Conserved Protein Domain Family
PRK08208

?
PRK08208: PRK08208 
coproporphyrinogen III oxidase family protein
Statistics
?
PSSM-Id: 181292
Aligned: 23 rows
Threshold Bit Score: 650.534
Threshold Setting Gi: 60681431
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
256390375   1 MLNGPYESYVYAYPHKTAYRPLVPKPLLSDVWRGEGRDALSFYTHIPFCEVRCGFCNLFTRTGAPESLTTAYLDALERQA 80 
108759540   8 LEGSPYVAYLYGYPHKTAYRPFTPALPLESVWAEERRDALFLYIHVPFCEMRCGFCNLFTAAGPKQDVVDGYLGALVRET 87 
28212117    8 IEENPYKSYIYSYPHKKSYRTFDKAFDLKKLWENRKSDNLTLYIHIPFCLNKCGYCNLFSTTDFNKDKMSKYVNKLIEEI 87 
72161143   13 PADTPYRTYVYGYPHKTAYRPLIPAPRLADVWRDEPTDALFLYFHIPFCEVRCGFCNLFTRAVPPAEQVTAYLDALARQA 92 
60681431    1 ---------MYSYPHKTAYRTLTPPVSLSPYLERLEGREASLYFHIPFCAHKCGYCNLFSQQCCDAERISLYLHTMRRQA 71 
159898365   7 ANATPYMGYSYSYPHKSAYRQLEPR-SLREVWADEAHDQLFLYLHIPFCEMRCGFCNLFTTTNPNESVVQRYLATLELQM 85 
182434745  11 PAVRPYESYVYAYPHKTAYRPLEDRPSLRALWAAEPKDALSLYLHIPFCEVRCGFCNLFTRIGAPEELTTRYLDALERQA 90 
271964726  35 TGAGPYQGYVYAYPHKTAYRPLEPRPSLREVWSGEPLGSLFLYLHIPFCEMRCGFCNLFTRTGAPEELVAAYLDALERQA 114
283777943  13 LHGDPYVGYAYSYPHKTAYRALEPR-TLGEVWEHESRSALSLYIHIPFCEMRCGFCNLFTYSQPADDWVANYLSALGRQM 91 
290955363  16 ASVRPYQHYVYAYPHKTAYRKLPGAPRLAGLWAGESRQALSLYAHIPFCEVRCGFCNLFTRIGAPDGLTGRYLDALERQA 95 
256390375  81 IAVRAAldesGPAPRFANAAIGGGTPTYLSPDELSRLFDIAEKVVGVGLGAIPLSVEASPATATPDRLTVLAERGTTRLS 160
108759540  88 KRVKEA----LGTASFARAAIGGGTPTLLDVAGLNTVFDMAEGVMGADMKNIPVSVEVSPETVDAQKLQVLRSRGTDRVS 163
28212117   88 KAVKNIld-lRKESVFYSVIFGGGTPTALPKDLMEKLLIVIEKDLNIDFKKIFFSMETSPNTMNKEYIDLLKKFHINRIS 166
72161143   93 EAVADAl---GGTARFARAAFGGGTPTYLTADELHRLYDLADRVLGVDLAAIPTSVETSPATATPERLDVVAARGASRIS 169
60681431   72 EQLSVA----AQGLKFTSFAVGGGTPLILDEGQLEELF-CLAELFGVHPSRVFTSVETSPEYTQKSVLRQLRARGVERLS 146
159898365  86 QALHNE----LGAVQFSRMAIGGGTPTYLSASELEQLFSMSQRWLGVNSRAIPLSVETSPHTATADRMAILAQAGVDRVS 161
182434745  91 DSVRDAlg-dEQPVRFAAAAFGGGTPTFLTAGELERLCDTAEKRMGADLGAVPLSVETSPATATADRLAVLADRGTTRIS 169
271964726 115 EAVRDA----LEEPRFVTAAIGGGTPTYLSAAELTRMFDLTERIMGADLRAVPLSVETSPATATADRLAVLAERGTTRIS 190
283777943  92 EVVAEQ----IPAAQFAQLALGGGTPTFLQTAELAQLLEQLKRVLDVPLGNLPISVEASPATTDDEKFALLRHYGVTRLS 167
290955363  96 IAVREAlg-dEEPVRFANAAFGGGTPTYLEAAELERLCDIAERHLGADLRAIPLSVEASPATATADRLAVLAERGTTRLS 174
256390375 161 LGVQSFDDVEARSAVRPQKAADVFAALDAVRAAD-IPVLNVDLIYGIEGQTRESWRASLQTALRWMPEEIYLYPLYVRPL 239
108759540 164 MGIQSFIEAEVAAVKRPQKTAQVEAALDLIRSTG-FPTLNLDLIYGMEGQTEESFLYSLRTALRYSPEEIYLYPLYVRPL 242
28212117  167 MGIQSFKECELKEICRFETVNNINKSLELMKKEN-IEIKNLDLIYGIPSQSMESFMDSLKRVIEYRPEEIFIYPLYIREK 245
72161143  170 IGVQSFLDAEAHAVGRPQRRADVDRALAAIRSHApRARLNIDLIYGIAGQTPDSWRYSLDAAVAYRPEEIYLYPLYVRPL 249
60681431  147 MGVQSFNETELKKLKRRPGLGTVVGALENIVEAG-FPQFNLDLIYGIEGQTVESFMRSLNTALTYRPNELFIYPLYVRPG 225
159898365 162 IGVQSFLDHEAHAAGRAQRRPEVEQALATVRAAQ-IPTLNIDLIYGLPNQSVATWLESLEIGLQWRPEELYLYPLYVRPL 240
182434745 170 IGVQSFVDEEARAAVRPQRRADVEAALGRIRDAR-IPVLNIDLIYGIDGQTERSWLASLDAALAWRPEELYLYPLYVRPL 248
271964726 191 IGVQSFVDAEARAAIRPQKRQEVETALGHIRETG-FEVLNIDLIYGIDGQTERSWRHSLDAALAWKPEEIYLYPLYVRPL 269
283777943 168 LGIQSFDADDLGAIGRPQKHDDVTRAIERIRRAG-FPILNLDLIYGGEAQTRRGWLESLRAAAQYEPEELYLYPLYVRPL 246
290955363 175 LGVQSFVAEEARAAVRPQRRSDVEAALGRIRDAG-LPVLNIDLIYGIDGQTAASWRLSLDAALAWRPEEIYLYPLYVRPL 253
256390375 240 TGLGRLNLNHDae---------wdAQRLDLYRCGRDFLLENGYEQVSMRMFRRLDAPv-VEGGEDYACQTDGMIGLGCGA 309
108759540 243 TFLGKKARAWD-------------DLRLSLYRVGRDFLLSEGYTQVSMRMFRARHAP--DAGGPVYRCQEDGMVGLGCGA 307
28212117  246 TKLYEKYKRDF-------------NKMTNMYELAKDELIKNGYIQTSMRNFIREDMN--EKLYPSYSCQENEMIGIGCGA 310
72161143  250 TGLGKRGRAWD-------------DQRRTLYQQGRDYLLERGYRQVSMRMFERVDAP--SETGPAYCCQTDGMVGLGCGA 314
60681431  226 TRIDVRSTD---------------DIGYAIYKSARELLVGQGFVQTSMRRFVRRETT-----ETEFSCGDEVMLSCGAGG 285
159898365 241 TGLDRRGTGWEh------------DLRLECYRAGRERLLAAGYQQISMRMFRAAHAPd-DSQAPRYCCQTDGMLGLGAGA 307
182434745 249 TGLHRLGPAVTgpearaledaawdEQRLRLYAVGRDHLLSHGYEQVSMRMFRRADAPreQEGPEDYACQTDGMIGLGCGA 328
271964726 270 TGLGRRARDWD-------------DHRLGLYRQGRDHLLAAGYEQVSMRMFRLRGSS----GATGYDCQSDGMVGLGCGA 332
283777943 247 TGLGSRPAKAPs------------DQRLERYREARDWLLANQYEQVSMRMFRRMGPC--EQTTTRYACQSDGMIGLGVGA 312
290955363 254 TGLGRHADPAVadr-------ewdETRLRRYREGRDHLLAQGYEQVSMRMFRRADAP--AQGPDDHACQTDGMIGLGCGA 324
256390375 310 RSYTASLHYSFDYAVSASEVRGIIDEYV--ATTDFSRVEVGYRLDADEQARRFLIQSLLqADGMERGDAVERFSA----- 382
108759540 308 RSYTGQVHYSSEYAVGSREVRSIISSYSerSEASFGEVGYGFRLDSAERRRRYMLLSLL-ADGVDLAVYRQRFCSdale- 385
28212117  311 RSYISNIHYSIKYAVNQSNINSIINNYL--KEENLYYATYGYILSEDEIKRKYILKSILkVTGLDLEEYFKRFNKnifd- 387
72161143  315 RSYTRGLHYSFDYAVGVRQVRAILDDYIsrGPGGFDCAEVGFRLDEDERRRRHLLQSLLqADGLDLDWYRSRFASdprtd 394
60681431  286 RSYLGNLHYATPYAVRQQAIADEIDHYI--RTTDFMTAANGFLLSTEEMQIRFIIKNLMyHRGVDLAEYEKRFGEkpd-- 361
159898365 308 RSYTRKLHYSSDYAVGASSVRQIIQNYNqrSLLDLSQVDYGCVVSSTEQRRRFVIQSLLqVSGLDTQAYRAQFGSdvla- 386
182434745 329 RSYTSALHYSFDYAVEMREIRSIIDRFT--ATEDFSRAEVGRYVDADEARRRHLLQSLLqAAGLPVADYRARFGTdpgad 406
271964726 333 RSYTSGLHYSYEYAVGAGQVRAIIDDYVrlAPGEFALANVGFRLDEDERRRRHLIQSLLqAEGLDPAAYRARFGTevtad 412
283777943 313 RSYTRQLHYASRFAVRQKSILGIIRNYIeqSPAEMGTVAHGIELHNEEQRRRYLLLSLLqVEGLDARAYQQHFASdlwn- 391
290955363 325 RSYTSRLHYSFDYAVGMSRIRTIIDDYT--ATEDFGQAVHGREVDEDEARRRHLLQSLLqARGMPVAEYRSRFGSdpyad 402
256390375 383 ---ELALLNDRGFLEsvsdrasasasASGa--------dGRLRLTPEGLAWSDAVGPMFFSEQVRAAMRAYELK 445
108759540 386 dfpELEELEAHGLAR-----------KNG----------GVVQLTAAGVERSDMIGPWLHSDQVQAMMKEYAWR 438
28212117  388 dfnEINLLIDKGFLI-----------KKG----------TRVYPTEKGLKYSDAMGCLFISNEVNKKTQDFSE- 439
72161143  395 fpaEFAVLTQRGWVT-----------ETS----------RVVRLTDEGLAYSDTVGPLFFSPRVTRLMAEYDAR 447
60681431  362 -rnLFREFTDRGWIE-----------ETG----------RIVRLTEEGMAYSDYIGQAFISPAVRKLMSEYVYP 413
159898365 387 dlsQINELIEIGWAE-----------YQH----------GIYQLTPAGLERSDLIGPWLYSPQIRQLSAEFILR 439
182434745 407 fpaELAGFAARGWLD-----------ASAp--------dGLLRLSPSGLAHSDALGPALFSPGVRAAMAAYERK 461
271964726 413 fgeDLERLAGRGWLEatgseagtrpgRSGadeshdgaggGRLRLAAEGLAHSDAIGPALFSGRVRELMAGYENS 486
283777943 392 dfpQLRGLVDHHLAT-----------FEG----------ELLALTPAGLELSDAIGPWLYSSEIRERMEGYAWT 444
290955363 403 fpaELELLAGRGWLA-----------EAGe---------GLLRLSGEGLAHSDAIGPGFFSPAVRAAMAGYEPR 456
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap