Conserved Protein Domain Family
PRK06294

?
PRK06294: PRK06294 (this model, PSSM-Id:180518 is obsolete)
coproporphyrinogen III oxidase; Provisional
Statistics
?
PSSM-Id: 180518
Aligned: 16 rows
Threshold Bit Score: 600.209
Threshold Setting Gi: 46446730
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46446730    6 NPTSSEISLYFHIPFCTKKCNYCHFYVLP-DQEPLKNQLLIALKLEWKRMLPLLINKCIISIYFGGGTPSLFSPDRIQAV 84 
76788765    1 MNGKTPLALYIHIPFCSKKCHYCSFYTIPyKEELMRSYCEAVIKEGLKKLAPLRCSHYIDTVFFGGGTPSLVPPALIQDI 80 
237802487   1 MNGKTPLALYIHIPFCSKKCHYCSFYTIPyKEELMRSYCEAVIKEGLKKLAPLRCSHYIDTVFFGGGTPSLVPPALIQDI 80 
237804402   1 MNGKTPLALYIHIPFCSKKCHYCSFYTIPyKEELMRSYCEAVIKEGLKKLAPLRCSHYIDTVFFGGGTPSLVPPALIQDI 80 
62185033    1 MNGKSPLALYIHFPFCSKKCHYCSFYTIPyNPESVSLYCNAILQEGLQKLSTIEDTHFVDTVFLGGGTPSLIPPHYLHNI 80 
89898396    3 MNGKTPLALYIHFPFCSKKCHYCNFYTIPyNPESVGLYCNAILQEGLHKLSTITDSYFIDTVFLGGGTPSLIPPHHLHNI 82 
29840180    1 MNGKQPLALYIHFPFCSKKCHYCSFYTIPyNPESVSLYCNAVLQEGLNKLAAIKDTHFIDTVFFGGGTPSLIPPHHLHNI 80 
16752659   22 MNGKAPLALYIHIPFCTKKCRYCSFYTIPyKSESVSLYCNAVIQEGLRKLAPIQETHFIETVFFGGGTPSLVSPLDLKRI 101
15618295    1 MNGKAPLALYIHIPFCTKKCRYCSFYTIPyKSESVSLYCNAVIQEGLRKLAPIQETHFIETVFFGGGTPSLVSPLDLKRI 80 
15835913    1 MNGKAPLALYIHIPFCTKKCRYCSFYTIPyKSESVSLYCNAVIQEGLRKLAPIQETHFIETVFFGGGTPSLVSPLDLKRI 80 
46446730   85 LETIHQDlpfdySTTEITLEVNPENGYFSLMRAYAQAGINRVSIGIQTLDQELLHLLGRLHSPSLAKRSVLETYEAGITN 164
76788765   81 LVALEAQ-----HATEITLEANPENLSLEYIQALVLTSINRISIGVQTFNDPLLKLLGRTHSSSKAIEAFMLCSQYGFSN 155
237802487  81 LVALEAQ-----HATEITLEANPENLSLEYIQALVLTSINRISIGVQTFNDPLLKLLGRTHSSSKAIEAFMLCSQYGFSN 155
237804402  81 LVALEAQ-----HATEITLEANPENLSLEYIQALVLTSINRISIGVQTFNDPLLKLLGRTHSSSKAIEAFMLCSQYGFSN 155
62185033   81 IQTL-AP-----HAQEITLEANPEDLSEFYLRELLLTAVNRISIGAQTFHDPLLKALGRIHSSAASIDAVHRCYEHGYNN 154
89898396   83 IKIL-AP-----HAQEITLEANPEDLSESYLRDLTQTPINRISIGVQTFHDPLLKAIGRIHSSSASIDAVQRCHEHEYHN 156
29840180   81 ITLL-AP-----HAQEITLEANPEDLSESYLRDLTLTPINRISIGVQTFHDPILKALGRIHSASTSMDAVHRCYEHEFHN 154
16752659  102 LKEL-AP-----HAREITLEANPENLTVSYLRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNHGFSN 175
15618295   81 LKEL-AP-----HAREITLEANPENLTVSYLRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNHGFSN 154
15835913   81 LKEL-AP-----HAREITLEANPENLTVSYLRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNHGFSN 154
46446730  165 LSIDLMYDLPRQSLKHWEMTLQEIGTLPLSHLSLYNLTIEPFTVFFKKQNFVRPLLPDEETSLAMYNAAIEHLTSFGLEQ 244
76788765  156 VSADLIYGLPTQSISDFIVDLHQAISLPIQHISIYNLTIDPHTSFYKHRKRILPSIADDDSLAEMALAAEELLENQGFTR 235
237802487 156 VSADLIYGLPTQSISDFIVDLHQAISLPIQHISIYNLTIDPHTSFYKHRKRILPSIADDDSLAEMALAAEELLENQGFTR 235
237804402 156 VSADLIYGLPTQSISDFIVDLHQAISLPIQHISIYNLTIDPHTSFYKHRKRILPSIADDDSLAEMALAAEELLENQGFTR 235
62185033  155 ISLDLIYGLPTQSLADFITDLHQALTLPIAHISLYNLTLDPHTSFYKHRRILAPSIADDDILAAMSLSAEELLTSRGFSR 234
89898396  157 ISIDLIYGLPTQSLSDFIADLHQALSLPITHLSLYNLTLDPHTSFYKHRRILERSIADDDILAAMSLSAEELLSSHGFSR 236
29840180  155 ISIDLIYGLPTQSLADFLADLHQALTLPIAHISLYNLTLDPHTSFYKHRRILTPSIANDDILAAMSLSAEELLSSRGFSR 234
16752659  176 LSIDLIYGLPTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFYKHRKILVPTIAQEEILAEMSLLAENLLLSQGFQR 255
15618295  155 LSIDLIYGLPTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFYKHRKILVPTIAQEEILAEMSLLAENLLLSQGFQR 234
15835913  155 LSIDLIYGLPTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFYKHRKILVPTIAQEEILAEMSLLAENLLLSQGFQR 234
46446730  245 YEISAFAKPGFYSKHNTGYWLARPFIGFGPSAFSYWEGKRFRNVANLKKYHQSLTLNQSPIDFNEQLDPIAHLKELFVIQ 324
76788765  236 YELASYAKNQAASKHNTYYWTAKPFLGLGVSASQYLHGIRSKNLSRISHYLRAAHQHLPTLESMEELPPNERIKETLALR 315
237802487 236 YELASYAKNQAASKHNTYYWTAKPFLGLGVSASQYLHGIRSKNLSRISHYLRAAHQHLPTLESMEELPPNERIKETLALR 315
237804402 236 YELASYAKNQAASKHNTYYWTAKPFLGLGVSASQYLHGIRSKNLSRISHYLRAAHQHLPTLESMEELPPNERIKETLALR 315
62185033  235 YELASYAKSQAQSKHNLYYWTDQPFLGLGVSASQYIHKVRSKNLSRISQYLRAVRKNLPVHESTESLPENERIKEALALR 314
89898396  237 YELASYAKFQAQSKHNLYYWTDKPFLGLGVSASQYFNKIRSKNLSRISHYLRALRKNLPLQEFTECLPEEERIKEALALR 316
29840180  235 YELASYAKSQAQSKHNLYYWTDKPFLGLGVSASQYIDKVRSKNLSRISQYLRAVRKNLPTHESTECLPEKERIKEALALR 314
16752659  256 YELASYAKPDYPAKHNLYYWTDRPFLGLGVSASQYLHGERSKNYSHISHYLRAVRKNLPTQETSEILPKKERIKEALALR 335
15618295  235 YELASYAKPDYPAKHNLYYWTDRPFLGLGVSASQYLHGERSKNYSHISHYLRAVRKNLPTQETSEILPKKERIKEALALR 314
15835913  235 YELASYAKPDYPAKHNLYYWTDRPFLGLGVSASQYLHGERSKNYSHISHYLRAVRKNLPTQETSEILPKKERIKEALALR 314
46446730  325 IRLCQGISIADFeqrhgkLSQETLETIEQFILDGFLTQSNQILSLTKKGVLFYDTVASELI 385
76788765  316 LRLCDPIPFGVF------PQELVDEILMHPSIGSLFTKDDKAFSLNKKGRLFHDSIAEEIM 370
237802487 316 LRLCDPIPFGVF------PQELVDEILMHPSIGSLFTKDDKAFSLNKKGRLFHDSIAEEIM 370
237804402 316 LRLCDPIPFGVF------PQELVDEILMHPSIGSLFTKDDKAFSLNKKGRLFHDSIAEEIM 370
62185033  315 LRLTQGARWKDF------PAPLMESLASLPLIKELFGHNNEFLFLNKQGRLFHDTIAEEIM 369
89898396  317 LRLTNGARWKDF------PAPLMQALVSLPQIQELFDQNDEFLFLNKQGRLFHDTIAEEIM 371
29840180  315 LRLTKGAKIKDF------PPSLIQSLTSLPLIKELFDHNDEFLFLNKQGRLFHDTIAEEIM 369
16752659  336 LRLLEGADLAEF------PSTLISMLTQDVKLQNLFSVHGQCLALNRQGRLFHDTIAEEIM 390
15618295  315 LRLLEGADLAEF------PSTLISMLTQDVKLQNLFSVHGQCLALNRQGRLFHDTIAEEIM 369
15835913  315 LRLLEGADLAEF------PSTLISMLTQDVKLQNLFSVHGQCLALNRQGRLFHDTIAEEIM 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap