NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58225.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58225.1 Public Homo sapiens 12 CNTN1 22 109 92 CCDS HistoryNCBI Gene:1272Re-query CCDS DB by CCDS ID:58225.1Re-query CCDS DB by GeneID:1272See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58225.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000547702.5 ENSP00000448004.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000547702.5Link to Ensembl Protein Viewer:ENSP00000448004.1Re-query CCDS DB by Nucleotide ID:ENST00000547702Re-query CCDS DB by Protein ID:ENSP00000448004
Original member Current member EBI ENST00000547849.5 ENSP00000448653.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000547849.5Link to Ensembl Protein Viewer:ENSP00000448653.1Re-query CCDS DB by Nucleotide ID:ENST00000547849Re-query CCDS DB by Protein ID:ENSP00000448653
Original member NCBI NM_001256063.1 NP_001242992.1 Updated not alive Link to Nucleotide Sequence:NM_001256063.1Link to Protein Sequence:NP_001242992.1Re-query CCDS DB by Nucleotide ID:NM_001256063Re-query CCDS DB by Protein ID:NP_001242992
Current member NCBI NM_001256063.2 NP_001242992.1 Accepted alive Link to Nucleotide Sequence:NM_001256063.2Link to Protein Sequence:NP_001242992.1Re-query CCDS DB by Nucleotide ID:NM_001256063Re-query CCDS DB by Protein ID:NP_001242992Link to BLAST:NP_001242992.1
Original member NCBI NM_001256064.1 NP_001242993.1 Updated not alive Link to Nucleotide Sequence:NM_001256064.1Link to Protein Sequence:NP_001242993.1Re-query CCDS DB by Nucleotide ID:NM_001256064Re-query CCDS DB by Protein ID:NP_001242993
Current member NCBI NM_001256064.2 NP_001242993.1 Accepted alive Link to Nucleotide Sequence:NM_001256064.2Link to Protein Sequence:NP_001242993.1Re-query CCDS DB by Nucleotide ID:NM_001256064Re-query CCDS DB by Protein ID:NP_001242993Link to BLAST:NP_001242993.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001242992.1 627 Q12860-3 627 100% 0 0
NP_001242993.1 627 Q12860-3 627 100% 0 0

Chromosomal Locations for CCDS 58225.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 40908433 40908493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40910073 40910105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40918639 40918771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40922256 40922428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40924557 40924652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40929796 40930002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40933461 40933560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40933697 40933878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40936781 40936905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40937570 40937687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40939335 40939485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40943597 40943724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40943995 40944170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40959114 40959234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 40971434 40971513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1884 nt):
ATGAAAATGTGGTTGCTGGTCAGTCATCTTGTGATAATATCTATTACTACCTGTTTAGCAGAGTTTACAT
GG
TATAGAAGATATGGTCATGGAGTTTCTGAGGAAGACAAAGGATTTGGACCAATTTTTGAAGAGCAGCC
A
ATCAATACCATTTATCCAGAGGAATCACTGGAAGGAAAAGTCTCACTCAACTGTAGGGCACGAGCCAGC
CCT
TTCCCGGTTTACAAATGGAGAATGAATAATGGGGACGTTGATCTCACAAGTGATCGATACAGTATGG
TA
GGAGGAAACCTTGTTATCAACAACCCTGACAAACAGAAAGATGCTGGAATATACTACTGTTTAGCATC
T
AATAACTACGGGATGGTCAGAAGCACTGAAGCAACCCTGAGCTTTGGATATCTTGATCCTTTCCCACCT
GAG
GAACGTCCTGAGGTCAGAGTAAAAGAAGGGAAAGGAATGGTGCTTCTCTGTGACCCCCCATACCATT
TT
CCAGATGATCTTAGCTATCGCTGGCTTCTAAATGAATTTCCTGTATTTATCACAATGGATAAACGGCG
A
TTTGTGTCTCAGACAAATGGCAATCTCTACATTGCAAATGTTGAGGCTTCCGACAAAGGCAATTATTCC
TGC
TTTGTTTCCAGTCCTTCTATTACAAAGAGCGTGTTCAGCAAATTCATCCCACTCATTCCAATACCTG
AA
CGAACAACAAAACCATATCCTGCTGATATTGTAGTTCAGTTCAAGGATGTATATGCATTGATGGGCCA
A
AATGTGACCTTAGAATGTTTTGCACTTGGAAATCCTGTTCCGGATATCCGATGGCGGAAGGTTCTAGAA
CCA
ATGCCAAGCACTGCTGAGATTAGCACCTCTGGGGCTGTTCTTAAGATCTTCAATATTCAGCTAGAAG
AT
GAAGGCATCTATGAATGTGAGGCTGAGAACATTAGAGGAAAGGATAAACATCAAGCAAGAATTTATGT
T
CAAGCATTCCCTGAGTGGGTAGAACACATCAATGACACAGAGGTGGACATAGGCAGTGATCTCTACTGG
CCT
TGTGTGGCCACAGGAAAGCCCATCCCTACAATCCGATGGTTGAAAAATGGATATGCGTATCATAAAG
GG
GAATTAAGACTGTATGATGTGACTTTTGAAAATGCCGGAATGTATCAGTGCATAGCTGAAAACACATA
T
GGAGCCATTTATGCAAATGCTGAGTTGAAGATCTTGGCGTTGGCTCCAACTTTTGAAATGAATCCTATG
AAG
AAAAAGATCCTGGCTGCTAAAGGTGGAAGGGTGATAATTGAATGCAAACCTAAAGCTGCACCGAAAC
CA
AAGTTTTCATGGAGTAAAGGGACAGAGTGGCTTGTCAATAGCAGCAGAATACTCATTTGGGAAGATGG
T
AGCTTGGAAATCAACAACATTACAAGGAATGATGGAGGTATCTATACATGCTTTGCAGAAAATAACAGA
GGG
AAAGCTAATAGCACTGGAACCCTTGTTATCACAGATCCTACGCGAATTATATTGGCCCCAATTAATG
CC
GATATCACAGTTGGAGAAAACGCCACCATGCAGTGTGCTGCGTCCTTTGATCCTGCCTTGGATCTCAC
A
TTTGTTTGGTCCTTCAATGGCTATGTGATCGATTTTAACAAAGAGAATATTCACTACCAGAGGAATTTT
ATG
CTGGATTCCAATGGGGAATTACTAATCCGAAATGCGCAGCTGAAACATGCTGGAAGATACACATGCA
CT
GCCCAGACAATTGTGGACAATTCTTCAGCTTCAGCTGACCTTGTAGTGAGAGGTAAAAACAGAAAAGG
T
GGAGAGAAAAACATGGTGGATTCCTTTCTCCCCGTCTGTGCAAGCCTGCCTCCAACCTGGTGA


Translation (627 aa):
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARAS
P
FPVY
KWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPP
E
ERPEVRVKEGKGMVLLCDPPYHFP
DDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYS
C
FVSSPSITKSVFSKFIPLIPIPE
RTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLE
P
MPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQ
AFPEWVEHINDTEVDIGSDLYW
P
CVATGKPIPTIRWLKNGYA
YHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
K
KKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSS
RILIWEDGSLEINNITRNDGGIYTCFAENNR
G
KANSTGTLVIT
DPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNF
M
LDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGKNRKGGEKNMVDSFLPVCASLPPTW



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser