NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37012.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37012.1 Public Mus musculus 14 Dnajc3 23 108 98 CCDS HistoryNCBI Gene:100037258Re-query CCDS DB by CCDS ID:37012.1Re-query CCDS DB by GeneID:100037258See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37012.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000022734.8 ENSMUSP00000022734.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022734.8Link to Ensembl Protein Viewer:ENSMUSP00000022734.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000022734Re-query CCDS DB by Protein ID:ENSMUSP00000022734
Original member Current member NCBI NM_008929.3 NP_032955.2 Accepted alive Link to Nucleotide Sequence:NM_008929.3Link to Protein Sequence:NP_032955.2Re-query CCDS DB by Nucleotide ID:NM_008929Re-query CCDS DB by Protein ID:NP_032955Link to BLAST:NP_032955.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032955.2 504 Q91YW3 504 100% 0 0

Chromosomal Locations for CCDS 37012.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 118938089 118938170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118953109 118953219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118957868 118957992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118960786 118960860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118967989 118968141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118970100 118970281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118970683 118970802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118972363 118972468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118972693 118972813 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118975132 118975264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118976710 118976858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 118978027 118978184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1515 nt):
ATGGTGGCCCCCGGCTCGGTGGGCAGCCGGCTGGGCGCGGTGTTCCCGTTCCTGCTGGTCCTGGTGGACC
TG
CAGTACGAAGGCGCTGAGTGTGGAGTAAATGCGGATGTGGAGAAGCATCTTGAATTGGGGAAGAAATT
A
CTCGCAGCCGGACAGCTAGCCGACGCCTTATCACAGTTTCACGCTGCAGTTGATGGTGACCCCGATAAC
TAT
ATCGCATACTATAGGAGAGCTACCGTCTTCTTAGCCATGGGAAAATCCAAAGCAGCGCTGCCCGACC
TC
ACCAAAGTGATTGCGCTGAAGATGGACTTTACTGCCGCAAGACTACAGAGAGGTCACCTACTGCTCAA
A
CAAGGGAAGCTTGACGAAGCAGAAGACGATTTCAAGAAAGTGCTCAAATCTAACCCCAGTGAGCAGGAG
GAG
AAGGAAGCCGAGTCTCAGCTTGTAAAAGCTGACGAGATGCAGCGGCTGCGCTCCCAAGCGCTCGACG
CC
TTTGACGGTGCCGATTACACTGCTGCTATAACCTTCCTTGATAAGATTTTAGAGGTTTGTGTTTGGGA
T
GCAGAACTGCGTGAACTGCGAGCAGAATGCTTCATAAAGGAAGGAGAGCCCAGGAAAGCCATCAGCGAC
TTA
AAGGCTGCTTCAAAGCTGAAGAGTGACAACACAGAGGCCTTTTACAAAATCAGCACACTCTACTACC
AG
CTAGGAGACCATGAGCTGTCTCTCAGTGAAGTTCGTGAATGTCTGAAACTTGACCAGGATCACAAGCG
G
TGTTTTGCACACTATAAGCAAGTGAAGAAACTTAACAAGCTGATTGAGTCAGCTGAAGAGCTGATCCGA
GAT
GGCAGATACACAGATGCAACCAGCAAATATGAATCAGTCATGAAAACAGAGCCCAGTGTTGCTGAGT
AC
ACAGTGCGCTCGAAGGAGAGGATCTGCCACTGCTTCTCTAAGGATGAGAAGCCCGTGGAAGCCATTAG
G
ATATGTTCTGAAGTTTTACAGATGGAGCCCGACAATGTGAATGCTCTGAAAGACCGAGCCGAGGCCTAC
TTA
ATAGAGGAAATGTACGATGAAGCCATTCAGGATTATGAAGCTGCTCAGGAGCACAATGAAAATGACC
AG
CAGATTCGGGAAGGCTTAGAGAAAGCCCAGCGGTTACTGAAGCAGTCACAGAAACGAGATTATTATAA
A
ATCTTGGGAGTAAAAAGAAATGCCAAAAAACAAGAAATCATTAAAGCATACCGAAAGTTAGCACTGCAG
TGG
CATCCAGATAATTTCCAGAATGAAGAAGAAAAGAAAAAAGCAGAGAAAAAGTTCATTGACATAGCAG
CT
GCTAAAGAAGTCCTCTCAGACCCAGAAATGAGAAAGAAGTTTGATGATGGAGAAGATCCTCTTGATGC
A
GAGAGTCAACAAGGAGGTGGTGGCAACCCCTTCCACAGAAGTTGGAACTCATGGCAAGGGTTTAACCCC
TTC
AGCTCAGGCGGACCGTTCAGATTTAAGTTCCACTTCAATTAA


Translation (504 aa):
MVAPGSVGSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN
Y
IAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTA
ARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQE
E
KEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILE
VCVWDAELRELRAECFIKEGEPRKAISD
L
KAASKLKSDNTEAFYKISTLYYQLGDHELSL
SEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR
D
G
RYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAY
L
IEEMYDE
AIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
W
HPDNFQNEEEKKKAEKKFIDIAAAKEVLSDP
EMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP
F
SSGGPFRFKFHFN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser