NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50042.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50042.1 Under review, update Mus musculus 17 Axin1 23 108 98 CCDS HistoryNCBI Gene:12005Re-query CCDS DB by CCDS ID:50042.1Re-query CCDS DB by GeneID:12005See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 50042.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000118904.8 ENSMUSP00000113756.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118904.8Link to Ensembl Protein Viewer:ENSMUSP00000113756.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000118904Re-query CCDS DB by Protein ID:ENSMUSP00000113756
Original member Current member EBI ENSMUST00000163421.7 ENSMUSP00000132000.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000163421.7Link to Ensembl Protein Viewer:ENSMUSP00000132000.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000163421Re-query CCDS DB by Protein ID:ENSMUSP00000132000
Original member NCBI NM_001159598.1 NP_001153070.1 Updated not alive Link to Nucleotide Sequence:NM_001159598.1Link to Protein Sequence:NP_001153070.1Re-query CCDS DB by Nucleotide ID:NM_001159598Re-query CCDS DB by Protein ID:NP_001153070
Current member NCBI NM_001159598.2 NP_001153070.2 Pending alive Link to Nucleotide Sequence:NM_001159598.2Link to Protein Sequence:NP_001153070.2Re-query CCDS DB by Nucleotide ID:NM_001159598Re-query CCDS DB by Protein ID:NP_001153070Link to BLAST:NP_001153070.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153070.2 827 O35625-2 827 100% 0 0

Chromosomal Locations for CCDS 50042.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 26142684 26143576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26173640 26173780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26182490 26182586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26184177 26184314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26187704 26188221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26188574 26188744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26189986 26190231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26193939 26194106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26194935 26195061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2499 nt):
ATGCAGAGTCCCAAAATGAATGTCCAGGAGCAGGGTTTCCCCTTGGACCTCGGAGCAAGTTTCACCGAAG
AT
GCCCCCCGGCCCCCAGTGCCTGGAGAAGAGGGAGAACTGGTATCTACTGATTCGAGGCCTGTCAACCA
C
AGTTTCTGTTCTGGGAAAGGTACCAGCATTAAAAGTGAGACCTCAACAGCCACCCCAAGACGTTCAGAT
CTG
GATCTGGGATATGAGCCCGAGGGCAGTGCCTCCCCCACCCCACCATATTTGAGGTGGGCTGAGTCAC
TG
CATTCCTTACTGGATGACCAAGATGGGATCAGCCTGTTCAGGACTTTCCTGAAGCAGGAGGGCTGTGC
T
GACCTGCTGGACTTCTGGTTTGCCTGCAGTGGCTTCAGGAAGCTTGAGCCCTGTGACTCAAATGAGGAA
AAG
AGGCTGAAGCTGGCAAGAGCCATCTACCGAAAGTACATCCTGGATAGCAATGGCATTGTGTCCAGAC
AA
ACCAAGCCAGCCACTAAGAGCTTCATAAAGGACTGTGTCATGAAGCAGCAGATAGATCCTGCCATGTT
T
GACCAGGCACAGACAGAAATCCAGTCCACCATGGAGGAGAATACCTACCCTTCCTTTCTTAAGTCTGAC
ATT
TATTTGGAGTACACAAGGACAGGCTCAGAGAGTCCGAAGGTCTGCAGTGACCAGAGCTCAGGGTCTG
GA
ACAGGGAAGGGCATGTCTGGATACCTGCCCACTTTGAATGAGGATGAAGAATGGAAATGTGACCAAGA
T
GCAGATGAGGATGATGGCCGAGACCCTCTCCCCCCCAGCAGGCTCACCCAGAAGCTGCTATTGGAGACT
GCT
GCCCCGAGGGCCCCCTCAAGTAGACGGTACAACGAAGGCAGAGAGCTCAGGTATGGATCTTGGAGGG
AG
CCCGTCAACCCCTACTACGTCAACTCTGGCTATGCCCTGGCCCCAGCCACCAGTGCCAATGACAGTGA
G
CAGCAGAGCCTGTCCAGTGATGCTGACACGCTATCCCTTACGGACAGTAGTGTGGATGGAATCCCCCCA
TAC
AGGATCCGTAAGCAGCACCGAAGGGAGATGCAGGAGAGTATCCAAGTCAATGGGCGGGTACCTCTAC
CT
CACATTCCTCGCACTTACCGAATGCCAAAGGAGATCCGGGTAGAGCCACAGAAATTTGCTGAAGAGCT
T
ATTCACCGTCTAGAGGCTGTCCAGCGCACTCGAGAGGCTGAAGAAAAGTTGGAGGAACGGCTGAAGCGT
GTA
CGCATGGAGGAAGAAGGGGAGGATGGTGAAATGCCTTCTGGCCCCATGGCAAGTCACAAGCTGCCTT
CT
GTCCCAGCTTGGCACCATTTCCCACCCCGCTATGTGGATATGGGCTGCTCTGGACTGCGGGATGCCCA
T
GAGGAGAATCCTGAGAGCATCCTGGATGAGCACGTGCAAAGGGTCATGAGGACACCTGGCTGCCAGTCA
CCT
GGCCCAGGCCACCGCTCTCCTGACAGTGGGCATGTGGCTAAGACTGCAGTGCTAGGGGGTACAGCCT
CC
GGGCATGGGAAGCATGTTCCTAAGTTAGGGTTGAAGCTGGATACAGCTGGCCTGCACCATCATAGACA
T
GTCCACCACCATGTTCACCATAATTCAGCTAGACCTAAGGAGCAAATGGAGGCTGAAGTTGCCCGCAGG
GTC
CAGAGCAGCTTCTCGTGGGGCCCAGAAACACATGGTCATGCCAAGCCCCGGAGCTATTCCGAGAACG
CA
GGCACCACCCTCAGTGCTGGGGATTTGGCCTTTGGTGGTAAAACTAGTGCACCTTCCAAAAGAAACAC
C
AAGAAGGCTGAATCTGGGAAGAATGCCAATGCTGAGGTACCCAGTACCACAGAGGACGCTGAGAAGAAC
CAG
AAGATCATGCAGTGGATCATTGAGGGAGAGAAGGAGATCAGTAGACACCGGAAGGCAGGCCATGGGT
CT
TCTGGGTTGAGGAAGCAGCAGGCCCATGAAAGCTCCAGGCCCTTGTCCATCGAGCGTCCTGGGGCCGT
G
CACCCCTGGGTCAGCGCTCAGCTTCGGAATTCTGTCCAGCCTTCTCATCTTTTCATCCAAGATCCCACA
ATG
CCACCCAATCCAGCCCCTAATCCCCTGACCCAGCTGGAAGAGGCCCGCAGGCGTTTGGAAGAAGAAG
AA
AAGAGAGCAAACAAACTGCCCTCCAAGCAGAGGACAAAATCACAAAGAAAGGCAGGTGGCGGGAGTGC
A
CCACCATGTGACAGCATTGTTGTGGCCTACTATTTCTGTGGGGAACCCATCCCCTACCGGACCCTGGTG
AGG
GGCCGTGCTGTCACCCTGGGCCAGTTCAAGGAGCTGCTAACCAAGAAGGGGAGCTACAGATACTACT
TT
AAGAAAGTGAGTGATGAGTTTGACTGTGGTGTGGTATTTGAGGAAGTACGGGAGGATGAGGCCGTCTT
G
CCTGTCTTTGAAGAAAAGATCATCGGCAAGGTGGAAAAGGTGGACTGA


Translation (832 aa):
MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSD
L
DLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEE
K
RLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSD
I
YLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLET
A
APRAPSSRRYNEGREL
RYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPP
Y
RIRKQHRREMQESIQVNGRVPLPHIP
RTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKR
V
RM
EEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQS
P
GPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARR
V
QSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAF
GGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKN
Q
KIMQWIIEGEKEISRHRKAGH
GSSGLRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPT
M
PPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQ
RTKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLV
R
GRAVTLGQFKELLTKKGSY
RYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser