Conserved Protein Domain Family
PRK05799

?
PRK05799: PRK05799 (this model, PSSM-Id:180263 is obsolete)
oxygen-independent coproporphyrinogen III oxidase
Statistics
?
PSSM-Id: 180263
Aligned: 27 rows
Threshold Bit Score: 586.181
Threshold Setting Gi: 304316640
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18311018    1 MDKISLYIHIPFCAQKCLYCDFPSFARKDHLRKAYIEALNKEIislREKHNNLEINTIFIGGGTPSVLEADELE-CLLKE 79 
110801024   1 MDKISLYIHIPFCAQKCLYCDFPSFARKDHLRKAYIEALNKEIinlREKHNNLEINTIFIGGGTPSVLESNELE-CLLKE 79 
110803276   1 MDKISLYIHIPFCAQKCLYCDFPSFARKDHLRKAYIEALNKEIislREKHNNLEINTIFIGGGTPSVLESDELE-YLLKE 79 
150015713   1 MRDISLYIHIPFCKQKCFYCDFPSYSGKEGLMNEYIEALSNEI---LQKGKEYRISSIFIGGGTPSYLNDLSLE-KLLGT 76 
187933035   6 LKEISLYIHIPFCKQKCLYCDFPSYSGKEKFISEYINSLNKEI---RAKASNYKIKSIFIGGGTPSYLNEIELE-KLLKC 81 
188588627   6 LKEISLYIHIPFCKQKCLYCDFPSYSGKEKFISGYIGALNKEI---KDKASSYKIKSIFIGGGTPSYLDEIELE-KLLKC 81 
167037805   1 MREIGLYIHIPFCKRKCYYCDFNSYAGYDYLFDDYIRALLMEIe--SNSTKDYNVVSVYIGGGTPNLLPPSYIEkILKSV 78 
297544377   1 MKEIGLYIHIPFCKRKCYYCDFNSYAGYDYLFEDYIRALLMEIe--SNSTKDYNVVSVYIGGGTPNLLPPYYIEvILKSV 78 
289578104   1 MKEIGLYIHIPFCKRKCYYCDFNSYAGYDYLFEDYIRALLMEIe--SNSTKDYNVVSVYIGGGTPNLLPPYYIEvILKSV 78 
167040705   1 MREIGLYIHIPFCKRKCYYCDFNSYAGYDYLFDDYIRALLMEIe--SNSTKDYNVVSVYIGGGTPNLLPPSYIEkILKSV 78 
18311018   80 VAKLNMAKDIEYSMECNPGNLTEEKLEVMKKYGVNRISMGLQAKQDNLLKGLGRIHNYKTFKENFLLAKKVGFNNINVDL 159
110801024  80 IAKLNMAKDIEYSMECNPGNLTEEKLEVMKKYGVNRISMGLQAKQDNLLKGLGRIHNYKTFKENFLLAKKVGFNNINVDL 159
110803276  80 VAKLNMAKDIEYSMECNPGNLTEEKLEVMKKYGVNRISMGLQAKQDNLLKGLGRIHNYKTFKENFLLAKKVGFNNINVDL 159
150015713  77 LNKLNLKDDLEFTVECNPGTLNEKNLNIMKEHNVNRISMGLQSTKNSLLKDIGRIHSYEEFEENYFLARKLGFNNINVDL 156
187933035  82 INTLTLEENLEFTMECNPGSLNEDKLKIMKKYNVNRISMGLQSTKLSLLKEIGRIHTLEEFENNYLLARKVGFKNINIDL 161
188588627  82 INTLMLGENLEFTIECNPGSLSEDKLKIMKKYNVNRISMGLQSTKPSLLKEIGRIHTFEEFENNYLLARKVGFKNINIDL 161
167037805  79 FKNYKILDGCEITIEMNPGLITEEKLKIYKDNGINRVSIGLQAFQNRLLKYIGRIHTVEEFFGNYELVKKF-FDNINIDL 157
297544377  79 FKYYKLVDDCEITIEMNPGLITEEKLEIYKVNGINRVSIGLQAFQNRLLKYIGRIHTIEEFLENYELVKKF-FDNINIDL 157
289578104  79 FKYYKLVDDCEITIEMNPGLITEEKLEIYKANGINRVSIGLQAFQNRLLKYIGRIHTIEEFLENYELVKKF-FDNINIDL 157
167040705  79 FKNYKILDGCEITIEMNPGLITEEKLKIYKDNGINRVSIGLQAFQNRLLKYIGRIHTVEEFFGNYELVKKF-FDNINIDL 157
18311018  160 MFGLPNQRLNEWEETLREIISLEPAHISAYSLIIEEGTAFYNLYENDKLKLPTEEEERKMYHLAKKILEENGFNQYEISN 239
110801024 160 MFGLPNQRLNEWEETLREIISLEPAHISAYSLIIEEGTAFYNLYENDKLKLPTEEEERKMYHLAKKILEENGFNQYEISN 239
110803276 160 MFGLPNQKLNEWEETLREIISLEPAHISAYSLIIEEGTAFYNLYENNKLKLPTEEEERKMYHLAKKILEENGFNQYEISN 239
150015713 157 MFGLPNQTIEDWECSLRKAAELELDHISAYSLIIEEGTRFYNLYEEDKLNLPEEDKERIMYLTTKDILNGYGYHQYEISN 236
187933035 162 MFGLPNQSVEDWRKTLEKIIEFNPEHISAYSLIIEEGTCFYNLYNQGKLNLPSEEKERDMYLLTKELLKDNGYSQYEISN 241
188588627 162 MFGLPNQSVEDWRKTLEKIIEFNPEHISAYSLIIEEGTCFYNLYNQDKLNLPSEEKERDMYLLTKKFLKENGYSQYEISN 241
167037805 158 MYALPTQTFKEWQETLKEVVKLQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISN 237
297544377 158 MYALPTQTFKEWQETLKEVVKLQPTHISTYSLILEPNTSFYKLYEKGQLPVVDEEKELSMYHWGIEFLKEKGYHHYEISN 237
289578104 158 MYALPTQTFKEWQETLKEIVKLQPTHISTYSLILEPNTSFYKLYEKGQLPIVDEEKELNMYHWGIEFLKEKGYHHYEISN 237
167040705 158 MYALPTQTFKEWQETLKEVVKLQPTHVSTYSLILEPNTSFYRLYEKGQLPIVDEEEELKMYHWGIEFLKEKGYHHYEISN 237
18311018  240 YAKEGKECRHNLAYWNMDNWIGVGSAAASYINGKRIKNISSVEKYINSINEKREAVEEIINNSKNDNMEEFMFMGLRKIN 319
110801024 240 YAKEGKECRHNLAYWNMDNWIGVGSAAASYINGKRIKNISSVEEYINSINEKGEAVEEIINNSKNDNMEEFMFMGLRKIN 319
110803276 240 YAKKGKECRHNLAYWNMDNWIGVGSASASYMDGKRIKNISSVEEYINSINEKGEAIEEIINNSKNDNMEEFMFMGLRKIN 319
150015713 237 YSKKSKECFHNKVYWKCDEYLGMGVSASSFIDKKRSKNIDNIKEYIKRINNKESVIEEIHLNDIKDDMEEFLFMGLRMIE 316
187933035 242 FSKEEKECYHNIVYWQLNEYLGVGVSASSYINGKRIKNIDDIEFYIKNINSNQSVENEIYENNINDNMEEFVFMGLRMIN 321
188588627 242 FSKDKKECYHNIVYWKLNEYLGLGVSSSSYIEGKRIKNIDDIELYIKNINSNESVENEIYENNINDDMEEFMFMGLRMIR 321
167037805 238 FALPTFECRHNILYWECKNYLGFGAGAHSYMADVRYSNIENIKDYIKSILERKSAVKEKIKLTKQDRMAEFMFLGMRMTK 317
297544377 238 FALPTFECRHNILYWQCKNYLGFGAGAHSYMEDVRYSNIEGTKDYIKGILERKSAVKEKIKLTKQDRMAEFMFLGLRMTK 317
289578104 238 FALPTFECRHNILYWQCKNYLGFGAGAHSYMEDVRYSNIESTKDYIKGILERKSAVKEKIKLTKQDKMAEFMFLGLRMTK 317
167040705 238 FALPTFECRHNILYWECKNYLGFGAGAHSYMADVRYSNIENIKDYIKSILERKSAVKEKIKLTKQDRMAEFMFLGMRMTK 317
18311018  320 GIDENEFKNRFSMNINDVYGEILNKYIDEGLLIRESGRIFLSEKGIEISNIIMADFLL 377
110801024 320 GIDENEFKKRFSMNINDVYGEILNKYIDEGLLIRDSGRIFLSEKGIEISNIIMADFLL 377
110803276 320 GIDENEFKNRFSMNINDVYGEIINKYIDAGLLIRESGRIFLSEKGIEISNIIMADFLL 377
150015713 317 GIKVEKFKERFNKDIYEVYGEIIEKNIKKGLLINNSGNLYLTSHGIEISNYVMSDFIL 374
187933035 322 GIEERDFKERFKKDINEVYGEVIDKNIKQELLVHNEGRIYLTSRGIEVSNSVMSDFII 379
188588627 322 GIEERDFKERFKKDIDEVYGDVIYKNIKQELLIRNGGRIYLTSRGIEVSNSVMSDFII 379
167037805 318 GVCDKDFKKRFGISLFEIYKKVIQKYLKEGLIEIDNECVKLTERGIDVSNVIFEEFLP 375
297544377 318 GVCDKDFKKIFDVSLFEIYKKVIQKYLKEGLIKVDNECVKLTERGIDVSNVIFEEFLP 375
289578104 318 GVCDKDFKKIFDVSLFEIYKKVIQKYLKEGLIKVDNECVKLTERGIDVSNVIFEEFLP 375
167040705 318 GVCDKDFKKRFGISLFEIYKKVIQKYLKEGLIEIDNECVKLTERGIDVSNVIFEEFLP 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap