NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS71431.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
71431.1 Public Mus musculus 4 Insl5 23 108 98 CCDS HistoryNCBI Gene:23919Re-query CCDS DB by CCDS ID:71431.1Re-query CCDS DB by GeneID:23919See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 71431.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000106869.2 ENSMUSP00000102482.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106869.2Link to Ensembl Protein Viewer:ENSMUSP00000102482.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000106869Re-query CCDS DB by Protein ID:ENSMUSP00000102482
Original member Current member NCBI NM_001290648.2 NP_001277577.1 Accepted alive Link to Nucleotide Sequence:NM_001290648.2Link to Protein Sequence:NP_001277577.1Re-query CCDS DB by Nucleotide ID:NM_001290648Re-query CCDS DB by Protein ID:NP_001277577Link to BLAST:NP_001277577.1

Chromosomal Locations for CCDS 71431.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 103018114 103018346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 103026518 103026693 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 103026814 103026842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (438 nt):
ATGTGCTTAGTAAACACTGTTAAGATAAGGATGAAGGGCCCCACTCTTGCTCTGTTTCTCCTCTTAGTTC
TG
TTGGCTGTGGTGGAAGTAAGAAGCAGGCAGACTGTGAAGCTCTGTGGCCTGGACTACGTGAGAACAGT
T
ATCTACATCTGTGCCAGCTCACGGTGGAGGAGACATCTGGAGGGGCATTTCCACTCTCAACAAGCTGAG
ACA
AGAAACTACCTCCAGCTCCTAGACAGGCACGAGCCATCCAAGAAAACTCTGGAGCACAGCCTTCCCA
AG
ACGGATCTCTCAGGACAGGAGCTTGTTCGAGATCCACAGGCACCCAAGGAAGGTCTTTGGGAACTGAA
G
AAGCACTCAGTGGTATCCAGACGAGATCTGCAAGCTCTGTGCTGCAGGGAAGGCTGCTCCATGAAGGAA
CTC
AGCACCCTCTGTTAG


Translation (145 aa):
MCLVNTVKIRMKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSRWRRHLEGHFHSQQAE
T
RNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKE
L
STLC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser