NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15959.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15959.1 Public Mus musculus 2 Rab14 23 108 98 CCDS HistoryNCBI Gene:68365Re-query CCDS DB by CCDS ID:15959.1Re-query CCDS DB by GeneID:68365See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15959.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000028238.14 ENSMUSP00000028238.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028238.14Link to Ensembl Protein Viewer:ENSMUSP00000028238.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000028238Re-query CCDS DB by Protein ID:ENSMUSP00000028238
Original member Current member NCBI NM_026697.4 NP_080973.1 Accepted alive Link to Nucleotide Sequence:NM_026697.4Link to Protein Sequence:NP_080973.1Re-query CCDS DB by Nucleotide ID:NM_026697Re-query CCDS DB by Protein ID:NP_080973Link to BLAST:NP_080973.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080973.1 215 Q91V41 215 100% 0 0

Chromosomal Locations for CCDS 15959.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 35182270 35182447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35183393 35183423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35183744 35183831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35186674 35186740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35189900 35190077 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35191512 35191565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 35192621 35192672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (648 nt):
ATGGCAACTGCACCGTACAACTACTCTTACATCTTTAAGTATATTATTATTGGGGATATGGGAGTAGGAA
AA
TCTTGCTTGCTTCATCAATTTACAGAAAAAAAATTTATGGCTGATTGTCCTCACACAATTGGTGTTGA
A
TTTGGTACAAGAATAATTGAAGTTAGTGGTCAAAAAATCAAACTGCAGATTTGGGATACAGCAGGGCAG
GAG
CGGTTCAGAGCGGTTACACGGAGCTACTATAGAGGAGCTGCAGGTGCGCTCATGGTGTATGACATCA
CC
AGAAGAAGTACATATAACCACTTAAGCAGCTGGTTGACAGACGCAAGGAATCTCACCAATCCAAACAC
T
GTAATAATTCTCATAGGAAATAAAGCAGACTTGGAAGCACAGAGAGATGTTACCTATGAAGAAGCCAAA
CAG
TTTGCTGAGGAAAACGGCTTATTGTTCCTTGAAGCAAGCGCAAAAACGGGAGAGAATGTAGAAGATG
CT
TTTCTTGAGGCTGCCAAGAAAATCTATCAGAACATTCAGGATGGAAGCCTGGATCTGAATGCTGCCGA
G
TCTGGTGTACAACACAAACCCTCAGCCCCGCAGGGAGGACGGCTAACCAGTGAACCCCAACCCCAGAGA
GAA
GGCTGTGGCTGCTAG


Translation (215 aa):
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ
E
RFRAVTRSYYRGAAGALMVYDIT
RRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
Q
FAEEN
GLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR
E
GCGC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser