NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24252.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24252.1 Public Mus musculus 10 Rdh16 23 108 98 CCDS HistoryNCBI Gene:19683Re-query CCDS DB by CCDS ID:24252.1Re-query CCDS DB by GeneID:19683See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24252.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000071646.1 ENSMUSP00000071573.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071646.1Link to Ensembl Protein Viewer:ENSMUSP00000071573.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000071646Re-query CCDS DB by Protein ID:ENSMUSP00000071573
Original member Current member NCBI NM_009040.3 NP_033066.1 Accepted alive Link to Nucleotide Sequence:NM_009040.3Link to Protein Sequence:NP_033066.1Re-query CCDS DB by Nucleotide ID:NM_009040Re-query CCDS DB by Protein ID:NP_033066Link to BLAST:NP_033066.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033066.1 317 O54909 317 100% 0 0

Chromosomal Locations for CCDS 24252.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 127801198 127801510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 127811054 127811312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 127812786 127812949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 127813413 127813630 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGTGGCTCTACCTGGTGGCACTGGTGGGCCTGTGGACGCTTCTGCGCTTCTTCAGGGTGAGGCAGGTGG
TG
AGCCATCTCCAAGACAAATATGTCTTCATCACGGGCTGTGACTCTGGCTTTGGGACCCTGCTGGCCAG
A
CAGCTGGACAGGAGAGGCATGAGGGTGCTGGCTGCATGTCTGACGGAGAAGGGAGCCGAGGAGCTGAGG
AAC
AAGACATCTGACAGGCTGGAGACAGTGATCCTGGATGTCACCAAGACAGAGAGTATTGTGACAGCCA
CT
CAGTGGGTGAAGGAGCATGTTGGGAACAGAGGACTCTGGGGCCTGGTCAACAACGCTGGCATCTCCAC
C
CCCTCGGGTCCCAACGAGTGGATGAAAAAGCAGGACTTTGCACATGTACTGGATGTGAACCTGTTGGGC
ATG
ATCGAGGTGACTCTGAGCATGCTGCCTTTAGTGAGGAAGGCGAGGGGTCGTGTGGTCAACGTCTCCA
GT
GTCATGGGTCGAGTGTCTCTCTTTGGTGGTGGTTACTGCATCTCTAAGTATGGTGTAGAGGCCTTCTC
A
GACTCCCTCAGGAGGGAGCTCTCCTACTTTGGGGTGAAGGTGGCTATTATAGAGCCTGGCTTCTTCCTG
ACC
GGTGTGACCAGTAGTGCCAGATTATGCTCAAATACCCAGATGCTGTGGGACCAGACCAGCTCAGAAA
TC
AGGGAGATCTATGGCGAGAAGTACCTGGCATCCTATCTGAAAAGGCTAAACAAATTGGACAAGAGGTG
C
AACAAGGACCTGTCTGGGGTGACTGACTGCATGGAGCATGCTCTGACTGCCTGTCACCCTCGTACCCGA
TAC
TCAGCTGGCTGGGATGCTAAGCTCTTCTACCTCCCCTTGAGCTACCTGCCCACCTTTCTTGTGGATG
CC
CTTCTCTACTGGACTTCCCTGAAGCCTGAAAAAGCCCTCTGA


Translation (317 aa):
MWLYLVALVGLWTLLRFFRVRQVVSHLQDKYVFITGCDSGFGTLLARQLDRRGMRVLAACLTEKGAEELR
N
KTSDRLETVILDVTKTESIVTATQWVKEHVGNR
GLWGLVNNAGISTPSGPNEWMKKQDFAHVLDVNLLG
M
IEVTLSMLPLVRKARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSL
RRELSYFGVKVAIIEPGFFL
T
GVTSSARLCSNTQMLWDQTSSEIREIYGEKYLAS
YLKRLNKLDKRCNKDLSGVTDCMEHALTACHPRTR
Y
SAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEKAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser