NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40549.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40549.1 Public Mus musculus 9 Zglp1 23 108 98 CCDS HistoryNCBI Gene:100009600Re-query CCDS DB by CCDS ID:40549.1Re-query CCDS DB by GeneID:100009600See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40549.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000115494.2 ENSMUSP00000111157.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115494.2Link to Ensembl Protein Viewer:ENSMUSP00000111157.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115494Re-query CCDS DB by Protein ID:ENSMUSP00000111157
Original member Current member NCBI NM_001103168.1 NP_001096638.1 Accepted alive Link to Nucleotide Sequence:NM_001103168.1Link to Protein Sequence:NP_001096638.1Re-query CCDS DB by Nucleotide ID:NM_001103168Re-query CCDS DB by Protein ID:NP_001096638Link to BLAST:NP_001096638.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001096638.1 266 Q1WG82 266 100% 0 0

Chromosomal Locations for CCDS 40549.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 21062588 21062717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21062894 21062987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21063314 21063396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21066024 21066377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21066940 21067079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (801 nt):
ATGGAGGCGGCACAGGCTGGAGACTTGACGCGCCGGCAGGAACTTCTGGCGCCACCTTGTCTGGACACCG
AG
TCGCTCCGGAAGAGTCGACCCCCCGCGCTGGAGCCTGGAGCCCTGAGATGCCTCACTCCCAATATCAG
G
TCTCTGTGGCCTACATGCCAGGACTCGGTCAGCACTGCATTGCCTTTCCTCCAAGAGAAAGAAAAGGGA
CTG
CCGGGTTCCCCTTCGCCGGCCACCCAGGTCCTGGGGTCGTGCTGGGAGCTGATGGTCATAGGAATGT
CA
GACCACCTGAGTATGGCCAGGAATCCCAGGGGCACACAGTGCCCTAACCTGGAAATTTCCAGTGCTAC
T
TCTCCTGCCTCACTCCAGAGAAGACCACGGAAGCAGCTAAACCCGCGAATGGGTATTGAGAAGGTGGAC
CCC
AGGTTCAAGGGGGTAACTCTGGAGTTCCAGATCCAGCCGGATTCTAGCCTCCAGATTGTACCCACCT
AC
AGCTTGCCTGGAAGAAGTTGTTCACAAAAGCTTCCTGCAAGCCCTTCCAAGGCTCTGGCCAGCCCAGG
A
AGCAGTGAGGCCCTTGGGCCCAGGCGGTGTGCTTCTTGTAGAACCCAGAGGACTCCACTATGGAGAGAC
GCT
GAAGATGGGACACCCCTCTGCAATGCCTGTGGCATCAGGTACAAGAAATATGGCACCCGTTGTTCCA
GT
TGCTGGCTGGTCCCAAGGAAAAGCATCCAGCCCAAAAGGCTCTGTGGCAGGTGTGGGATGTCCCAGGA
C
CCCCACCTCAGCCCAACCCAGGAACTGTAA


Translation (266 aa):
MEAAQAGDLTRRQELLAPPCLDTESLRKSRPPALEPGALRCLTPNIRSLWPTCQDSVSTALPFLQEKEKG
L
PGSPSPATQVLGSCWELMVIGMSDHLSMARNPRGTQCPNLEISSATSPASLQRRPRKQLNPRMGIEKVD
P
RFKGVTLEFQIQPDSSLQIVPTY
SLPGRSCSQKLPASPSKALASPGSSEALGPRRCASCRTQRTPLWRD
A
EDGTPLCNACGI
RYKKYGTRCSSCWLVPRKSIQPKRLCGRCGMSQDPHLSPTQEL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser