NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25350.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25350.1 Public Mus musculus 11 Mien1 23 108 98 CCDS HistoryNCBI Gene:103742Re-query CCDS DB by CCDS ID:25350.1Re-query CCDS DB by GeneID:103742See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25350.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000002655.7 ENSMUSP00000002655.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002655.7Link to Ensembl Protein Viewer:ENSMUSP00000002655.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000002655Re-query CCDS DB by Protein ID:ENSMUSP00000002655
Original member Current member NCBI NM_025559.2 NP_079835.1 Accepted alive Link to Nucleotide Sequence:NM_025559.2Link to Protein Sequence:NP_079835.1Re-query CCDS DB by Nucleotide ID:NM_025559Re-query CCDS DB by Protein ID:NP_079835Link to BLAST:NP_079835.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079835.1 115 Q9CQ86 115 100% 0 0

Chromosomal Locations for CCDS 25350.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 98438062 98438145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 98438237 98438313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 98438647 98438744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 98438858 98438946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (348 nt):
ATGAGTGGGGAGCCAGCGCCGGTGTCCGTAGTGCCCCCTCCCGGGGAGGTGGAAGCAGGCAGTGGAGTCC
AC
ATCGTGGTGGAGTACTGTAAACCCTGCGGCTTTGAGGCGACCTACCTGGAGCTGGCGAGCGCTGTGAA
G
GAGGAGTATCCGGGCATTGAGATTGAGTCGCGACTCGGGGGGACAGGGGCCTTCGAGATTGAGATCAAT
GGA
CAGCTGGTGTTCTCCAAGCTGGAGAATGGAGGGTTTCCTTATGAGAAAGACCTCATGGAAGCCATCC
GA
AGAGCCAGCAATGGAGAACCTGTAGAAAAGATCACCAACAGCCGGCCTCCCTGTGTCATCCTGTGA


Translation (115 aa):
MSGEPAPVSVVPPPGEVEAGSGVHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEIN
G
QLVFSKLENGGFPYEKD
LMEAIRRASNGEPVEKITNSRPPCVIL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser