NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22604.1 Public Mus musculus 8 Atp6v0d1 23 108 98 CCDS HistoryNCBI Gene:11972Re-query CCDS DB by CCDS ID:22604.1Re-query CCDS DB by GeneID:11972See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22604.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000013304.7 ENSMUSP00000013304.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000013304.7Link to Ensembl Protein Viewer:ENSMUSP00000013304.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000013304Re-query CCDS DB by Protein ID:ENSMUSP00000013304
Original member Current member NCBI NM_013477.4 NP_038505.2 Accepted alive Link to Nucleotide Sequence:NM_013477.4Link to Protein Sequence:NP_038505.2Re-query CCDS DB by Nucleotide ID:NM_013477Re-query CCDS DB by Protein ID:NP_038505Link to BLAST:NP_038505.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038505.2 351 P51863 351 100% 0 0

Chromosomal Locations for CCDS 22604.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 105524903 105525064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105525157 105525234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105525323 105525499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105525624 105525701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105529174 105529253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105530815 105530993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105539321 105539492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 105565783 105565912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1056 nt):
ATGTCGTTCTTCCCGGAGCTCTATTTCAACGTGGACAATGGCTACTTGGAGGGATTAGTGCGCGGCCTGA
AG
GCCGGGGTGCTCAGCCAGGCGGACTACCTCAACCTGGTGCAGTGCGAGACGCTCGAGGACTTGAAGCT
G
CACCTACAGAGTACAGATTATGGCAACTTCCTGGCCAATGAAGCGTCACCTCTGACGGTGTCAGTCATC
GAT
GACAAGCTCAAGGAGAAGATGGTAGTAGAGTTCCGCCACATGAGAAACCATGCTTATGAGCCGCTCG
CC
AGCTTCCTGGACTTCATAACTTATAGCTACATGATTGACAACGTGATCCTGCTAATCACAGGCACACT
G
CACCAGCGTTCAATAGCTGAACTTGTGCCCAAGTGCCATCCGCTAGGCAGCTTTGAGCAGATGGAGGCT
GTG
AACATCGCACAGACACCTGCAGAGCTCTACAATGCCATTCTGGTGGACACACCCCTGGCGGCTTTTT
TC
CAGGACTGCATCTCAGAGCAGGACCTTGATGAGATGAACATCGAGATAATCCGAAATACGCTTTACAA
G
GCCTACTTGGAGTCCTTCTACAAGTTCTGTACTCTGTTGGGTGGGACCACAGCTGATGCCATGTGTCCT
ATC
CTAGAGTTTGAAGCAGACCGCCGCGCTTTCATCATCACCATCAACTCTTTCGGCACAGAGCTGTCCA
AG
GAGGACCGTGCCAAGCTCTTCCCGCACTGTGGCCGGCTCTACCCTGAGGGCTTGGCTCAGCTGGCGCG
G
GCTGATGACTATGAACAGGTCAAGAATGTAGCTGATTACTACCCGGAATACAAACTGCTTTTTGAGGGT
GCA
GGTAGCAATCCTGGAGACAAGACCCTGGAGGACCGGTTTTTTGAACATGAGGTGAAGCTAAACAAGC
TG
GCCTTCCTGAACCAGTTCCATTTTGGTGTCTTTTATGCCTTTGTGAAGCTTAAGGAACAGGAATGTCG
C
AACATCGTATGGATTGCTGAGTGCATTGCCCAGCGCCATCGCGCCAAGATCGACAACTACATCCCCATC
TTT
TAG


Translation (351 aa):
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI
D
DKLKEKMVVEFRHMRNHAYEPLASFLDFI
TYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEA
V
NIAQTPAELYNAILVDTPL
AAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP
I
LE
FEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG
A
GSNPGDKTLEDRFFEHE
VKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI
F




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser