NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7313.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7313.1 Public Homo sapiens 10 SPOCK2 22 109 92 CCDS HistoryNCBI Gene:9806Re-query CCDS DB by CCDS ID:7313.1Re-query CCDS DB by GeneID:9806See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7313.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000317376.8 ENSP00000321108.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000317376.8Link to Ensembl Protein Viewer:ENSP00000321108.4Re-query CCDS DB by Nucleotide ID:ENST00000317376Re-query CCDS DB by Protein ID:ENSP00000321108
Original member Current member EBI,WTSI ENST00000373109.6 ENSP00000362201.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373109.6Link to Ensembl Protein Viewer:ENSP00000362201.2Re-query CCDS DB by Nucleotide ID:ENST00000373109Re-query CCDS DB by Protein ID:ENSP00000362201
Original member NCBI NM_001244950.1 NP_001231879.1 Updated not alive Link to Nucleotide Sequence:NM_001244950.1Link to Protein Sequence:NP_001231879.1Re-query CCDS DB by Nucleotide ID:NM_001244950Re-query CCDS DB by Protein ID:NP_001231879
Current member NCBI NM_001244950.2 NP_001231879.1 Accepted alive Link to Nucleotide Sequence:NM_001244950.2Link to Protein Sequence:NP_001231879.1Re-query CCDS DB by Nucleotide ID:NM_001244950Re-query CCDS DB by Protein ID:NP_001231879Link to BLAST:NP_001231879.1
Original member Current member NCBI NM_014767.2 NP_055582.1 Accepted alive Link to Nucleotide Sequence:NM_014767.2Link to Protein Sequence:NP_055582.1Re-query CCDS DB by Nucleotide ID:NM_014767Re-query CCDS DB by Protein ID:NP_055582Link to BLAST:NP_055582.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001231879.1 424 Q92563-1 424 100% 0 0
NP_055582.1 424 Q92563-1 424 100% 0 0

Chromosomal Locations for CCDS 7313.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 72062760 72062905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72063025 72063162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72064178 72064240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72066902 72067120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72067613 72067732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72068187 72068301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72070312 72070426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72072144 72072258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72072503 72072548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72072902 72072910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 72088140 72088328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1275 nt):
ATGCGCGCCCCGGGCTGCGGGCGGCTGGTGCTGCCGCTGCTGCTCCTGGCCGCGGCAGCCCTGGCCGAAG
GC
GACGCCAAGGGGCTCAAGGAGGGCGAGACCCCCGGCAATTTCATGGAGGACGAGCAATGGCTGTCGTC
C
ATCTCGCAGTACAGCGGCAAGATCAAGCACTGGAACCGCTTCCGAGACGAAGTGGAGGATGACTATATC
AAG
AGCTGGGAGGACAATCAGCAAGGAGATGAAGCCCTGGATACCACCAAGGACCCCTGCCAGAAGGTGA
AG
TGCAGCCGCCACAAGGTGTGCATTGCCCAGGGCTACCAGCGGGCCATGTGCATCAGTCGCAAGAAGCT
G
GAGCACAGGATCAAGCAGCCGACCGTGAAACTCCATGGAAACAAAGACTCCATCTGCAAGCCCTGCCAC
ATG
GCCCAGCTTGCCTCTGTCTGCGGCTCAGATGGCCACACTTACAGCTCTGTGTGTAAGCTGGAGCAAC
AG
GCGTGCCTGAGCAGCAAGCAGCTGGCGGTGCGATGCGAGGGCCCCTGCCCCTGCCCCACGGAGCAGGC
T
GCCACCTCCACCGCCGATGGCAAACCAGAGACTTGCACCGGTCAGGACCTGGCTGACCTGGGAGATCGG
CTG
CGGGACTGGTTCCAGCTCCTTCATGAGAACTCCAAGCAGAATGGCTCAGCCAGCAGTGTAGCCGGCC
CG
GCCAGCGGGCTGGACAAGAGCCTGGGGGCCAGCTGCAAGGACTCCATTGGCTGGATGTTCTCCAAGCT
G
GACACCAGTGCTGACCTCTTCCTGGACCAGACGGAGCTGGCCGCCATCAACCTGGACAAGTACGAGGTC
TGC
ATCCGTCCCTTCTTCAACTCCTGTGACACCTACAAGGATGGCCGGGTCTCTACTGCTGAGTGGTGCT
TC
TGCTTCTGGAGGGAGAAGCCCCCCTGCCTGGCAGAGCTGGAGCGCATCCAGATCCAGGAGGCCGCCAA
G
AAGAAGCCAGGCATCTTCATCCCGAGCTGCGACGAGGATGGCTACTACCGGAAGATGCAGTGTGACCAG
AGC
AGCGGTGACTGCTGGTGTGTGGACCAGCTGGGCCTGGAGCTGACTGGCACGCGCACGCATGGGAGCC
CC
GACTGCGATGACATCGTGGGCTTCTCGGGGGACTTTGGAAGCGGTGTCGGCTGGGAGGATGAGGAGGA
G
AAGGAGACGGAGGAAGCAGGCGAGGAGGCCGAGGAGGAGGAGGGCGAGGCAGGCGAGGCTGACGACGGG
GGC
TACATCTGGTAG


Translation (424 aa):
MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYI
K
SWEDNQQGDE
ALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCH
M
AQLASVCGSDGHTYSSV
CKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDR
L
RDWFQLLHENSKQNGSASSVAGPAS
GLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEV
C
IRPFFNSCDTYKDGRVSTAEWCFCFWRE
KPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQ
S
SGDCWCVDQLGLELTGTRTHGSPDC
DDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG
G
YIW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser