NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48987.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48987.1 Public Mus musculus 11 Prcd 23 108 98 CCDS HistoryNCBI Gene:100038570Re-query CCDS DB by CCDS ID:48987.1Re-query CCDS DB by GeneID:100038570See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 48987.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000116318.2 ENSMUSP00000112020.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000116318.2Link to Ensembl Protein Viewer:ENSMUSP00000112020.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000116318Re-query CCDS DB by Protein ID:ENSMUSP00000112020
Original member Current member EBI ENSMUST00000148484.8 ENSMUSP00000119671.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000148484.8Link to Ensembl Protein Viewer:ENSMUSP00000119671.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000148484Re-query CCDS DB by Protein ID:ENSMUSP00000119671
Original member Current member NCBI NM_001163318.1 NP_001156790.1 Accepted alive Link to Nucleotide Sequence:NM_001163318.1Link to Protein Sequence:NP_001156790.1Re-query CCDS DB by Nucleotide ID:NM_001163318Re-query CCDS DB by Protein ID:NP_001156790Link to BLAST:NP_001156790.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001156790.1 53 Q00LT2 53 100% 0 0

Chromosomal Locations for CCDS 48987.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 116657237 116657307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 116657538 116657606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 116659298 116659319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (162 nt):
ATGTGCACCACCCTCTTCCTGTTCAGCTTGGCCATGCTGTGGCGCCGTAGATTTACCAACCGAGTGGAAC
C
A
GAGCCCAGCAGAGTGGACGGGACAGTCGTGGGCAGCGGCTCAGACACAGACCTTCAATCTACCGGCAG
G
GAGAAAGGACCTGTGAAGTAG


Translation (53 aa):
MCTTLFLFSLAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser