NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4529.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4529.1 Public Homo sapiens 6 RANBP9 22 109 92 CCDS HistoryNCBI Gene:10048Re-query CCDS DB by CCDS ID:4529.1Re-query CCDS DB by GeneID:10048See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4529.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000011619.5 ENSP00000011619.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000011619.5Link to Ensembl Protein Viewer:ENSP00000011619.3Re-query CCDS DB by Nucleotide ID:ENST00000011619Re-query CCDS DB by Protein ID:ENSP00000011619
Original member NCBI NM_005493.2 NP_005484.2 Updated not alive Link to Nucleotide Sequence:NM_005493.2Link to Protein Sequence:NP_005484.2Re-query CCDS DB by Nucleotide ID:NM_005493Re-query CCDS DB by Protein ID:NP_005484
Current member NCBI NM_005493.3 NP_005484.2 Accepted alive Link to Nucleotide Sequence:NM_005493.3Link to Protein Sequence:NP_005484.2Re-query CCDS DB by Nucleotide ID:NM_005493Re-query CCDS DB by Protein ID:NP_005484Link to BLAST:NP_005484.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005484.2 729 Q96S59-1 729 100% 0 0

Chromosomal Locations for CCDS 4529.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 13622362 13622492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13625653 13625764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13632370 13632521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13634431 13634552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13637808 13637955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13639563 13639753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13641199 13641307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13642479 13642591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13644545 13644729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13652659 13652681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13657109 13657276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13658780 13658832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13696785 13696896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 13710935 13711505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2190 nt):
ATGTCCGGGCAGCCGCCGCCGCCGCCGCCGCAGCAGCAGCAACAGCAGCAGCAGCTGTCGCCGCCACCGC
CG
GCGGCCTTGGCCCCAGTCTCCGGAGTCGTCCTGCCGGCGCCCCCGGCCGTCAGCGCCGGCTCTTCTCC
G
GCCGGCTCGCCCGGCGGCGGTGCGGGCGGCGAAGGCTTAGGGGCCGCGGCGGCCGCCCTGCTCCTCCAC
CCT
CCGCCGCCGCCGCCCCCGGCCACCGCGGCCCCGCCGCCCCCGCCGCCGCCCCCGCCTCCCCCTGCCT
CA
GCGGCTGCCCCCGCCAGCGGGCCGCCCGCTCCCCCGGGCCTTGCAGCGGGCCCCGGCCCGGCTGGAGG
A
GCCCCGACCCCAGCTCTGGTGGCGGGCAGCAGCGCCGCGGCCCCCTTCCCTCACGGGGACTCGGCCCTG
AAC
GAGCAGGAGAAGGAGTTGCAGCGGCGGCTGAAGCGTCTCTACCCGGCCGTGGACGAACAAGAGACGC
CG
CTGCCTCGGTCCTGGAGCCCGAAGGACAAGTTCAGCTACATCGGCCTCTCTCAGAACAACCTGCGGGT
G
CACTACAAAGGTCATGGCAAAACCCCAAAAGATGCCGCGTCAGTTCGAGCCACGCATCCAATACCAGCA
GCC
TGTGGGATTTATTATTTTGAAGTAAAAATTGTCAGTAAGGGAAGAGATGGTTACATGGGAATTGGTC
TT
TCTGCTCAAGGTGTGAACATGAATAGACTACCAGGTTGGGATAAGCATTCATATGGTTACCATGGGGA
T
GATGGACATTCGTTTTGTTCTTCTGGAACTGGACAACCTTATGGACCAACTTTCACTACTGGTGATGTC
ATT
GGCTGTTGTGTTAATCTTATCAACAATACCTGCTTTTACACCAAGAATGGACATAGTTTAGGTATTG
CT
TTCACTGACCTACCGCCAAATTTGTATCCTACTGTGGGGCTTCAAACACCAGGAGAAGTGGTCGATGC
C
AATTTTGGGCAACATCCTTTCGTGTTTGATATAGAAGACTATATGCGGGAGTGGAGAACCAAAATCCAG
GCA
CAGATAGATCGATTTCCTATCGGAGATCGAGAAGGAGAATGGCAGACCATGATACAAAAAATGGTTT
CA
TCTTATTTAGTCCACCATGGGTACTGTGCCACAGCAGAGGCCTTTGCCAGATCTACAGACCAGACCGT
T
CTAGAAGAATTAGCTTCCATTAAGAATAGACAAAGAATTCAGAAATTGGTATTAGCAGGAAGAATGGGA
GAA
GCCATTGAAACAACACAACAGTTATACCCAAGTTTACTTGAAAGAAATCCTAATCTCCTTTTCACAT
TA
AAAGTGCGTCAGTTTATAGAAATGGTGAATGGTACAGATAGTGAAGTACGATGTTTGGGAGGCCGAAG
T
CCAAAGTCTCAAGACAGTTATCCTGTTAGTCCTCGACCTTTTAGTAGTCCAAGTATGAGCCCCAGCCAT
GGA
ATGAATATCCACAATTTAGCATCAGGCAAAGGAAGCACCGCACATTTTTCAGGTTTTGAAAGTTGTA
GT
AATGGTGTAATATCAAATAAAGCACATCAATCATATTGCCATAGTAATAAACACCAGTCATCCAACTT
G
AATGTACCAGAACTAAACAGTATAAATATGTCAAGATCACAGCAAGTTAATAACTTCACCAGTAATGAT
GTA
GACATGGAAACAGATCACTACTCCAATGGAGTTGGAGAAACTTCATCCAATGGTTTCCTAAATGGTA
GC
TCTAAACATGACCACGAAATGGAAGATTGTGACACCGAAATGGAAGTTGATTCAAGTCAGTTGAGACG
C
CAGTTGTGTGGAGGAAGTCAGGCCGCCATAGAAAGAATGATCCACTTTGGACGAGAGCTGCAAGCAATG
AGT
GAACAGCTAAGGAGAGACTGTGGCAAGAACACTGCAAACAAAAAAATGTTGAAGGATGCATTCAGTC
TA
CTAGCATATTCAGATCCCTGGAACAGCCCAGTTGGAAATCAGCTTGACCCGATTCAGAGAGAACCTGT
G
TGCTCAGCTCTTAACAGTGCAATATTAGAAACCCACAATCTGCCAAAGCAACCTCCACTTGCCCTAGCA
ATG
GGACAGGCCACACAATGTCTAGGACTGATGGCTCGATCAGGAATTGGATCCTGCGCATTTGCCACAG
TG
GAAGACTACCTACATTAG


Translation (729 aa):
MSGQPPPPPPQQQQQQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAGGEGLGAAAAALLLH
P
PPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSAL
N
EQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYK
GHGKTPKDAASVRATHPIPA
A
CGIYYFEVKIVSKGRD
GYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDV
I
GCCVNLINNTCFYTKNGHSL
GIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQ
A
QIDRFPIGDREGEWQTMIQ
KMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMG
E
AIETTQQLYPSLLERNPNLLFTL
KVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSH
G
MNIHNLASGKGSTAHFS
GFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSND
V
DMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEM
EVDSSQLRRQLCGGSQAAIERMIHFGRELQAM
S
EQLRRDCGKNTANKKMLK
DAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALA
M
GQATQCLGLMARSGIGSCAFATVEDYLH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser