NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1467.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1467.1 Public Homo sapiens 1 IL10 22 109 92 CCDS HistoryNCBI Gene:3586Re-query CCDS DB by CCDS ID:1467.1Re-query CCDS DB by GeneID:3586See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1467.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000423557.1 ENSP00000412237.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000423557.1Link to Ensembl Protein Viewer:ENSP00000412237.1Re-query CCDS DB by Nucleotide ID:ENST00000423557Re-query CCDS DB by Protein ID:ENSP00000412237
Original member NCBI NM_000572.2 NP_000563.1 Updated not alive Link to Nucleotide Sequence:NM_000572.2Link to Protein Sequence:NP_000563.1Re-query CCDS DB by Nucleotide ID:NM_000572Re-query CCDS DB by Protein ID:NP_000563
Current member NCBI NM_000572.3 NP_000563.1 Accepted alive Link to Nucleotide Sequence:NM_000572.3Link to Protein Sequence:NP_000563.1Re-query CCDS DB by Nucleotide ID:NM_000572Re-query CCDS DB by Protein ID:NP_000563Link to BLAST:NP_000563.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000563.1 178 P22301 178 100% 0 0

Chromosomal Locations for CCDS 1467.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 206768636 206768728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 206769829 206769894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 206770907 206771059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 206771356 206771415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 206772271 206772435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (537 nt):
ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAGGGCCAGCCCAGGCCAGGGCA
CC
CAGTCTGAGAACAGCTGCACCCACTTCCCAGGCAACCTGCCTAACATGCTTCGAGATCTCCGAGATGC
C
TTCAGCAGAGTGAAGACTTTCTTTCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAGTCCTTG
CTG
GAGGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTGGAGGAGG
TG
ATGCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTGAACTCCCTGGGGGAGAACCTGAA
G
ACCCTCAGGCTGAGGCTACGGCGCTGTCATCGATTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAG
CAG
GTGAAGAATGCCTTTAATAAGCTCCAAGAGAAAGGCATCTACAAAGCCATGAGTGAGTTTGACATCT
TC
ATCAACTACATAGAAGCCTACATGACAATGAAGATACGAAACTGA


Translation (178 aa):
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESL
L
EDFK
GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE
Q
VKNAFNK
LQEKGIYKAMSEFDIFINYIEAYMTMKIRN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser