNLMKFFIKQLLELNFFQYEISNFSKtk 236
154174156 158 ATKLDNKKRLAQEVLALKNLG--VTHASAYSLTLEENTPFE--RKFELRNDSAALAKFMMKQIENIGLKQYEVSNFGK-- 231
157414862 159 DTKLDNKKMLEFELLHLKQIKalITHLSAYNLTIESNTAFA--KKEHFKKNAPNLMKFFIKQLLELDFFQYEISNFSKtk 236
153951392 159 DTKLDNKKMLEFELLHLKKIKalITHLSAYNLTIESNTAFA--KKEHFKKNAPNLIKFFIKQLLELDFFQYEISNFSKtk 236
222823673 159 DTKLDDKKMLDYEISKLTLLD--INHISAYNLTIEEKTKFA--KKFHFKKNAPRLAKHFIKAIENLGYKQYEISNFGQ-- 232
157737443 239 NSQSKHNYGYWQHKEYLGVGAGAVGYINKRREYPLKNLEEYIKNPLFVEIEEIDEDDIKVEKVLLGFRCLNGVELELFDE 318
218562231 237 AQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENPTFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQ 316
57238224  237 AQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENPTFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQ 316
154148889 229 --ICEHNFSYWKGEDYAGFGAYAVGTINKTR-KTSPDLFSYLKNPLKKSIEILNDKDIKTERILLGMRSSVGFSRKILNE 305
118475057 231 --PCLHNIGYWKQKDYLGFGAYAVGTIGEKRFYSTPNLEAYIKNPLEKSVENLSKNDKLNEHIFLGLRSIVGVKISNLND 308
121613561 237 AQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENPTFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQ 316
154174156 232 --PCKHNLGYWQGKEYIGAGAYSVGFMRSARYYAQKDLAGYIASPTHREIEVLNDDELRMEHVFLGARSCVGIDERRLTP 309
157414862 237 SQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENPTFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQ 316
153951392 237 SQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENPTFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQ 316
222823673 233 --ICKHNLAYWQGKDYIGCGLSAVGFLKNQRFYTKKSLKDYIANPCFREIENLNLQDLRLEHIFLGLRSVIGVDETKLEP 310
157737443 319 KELKKIDELISYEKVYIENNKVFNKNFLLADELALYILD 357
218562231 317 WQKDKINILLKEKKLFYKNKRYFNPNFLISDELALYLSS 355
57238224  317 WQKDKINILLKEKKLFYKNKRYFNPNFLISDELALYLSS 355
154148889 306 KELKKAEILLQSGKILFKNGRFYNTNFLLADEIALFILC 344
118475057 309 LQLQKANILAKKNRIYIKNGRIFNKNFLLSDEIYLFLT- 346
121613561 317 WQKDKINILLKEKKLFYKNKRYFNPNFLISDELALYLSS 355
154174156 310 QQRQRAEILRRSRKLKFERGRYFVKNFLLADEIALFING 348
157414862 317 WQKDKINILLKEKKLFYKNKRYFNPNFLISDELALYLSS 355
153951392 317 WQKDKINILLKEKKLFYKNKRYFNPNFLISDELALYLSS 355
222823673 311 LEKEKAMFLSKKGKLIYKNRIFYNTNYLLSDELALYIST 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap