Current GenBank Release Notes
GBREL.TXT Genetic Sequence Data Bank
April 15 2024
NCBI-GenBank Flat File Release 260.0
Distribution Release Notes
250803006 sequences, 3213818003787 bases, for traditional GenBank records
4209804087 sequences, 27968257148275 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 260.0
1.2 Cutoff Date
1.3 Important Changes in Release 260.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 260.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genbank/update/
Email: update@ncbi.nlm.nih.gov
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 260.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:
ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.
1.2 Cutoff Date
This full release, 260.0, incorporates data processed by the INSDC databases
as of Saturday December 16 at 11:22PM EST. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 260.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 1560 with this release:
- the BCT division is now composed of 1201 files (+132)
- the CON division is now composed of 240 files (+2)
- the INV division is now composed of 2561 files (+462)
- the MAM division is now composed of 349 files (+76)
- the PAT division is now composed of 269 files (+6)
- the PLN division is now composed of 2458 files (+745)
- the PRI division is now composed of 87 files (+10)
- the ROD division is now composed of 343 files (+29)
- the VRL division is now composed of 1095 files (+32)
- the VRT division is now composed of 575 files (+66)
1.4 Upcoming Changes
1.4.1 The /country qualifier will transition to /geo_loc_name
As of GenBank Release 262.0 in June 2024, the name of the "country"
qualifier will be changed to "geo_loc_name", to reflect the fact that
it is used for geographic features (for example: islands, oceans and seas)
in addition to country names. For further information, please see:
https://ncbiinsights.ncbi.nlm.nih.gov/2023/12/14/update-genbank-qualifier/
1.4.2 New allowed values for the /country and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /country (soon to be renamed
as /geo_loc_name, see Section 1.4.1) and /collection_date for sequence
submissions, in alignment with its goal of increasing the number of
sequences for which the origin of a sample can be precisely located in
time and space. This requirement is expected to take effect by the end of
December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which the country and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timing for introducing these new values is still uncertain, but the
earliest possible date for their appearance is June 15 2023.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:
table2asn: https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 10392 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct1000.seq - Bacterial sequence entries, part 1000.
5. gbbct1001.seq - Bacterial sequence entries, part 1001.
6. gbbct1002.seq - Bacterial sequence entries, part 1002.
7. gbbct1003.seq - Bacterial sequence entries, part 1003.
8. gbbct1004.seq - Bacterial sequence entries, part 1004.
9. gbbct1005.seq - Bacterial sequence entries, part 1005.
10. gbbct1006.seq - Bacterial sequence entries, part 1006.
11. gbbct1007.seq - Bacterial sequence entries, part 1007.
12. gbbct1008.seq - Bacterial sequence entries, part 1008.
13. gbbct1009.seq - Bacterial sequence entries, part 1009.
14. gbbct101.seq - Bacterial sequence entries, part 101.
15. gbbct1010.seq - Bacterial sequence entries, part 1010.
16. gbbct1011.seq - Bacterial sequence entries, part 1011.
17. gbbct1012.seq - Bacterial sequence entries, part 1012.
18. gbbct1013.seq - Bacterial sequence entries, part 1013.
19. gbbct1014.seq - Bacterial sequence entries, part 1014.
20. gbbct1015.seq - Bacterial sequence entries, part 1015.
21. gbbct1016.seq - Bacterial sequence entries, part 1016.
22. gbbct1017.seq - Bacterial sequence entries, part 1017.
23. gbbct1018.seq - Bacterial sequence entries, part 1018.
24. gbbct1019.seq - Bacterial sequence entries, part 1019.
25. gbbct102.seq - Bacterial sequence entries, part 102.
26. gbbct1020.seq - Bacterial sequence entries, part 1020.
27. gbbct1021.seq - Bacterial sequence entries, part 1021.
28. gbbct1022.seq - Bacterial sequence entries, part 1022.
29. gbbct1023.seq - Bacterial sequence entries, part 1023.
30. gbbct1024.seq - Bacterial sequence entries, part 1024.
31. gbbct1025.seq - Bacterial sequence entries, part 1025.
32. gbbct1026.seq - Bacterial sequence entries, part 1026.
33. gbbct1027.seq - Bacterial sequence entries, part 1027.
34. gbbct1028.seq - Bacterial sequence entries, part 1028.
35. gbbct1029.seq - Bacterial sequence entries, part 1029.
36. gbbct103.seq - Bacterial sequence entries, part 103.
37. gbbct1030.seq - Bacterial sequence entries, part 1030.
38. gbbct1031.seq - Bacterial sequence entries, part 1031.
39. gbbct1032.seq - Bacterial sequence entries, part 1032.
40. gbbct1033.seq - Bacterial sequence entries, part 1033.
41. gbbct1034.seq - Bacterial sequence entries, part 1034.
42. gbbct1035.seq - Bacterial sequence entries, part 1035.
43. gbbct1036.seq - Bacterial sequence entries, part 1036.
44. gbbct1037.seq - Bacterial sequence entries, part 1037.
45. gbbct1038.seq - Bacterial sequence entries, part 1038.
46. gbbct1039.seq - Bacterial sequence entries, part 1039.
47. gbbct104.seq - Bacterial sequence entries, part 104.
48. gbbct1040.seq - Bacterial sequence entries, part 1040.
49. gbbct1041.seq - Bacterial sequence entries, part 1041.
50. gbbct1042.seq - Bacterial sequence entries, part 1042.
51. gbbct1043.seq - Bacterial sequence entries, part 1043.
52. gbbct1044.seq - Bacterial sequence entries, part 1044.
53. gbbct1045.seq - Bacterial sequence entries, part 1045.
54. gbbct1046.seq - Bacterial sequence entries, part 1046.
55. gbbct1047.seq - Bacterial sequence entries, part 1047.
56. gbbct1048.seq - Bacterial sequence entries, part 1048.
57. gbbct1049.seq - Bacterial sequence entries, part 1049.
58. gbbct105.seq - Bacterial sequence entries, part 105.
59. gbbct1050.seq - Bacterial sequence entries, part 1050.
60. gbbct1051.seq - Bacterial sequence entries, part 1051.
61. gbbct1052.seq - Bacterial sequence entries, part 1052.
62. gbbct1053.seq - Bacterial sequence entries, part 1053.
63. gbbct1054.seq - Bacterial sequence entries, part 1054.
64. gbbct1055.seq - Bacterial sequence entries, part 1055.
65. gbbct1056.seq - Bacterial sequence entries, part 1056.
66. gbbct1057.seq - Bacterial sequence entries, part 1057.
67. gbbct1058.seq - Bacterial sequence entries, part 1058.
68. gbbct1059.seq - Bacterial sequence entries, part 1059.
69. gbbct106.seq - Bacterial sequence entries, part 106.
70. gbbct1060.seq - Bacterial sequence entries, part 1060.
71. gbbct1061.seq - Bacterial sequence entries, part 1061.
72. gbbct1062.seq - Bacterial sequence entries, part 1062.
73. gbbct1063.seq - Bacterial sequence entries, part 1063.
74. gbbct1064.seq - Bacterial sequence entries, part 1064.
75. gbbct1065.seq - Bacterial sequence entries, part 1065.
76. gbbct1066.seq - Bacterial sequence entries, part 1066.
77. gbbct1067.seq - Bacterial sequence entries, part 1067.
78. gbbct1068.seq - Bacterial sequence entries, part 1068.
79. gbbct1069.seq - Bacterial sequence entries, part 1069.
80. gbbct107.seq - Bacterial sequence entries, part 107.
81. gbbct1070.seq - Bacterial sequence entries, part 1070.
82. gbbct1071.seq - Bacterial sequence entries, part 1071.
83. gbbct1072.seq - Bacterial sequence entries, part 1072.
84. gbbct1073.seq - Bacterial sequence entries, part 1073.
85. gbbct1074.seq - Bacterial sequence entries, part 1074.
86. gbbct1075.seq - Bacterial sequence entries, part 1075.
87. gbbct1076.seq - Bacterial sequence entries, part 1076.
88. gbbct1077.seq - Bacterial sequence entries, part 1077.
89. gbbct1078.seq - Bacterial sequence entries, part 1078.
90. gbbct1079.seq - Bacterial sequence entries, part 1079.
91. gbbct108.seq - Bacterial sequence entries, part 108.
92. gbbct1080.seq - Bacterial sequence entries, part 1080.
93. gbbct1081.seq - Bacterial sequence entries, part 1081.
94. gbbct1082.seq - Bacterial sequence entries, part 1082.
95. gbbct1083.seq - Bacterial sequence entries, part 1083.
96. gbbct1084.seq - Bacterial sequence entries, part 1084.
97. gbbct1085.seq - Bacterial sequence entries, part 1085.
98. gbbct1086.seq - Bacterial sequence entries, part 1086.
99. gbbct1087.seq - Bacterial sequence entries, part 1087.
100. gbbct1088.seq - Bacterial sequence entries, part 1088.
101. gbbct1089.seq - Bacterial sequence entries, part 1089.
102. gbbct109.seq - Bacterial sequence entries, part 109.
103. gbbct1090.seq - Bacterial sequence entries, part 1090.
104. gbbct1091.seq - Bacterial sequence entries, part 1091.
105. gbbct1092.seq - Bacterial sequence entries, part 1092.
106. gbbct1093.seq - Bacterial sequence entries, part 1093.
107. gbbct1094.seq - Bacterial sequence entries, part 1094.
108. gbbct1095.seq - Bacterial sequence entries, part 1095.
109. gbbct1096.seq - Bacterial sequence entries, part 1096.
110. gbbct1097.seq - Bacterial sequence entries, part 1097.
111. gbbct1098.seq - Bacterial sequence entries, part 1098.
112. gbbct1099.seq - Bacterial sequence entries, part 1099.
113. gbbct11.seq - Bacterial sequence entries, part 11.
114. gbbct110.seq - Bacterial sequence entries, part 110.
115. gbbct1100.seq - Bacterial sequence entries, part 1100.
116. gbbct1101.seq - Bacterial sequence entries, part 1101.
117. gbbct1102.seq - Bacterial sequence entries, part 1102.
118. gbbct1103.seq - Bacterial sequence entries, part 1103.
119. gbbct1104.seq - Bacterial sequence entries, part 1104.
120. gbbct1105.seq - Bacterial sequence entries, part 1105.
121. gbbct1106.seq - Bacterial sequence entries, part 1106.
122. gbbct1107.seq - Bacterial sequence entries, part 1107.
123. gbbct1108.seq - Bacterial sequence entries, part 1108.
124. gbbct1109.seq - Bacterial sequence entries, part 1109.
125. gbbct111.seq - Bacterial sequence entries, part 111.
126. gbbct1110.seq - Bacterial sequence entries, part 1110.
127. gbbct1111.seq - Bacterial sequence entries, part 1111.
128. gbbct1112.seq - Bacterial sequence entries, part 1112.
129. gbbct1113.seq - Bacterial sequence entries, part 1113.
130. gbbct1114.seq - Bacterial sequence entries, part 1114.
131. gbbct1115.seq - Bacterial sequence entries, part 1115.
132. gbbct1116.seq - Bacterial sequence entries, part 1116.
133. gbbct1117.seq - Bacterial sequence entries, part 1117.
134. gbbct1118.seq - Bacterial sequence entries, part 1118.
135. gbbct1119.seq - Bacterial sequence entries, part 1119.
136. gbbct112.seq - Bacterial sequence entries, part 112.
137. gbbct1120.seq - Bacterial sequence entries, part 1120.
138. gbbct1121.seq - Bacterial sequence entries, part 1121.
139. gbbct1122.seq - Bacterial sequence entries, part 1122.
140. gbbct1123.seq - Bacterial sequence entries, part 1123.
141. gbbct1124.seq - Bacterial sequence entries, part 1124.
142. gbbct1125.seq - Bacterial sequence entries, part 1125.
143. gbbct1126.seq - Bacterial sequence entries, part 1126.
144. gbbct1127.seq - Bacterial sequence entries, part 1127.
145. gbbct1128.seq - Bacterial sequence entries, part 1128.
146. gbbct1129.seq - Bacterial sequence entries, part 1129.
147. gbbct113.seq - Bacterial sequence entries, part 113.
148. gbbct1130.seq - Bacterial sequence entries, part 1130.
149. gbbct1131.seq - Bacterial sequence entries, part 1131.
150. gbbct1132.seq - Bacterial sequence entries, part 1132.
151. gbbct1133.seq - Bacterial sequence entries, part 1133.
152. gbbct1134.seq - Bacterial sequence entries, part 1134.
153. gbbct1135.seq - Bacterial sequence entries, part 1135.
154. gbbct1136.seq - Bacterial sequence entries, part 1136.
155. gbbct1137.seq - Bacterial sequence entries, part 1137.
156. gbbct1138.seq - Bacterial sequence entries, part 1138.
157. gbbct1139.seq - Bacterial sequence entries, part 1139.
158. gbbct114.seq - Bacterial sequence entries, part 114.
159. gbbct1140.seq - Bacterial sequence entries, part 1140.
160. gbbct1141.seq - Bacterial sequence entries, part 1141.
161. gbbct1142.seq - Bacterial sequence entries, part 1142.
162. gbbct1143.seq - Bacterial sequence entries, part 1143.
163. gbbct1144.seq - Bacterial sequence entries, part 1144.
164. gbbct1145.seq - Bacterial sequence entries, part 1145.
165. gbbct1146.seq - Bacterial sequence entries, part 1146.
166. gbbct1147.seq - Bacterial sequence entries, part 1147.
167. gbbct1148.seq - Bacterial sequence entries, part 1148.
168. gbbct1149.seq - Bacterial sequence entries, part 1149.
169. gbbct115.seq - Bacterial sequence entries, part 115.
170. gbbct1150.seq - Bacterial sequence entries, part 1150.
171. gbbct1151.seq - Bacterial sequence entries, part 1151.
172. gbbct1152.seq - Bacterial sequence entries, part 1152.
173. gbbct1153.seq - Bacterial sequence entries, part 1153.
174. gbbct1154.seq - Bacterial sequence entries, part 1154.
175. gbbct1155.seq - Bacterial sequence entries, part 1155.
176. gbbct1156.seq - Bacterial sequence entries, part 1156.
177. gbbct1157.seq - Bacterial sequence entries, part 1157.
178. gbbct1158.seq - Bacterial sequence entries, part 1158.
179. gbbct1159.seq - Bacterial sequence entries, part 1159.
180. gbbct116.seq - Bacterial sequence entries, part 116.
181. gbbct1160.seq - Bacterial sequence entries, part 1160.
182. gbbct1161.seq - Bacterial sequence entries, part 1161.
183. gbbct1162.seq - Bacterial sequence entries, part 1162.
184. gbbct1163.seq - Bacterial sequence entries, part 1163.
185. gbbct1164.seq - Bacterial sequence entries, part 1164.
186. gbbct1165.seq - Bacterial sequence entries, part 1165.
187. gbbct1166.seq - Bacterial sequence entries, part 1166.
188. gbbct1167.seq - Bacterial sequence entries, part 1167.
189. gbbct1168.seq - Bacterial sequence entries, part 1168.
190. gbbct1169.seq - Bacterial sequence entries, part 1169.
191. gbbct117.seq - Bacterial sequence entries, part 117.
192. gbbct1170.seq - Bacterial sequence entries, part 1170.
193. gbbct1171.seq - Bacterial sequence entries, part 1171.
194. gbbct1172.seq - Bacterial sequence entries, part 1172.
195. gbbct1173.seq - Bacterial sequence entries, part 1173.
196. gbbct1174.seq - Bacterial sequence entries, part 1174.
197. gbbct1175.seq - Bacterial sequence entries, part 1175.
198. gbbct1176.seq - Bacterial sequence entries, part 1176.
199. gbbct1177.seq - Bacterial sequence entries, part 1177.
200. gbbct1178.seq - Bacterial sequence entries, part 1178.
201. gbbct1179.seq - Bacterial sequence entries, part 1179.
202. gbbct118.seq - Bacterial sequence entries, part 118.
203. gbbct1180.seq - Bacterial sequence entries, part 1180.
204. gbbct1181.seq - Bacterial sequence entries, part 1181.
205. gbbct1182.seq - Bacterial sequence entries, part 1182.
206. gbbct1183.seq - Bacterial sequence entries, part 1183.
207. gbbct1184.seq - Bacterial sequence entries, part 1184.
208. gbbct1185.seq - Bacterial sequence entries, part 1185.
209. gbbct1186.seq - Bacterial sequence entries, part 1186.
210. gbbct1187.seq - Bacterial sequence entries, part 1187.
211. gbbct1188.seq - Bacterial sequence entries, part 1188.
212. gbbct1189.seq - Bacterial sequence entries, part 1189.
213. gbbct119.seq - Bacterial sequence entries, part 119.
214. gbbct1190.seq - Bacterial sequence entries, part 1190.
215. gbbct1191.seq - Bacterial sequence entries, part 1191.
216. gbbct1192.seq - Bacterial sequence entries, part 1192.
217. gbbct1193.seq - Bacterial sequence entries, part 1193.
218. gbbct1194.seq - Bacterial sequence entries, part 1194.
219. gbbct1195.seq - Bacterial sequence entries, part 1195.
220. gbbct1196.seq - Bacterial sequence entries, part 1196.
221. gbbct1197.seq - Bacterial sequence entries, part 1197.
222. gbbct1198.seq - Bacterial sequence entries, part 1198.
223. gbbct1199.seq - Bacterial sequence entries, part 1199.
224. gbbct12.seq - Bacterial sequence entries, part 12.
225. gbbct120.seq - Bacterial sequence entries, part 120.
226. gbbct1200.seq - Bacterial sequence entries, part 1200.
227. gbbct1201.seq - Bacterial sequence entries, part 1201.
228. gbbct121.seq - Bacterial sequence entries, part 121.
229. gbbct122.seq - Bacterial sequence entries, part 122.
230. gbbct123.seq - Bacterial sequence entries, part 123.
231. gbbct124.seq - Bacterial sequence entries, part 124.
232. gbbct125.seq - Bacterial sequence entries, part 125.
233. gbbct126.seq - Bacterial sequence entries, part 126.
234. gbbct127.seq - Bacterial sequence entries, part 127.
235. gbbct128.seq - Bacterial sequence entries, part 128.
236. gbbct129.seq - Bacterial sequence entries, part 129.
237. gbbct13.seq - Bacterial sequence entries, part 13.
238. gbbct130.seq - Bacterial sequence entries, part 130.
239. gbbct131.seq - Bacterial sequence entries, part 131.
240. gbbct132.seq - Bacterial sequence entries, part 132.
241. gbbct133.seq - Bacterial sequence entries, part 133.
242. gbbct134.seq - Bacterial sequence entries, part 134.
243. gbbct135.seq - Bacterial sequence entries, part 135.
244. gbbct136.seq - Bacterial sequence entries, part 136.
245. gbbct137.seq - Bacterial sequence entries, part 137.
246. gbbct138.seq - Bacterial sequence entries, part 138.
247. gbbct139.seq - Bacterial sequence entries, part 139.
248. gbbct14.seq - Bacterial sequence entries, part 14.
249. gbbct140.seq - Bacterial sequence entries, part 140.
250. gbbct141.seq - Bacterial sequence entries, part 141.
251. gbbct142.seq - Bacterial sequence entries, part 142.
252. gbbct143.seq - Bacterial sequence entries, part 143.
253. gbbct144.seq - Bacterial sequence entries, part 144.
254. gbbct145.seq - Bacterial sequence entries, part 145.
255. gbbct146.seq - Bacterial sequence entries, part 146.
256. gbbct147.seq - Bacterial sequence entries, part 147.
257. gbbct148.seq - Bacterial sequence entries, part 148.
258. gbbct149.seq - Bacterial sequence entries, part 149.
259. gbbct15.seq - Bacterial sequence entries, part 15.
260. gbbct150.seq - Bacterial sequence entries, part 150.
261. gbbct151.seq - Bacterial sequence entries, part 151.
262. gbbct152.seq - Bacterial sequence entries, part 152.
263. gbbct153.seq - Bacterial sequence entries, part 153.
264. gbbct154.seq - Bacterial sequence entries, part 154.
265. gbbct155.seq - Bacterial sequence entries, part 155.
266. gbbct156.seq - Bacterial sequence entries, part 156.
267. gbbct157.seq - Bacterial sequence entries, part 157.
268. gbbct158.seq - Bacterial sequence entries, part 158.
269. gbbct159.seq - Bacterial sequence entries, part 159.
270. gbbct16.seq - Bacterial sequence entries, part 16.
271. gbbct160.seq - Bacterial sequence entries, part 160.
272. gbbct161.seq - Bacterial sequence entries, part 161.
273. gbbct162.seq - Bacterial sequence entries, part 162.
274. gbbct163.seq - Bacterial sequence entries, part 163.
275. gbbct164.seq - Bacterial sequence entries, part 164.
276. gbbct165.seq - Bacterial sequence entries, part 165.
277. gbbct166.seq - Bacterial sequence entries, part 166.
278. gbbct167.seq - Bacterial sequence entries, part 167.
279. gbbct168.seq - Bacterial sequence entries, part 168.
280. gbbct169.seq - Bacterial sequence entries, part 169.
281. gbbct17.seq - Bacterial sequence entries, part 17.
282. gbbct170.seq - Bacterial sequence entries, part 170.
283. gbbct171.seq - Bacterial sequence entries, part 171.
284. gbbct172.seq - Bacterial sequence entries, part 172.
285. gbbct173.seq - Bacterial sequence entries, part 173.
286. gbbct174.seq - Bacterial sequence entries, part 174.
287. gbbct175.seq - Bacterial sequence entries, part 175.
288. gbbct176.seq - Bacterial sequence entries, part 176.
289. gbbct177.seq - Bacterial sequence entries, part 177.
290. gbbct178.seq - Bacterial sequence entries, part 178.
291. gbbct179.seq - Bacterial sequence entries, part 179.
292. gbbct18.seq - Bacterial sequence entries, part 18.
293. gbbct180.seq - Bacterial sequence entries, part 180.
294. gbbct181.seq - Bacterial sequence entries, part 181.
295. gbbct182.seq - Bacterial sequence entries, part 182.
296. gbbct183.seq - Bacterial sequence entries, part 183.
297. gbbct184.seq - Bacterial sequence entries, part 184.
298. gbbct185.seq - Bacterial sequence entries, part 185.
299. gbbct186.seq - Bacterial sequence entries, part 186.
300. gbbct187.seq - Bacterial sequence entries, part 187.
301. gbbct188.seq - Bacterial sequence entries, part 188.
302. gbbct189.seq - Bacterial sequence entries, part 189.
303. gbbct19.seq - Bacterial sequence entries, part 19.
304. gbbct190.seq - Bacterial sequence entries, part 190.
305. gbbct191.seq - Bacterial sequence entries, part 191.
306. gbbct192.seq - Bacterial sequence entries, part 192.
307. gbbct193.seq - Bacterial sequence entries, part 193.
308. gbbct194.seq - Bacterial sequence entries, part 194.
309. gbbct195.seq - Bacterial sequence entries, part 195.
310. gbbct196.seq - Bacterial sequence entries, part 196.
311. gbbct197.seq - Bacterial sequence entries, part 197.
312. gbbct198.seq - Bacterial sequence entries, part 198.
313. gbbct199.seq - Bacterial sequence entries, part 199.
314. gbbct2.seq - Bacterial sequence entries, part 2.
315. gbbct20.seq - Bacterial sequence entries, part 20.
316. gbbct200.seq - Bacterial sequence entries, part 200.
317. gbbct201.seq - Bacterial sequence entries, part 201.
318. gbbct202.seq - Bacterial sequence entries, part 202.
319. gbbct203.seq - Bacterial sequence entries, part 203.
320. gbbct204.seq - Bacterial sequence entries, part 204.
321. gbbct205.seq - Bacterial sequence entries, part 205.
322. gbbct206.seq - Bacterial sequence entries, part 206.
323. gbbct207.seq - Bacterial sequence entries, part 207.
324. gbbct208.seq - Bacterial sequence entries, part 208.
325. gbbct209.seq - Bacterial sequence entries, part 209.
326. gbbct21.seq - Bacterial sequence entries, part 21.
327. gbbct210.seq - Bacterial sequence entries, part 210.
328. gbbct211.seq - Bacterial sequence entries, part 211.
329. gbbct212.seq - Bacterial sequence entries, part 212.
330. gbbct213.seq - Bacterial sequence entries, part 213.
331. gbbct214.seq - Bacterial sequence entries, part 214.
332. gbbct215.seq - Bacterial sequence entries, part 215.
333. gbbct216.seq - Bacterial sequence entries, part 216.
334. gbbct217.seq - Bacterial sequence entries, part 217.
335. gbbct218.seq - Bacterial sequence entries, part 218.
336. gbbct219.seq - Bacterial sequence entries, part 219.
337. gbbct22.seq - Bacterial sequence entries, part 22.
338. gbbct220.seq - Bacterial sequence entries, part 220.
339. gbbct221.seq - Bacterial sequence entries, part 221.
340. gbbct222.seq - Bacterial sequence entries, part 222.
341. gbbct223.seq - Bacterial sequence entries, part 223.
342. gbbct224.seq - Bacterial sequence entries, part 224.
343. gbbct225.seq - Bacterial sequence entries, part 225.
344. gbbct226.seq - Bacterial sequence entries, part 226.
345. gbbct227.seq - Bacterial sequence entries, part 227.
346. gbbct228.seq - Bacterial sequence entries, part 228.
347. gbbct229.seq - Bacterial sequence entries, part 229.
348. gbbct23.seq - Bacterial sequence entries, part 23.
349. gbbct230.seq - Bacterial sequence entries, part 230.
350. gbbct231.seq - Bacterial sequence entries, part 231.
351. gbbct232.seq - Bacterial sequence entries, part 232.
352. gbbct233.seq - Bacterial sequence entries, part 233.
353. gbbct234.seq - Bacterial sequence entries, part 234.
354. gbbct235.seq - Bacterial sequence entries, part 235.
355. gbbct236.seq - Bacterial sequence entries, part 236.
356. gbbct237.seq - Bacterial sequence entries, part 237.
357. gbbct238.seq - Bacterial sequence entries, part 238.
358. gbbct239.seq - Bacterial sequence entries, part 239.
359. gbbct24.seq - Bacterial sequence entries, part 24.
360. gbbct240.seq - Bacterial sequence entries, part 240.
361. gbbct241.seq - Bacterial sequence entries, part 241.
362. gbbct242.seq - Bacterial sequence entries, part 242.
363. gbbct243.seq - Bacterial sequence entries, part 243.
364. gbbct244.seq - Bacterial sequence entries, part 244.
365. gbbct245.seq - Bacterial sequence entries, part 245.
366. gbbct246.seq - Bacterial sequence entries, part 246.
367. gbbct247.seq - Bacterial sequence entries, part 247.
368. gbbct248.seq - Bacterial sequence entries, part 248.
369. gbbct249.seq - Bacterial sequence entries, part 249.
370. gbbct25.seq - Bacterial sequence entries, part 25.
371. gbbct250.seq - Bacterial sequence entries, part 250.
372. gbbct251.seq - Bacterial sequence entries, part 251.
373. gbbct252.seq - Bacterial sequence entries, part 252.
374. gbbct253.seq - Bacterial sequence entries, part 253.
375. gbbct254.seq - Bacterial sequence entries, part 254.
376. gbbct255.seq - Bacterial sequence entries, part 255.
377. gbbct256.seq - Bacterial sequence entries, part 256.
378. gbbct257.seq - Bacterial sequence entries, part 257.
379. gbbct258.seq - Bacterial sequence entries, part 258.
380. gbbct259.seq - Bacterial sequence entries, part 259.
381. gbbct26.seq - Bacterial sequence entries, part 26.
382. gbbct260.seq - Bacterial sequence entries, part 260.
383. gbbct261.seq - Bacterial sequence entries, part 261.
384. gbbct262.seq - Bacterial sequence entries, part 262.
385. gbbct263.seq - Bacterial sequence entries, part 263.
386. gbbct264.seq - Bacterial sequence entries, part 264.
387. gbbct265.seq - Bacterial sequence entries, part 265.
388. gbbct266.seq - Bacterial sequence entries, part 266.
389. gbbct267.seq - Bacterial sequence entries, part 267.
390. gbbct268.seq - Bacterial sequence entries, part 268.
391. gbbct269.seq - Bacterial sequence entries, part 269.
392. gbbct27.seq - Bacterial sequence entries, part 27.
393. gbbct270.seq - Bacterial sequence entries, part 270.
394. gbbct271.seq - Bacterial sequence entries, part 271.
395. gbbct272.seq - Bacterial sequence entries, part 272.
396. gbbct273.seq - Bacterial sequence entries, part 273.
397. gbbct274.seq - Bacterial sequence entries, part 274.
398. gbbct275.seq - Bacterial sequence entries, part 275.
399. gbbct276.seq - Bacterial sequence entries, part 276.
400. gbbct277.seq - Bacterial sequence entries, part 277.
401. gbbct278.seq - Bacterial sequence entries, part 278.
402. gbbct279.seq - Bacterial sequence entries, part 279.
403. gbbct28.seq - Bacterial sequence entries, part 28.
404. gbbct280.seq - Bacterial sequence entries, part 280.
405. gbbct281.seq - Bacterial sequence entries, part 281.
406. gbbct282.seq - Bacterial sequence entries, part 282.
407. gbbct283.seq - Bacterial sequence entries, part 283.
408. gbbct284.seq - Bacterial sequence entries, part 284.
409. gbbct285.seq - Bacterial sequence entries, part 285.
410. gbbct286.seq - Bacterial sequence entries, part 286.
411. gbbct287.seq - Bacterial sequence entries, part 287.
412. gbbct288.seq - Bacterial sequence entries, part 288.
413. gbbct289.seq - Bacterial sequence entries, part 289.
414. gbbct29.seq - Bacterial sequence entries, part 29.
415. gbbct290.seq - Bacterial sequence entries, part 290.
416. gbbct291.seq - Bacterial sequence entries, part 291.
417. gbbct292.seq - Bacterial sequence entries, part 292.
418. gbbct293.seq - Bacterial sequence entries, part 293.
419. gbbct294.seq - Bacterial sequence entries, part 294.
420. gbbct295.seq - Bacterial sequence entries, part 295.
421. gbbct296.seq - Bacterial sequence entries, part 296.
422. gbbct297.seq - Bacterial sequence entries, part 297.
423. gbbct298.seq - Bacterial sequence entries, part 298.
424. gbbct299.seq - Bacterial sequence entries, part 299.
425. gbbct3.seq - Bacterial sequence entries, part 3.
426. gbbct30.seq - Bacterial sequence entries, part 30.
427. gbbct300.seq - Bacterial sequence entries, part 300.
428. gbbct301.seq - Bacterial sequence entries, part 301.
429. gbbct302.seq - Bacterial sequence entries, part 302.
430. gbbct303.seq - Bacterial sequence entries, part 303.
431. gbbct304.seq - Bacterial sequence entries, part 304.
432. gbbct305.seq - Bacterial sequence entries, part 305.
433. gbbct306.seq - Bacterial sequence entries, part 306.
434. gbbct307.seq - Bacterial sequence entries, part 307.
435. gbbct308.seq - Bacterial sequence entries, part 308.
436. gbbct309.seq - Bacterial sequence entries, part 309.
437. gbbct31.seq - Bacterial sequence entries, part 31.
438. gbbct310.seq - Bacterial sequence entries, part 310.
439. gbbct311.seq - Bacterial sequence entries, part 311.
440. gbbct312.seq - Bacterial sequence entries, part 312.
441. gbbct313.seq - Bacterial sequence entries, part 313.
442. gbbct314.seq - Bacterial sequence entries, part 314.
443. gbbct315.seq - Bacterial sequence entries, part 315.
444. gbbct316.seq - Bacterial sequence entries, part 316.
445. gbbct317.seq - Bacterial sequence entries, part 317.
446. gbbct318.seq - Bacterial sequence entries, part 318.
447. gbbct319.seq - Bacterial sequence entries, part 319.
448. gbbct32.seq - Bacterial sequence entries, part 32.
449. gbbct320.seq - Bacterial sequence entries, part 320.
450. gbbct321.seq - Bacterial sequence entries, part 321.
451. gbbct322.seq - Bacterial sequence entries, part 322.
452. gbbct323.seq - Bacterial sequence entries, part 323.
453. gbbct324.seq - Bacterial sequence entries, part 324.
454. gbbct325.seq - Bacterial sequence entries, part 325.
455. gbbct326.seq - Bacterial sequence entries, part 326.
456. gbbct327.seq - Bacterial sequence entries, part 327.
457. gbbct328.seq - Bacterial sequence entries, part 328.
458. gbbct329.seq - Bacterial sequence entries, part 329.
459. gbbct33.seq - Bacterial sequence entries, part 33.
460. gbbct330.seq - Bacterial sequence entries, part 330.
461. gbbct331.seq - Bacterial sequence entries, part 331.
462. gbbct332.seq - Bacterial sequence entries, part 332.
463. gbbct333.seq - Bacterial sequence entries, part 333.
464. gbbct334.seq - Bacterial sequence entries, part 334.
465. gbbct335.seq - Bacterial sequence entries, part 335.
466. gbbct336.seq - Bacterial sequence entries, part 336.
467. gbbct337.seq - Bacterial sequence entries, part 337.
468. gbbct338.seq - Bacterial sequence entries, part 338.
469. gbbct339.seq - Bacterial sequence entries, part 339.
470. gbbct34.seq - Bacterial sequence entries, part 34.
471. gbbct340.seq - Bacterial sequence entries, part 340.
472. gbbct341.seq - Bacterial sequence entries, part 341.
473. gbbct342.seq - Bacterial sequence entries, part 342.
474. gbbct343.seq - Bacterial sequence entries, part 343.
475. gbbct344.seq - Bacterial sequence entries, part 344.
476. gbbct345.seq - Bacterial sequence entries, part 345.
477. gbbct346.seq - Bacterial sequence entries, part 346.
478. gbbct347.seq - Bacterial sequence entries, part 347.
479. gbbct348.seq - Bacterial sequence entries, part 348.
480. gbbct349.seq - Bacterial sequence entries, part 349.
481. gbbct35.seq - Bacterial sequence entries, part 35.
482. gbbct350.seq - Bacterial sequence entries, part 350.
483. gbbct351.seq - Bacterial sequence entries, part 351.
484. gbbct352.seq - Bacterial sequence entries, part 352.
485. gbbct353.seq - Bacterial sequence entries, part 353.
486. gbbct354.seq - Bacterial sequence entries, part 354.
487. gbbct355.seq - Bacterial sequence entries, part 355.
488. gbbct356.seq - Bacterial sequence entries, part 356.
489. gbbct357.seq - Bacterial sequence entries, part 357.
490. gbbct358.seq - Bacterial sequence entries, part 358.
491. gbbct359.seq - Bacterial sequence entries, part 359.
492. gbbct36.seq - Bacterial sequence entries, part 36.
493. gbbct360.seq - Bacterial sequence entries, part 360.
494. gbbct361.seq - Bacterial sequence entries, part 361.
495. gbbct362.seq - Bacterial sequence entries, part 362.
496. gbbct363.seq - Bacterial sequence entries, part 363.
497. gbbct364.seq - Bacterial sequence entries, part 364.
498. gbbct365.seq - Bacterial sequence entries, part 365.
499. gbbct366.seq - Bacterial sequence entries, part 366.
500. gbbct367.seq - Bacterial sequence entries, part 367.
501. gbbct368.seq - Bacterial sequence entries, part 368.
502. gbbct369.seq - Bacterial sequence entries, part 369.
503. gbbct37.seq - Bacterial sequence entries, part 37.
504. gbbct370.seq - Bacterial sequence entries, part 370.
505. gbbct371.seq - Bacterial sequence entries, part 371.
506. gbbct372.seq - Bacterial sequence entries, part 372.
507. gbbct373.seq - Bacterial sequence entries, part 373.
508. gbbct374.seq - Bacterial sequence entries, part 374.
509. gbbct375.seq - Bacterial sequence entries, part 375.
510. gbbct376.seq - Bacterial sequence entries, part 376.
511. gbbct377.seq - Bacterial sequence entries, part 377.
512. gbbct378.seq - Bacterial sequence entries, part 378.
513. gbbct379.seq - Bacterial sequence entries, part 379.
514. gbbct38.seq - Bacterial sequence entries, part 38.
515. gbbct380.seq - Bacterial sequence entries, part 380.
516. gbbct381.seq - Bacterial sequence entries, part 381.
517. gbbct382.seq - Bacterial sequence entries, part 382.
518. gbbct383.seq - Bacterial sequence entries, part 383.
519. gbbct384.seq - Bacterial sequence entries, part 384.
520. gbbct385.seq - Bacterial sequence entries, part 385.
521. gbbct386.seq - Bacterial sequence entries, part 386.
522. gbbct387.seq - Bacterial sequence entries, part 387.
523. gbbct388.seq - Bacterial sequence entries, part 388.
524. gbbct389.seq - Bacterial sequence entries, part 389.
525. gbbct39.seq - Bacterial sequence entries, part 39.
526. gbbct390.seq - Bacterial sequence entries, part 390.
527. gbbct391.seq - Bacterial sequence entries, part 391.
528. gbbct392.seq - Bacterial sequence entries, part 392.
529. gbbct393.seq - Bacterial sequence entries, part 393.
530. gbbct394.seq - Bacterial sequence entries, part 394.
531. gbbct395.seq - Bacterial sequence entries, part 395.
532. gbbct396.seq - Bacterial sequence entries, part 396.
533. gbbct397.seq - Bacterial sequence entries, part 397.
534. gbbct398.seq - Bacterial sequence entries, part 398.
535. gbbct399.seq - Bacterial sequence entries, part 399.
536. gbbct4.seq - Bacterial sequence entries, part 4.
537. gbbct40.seq - Bacterial sequence entries, part 40.
538. gbbct400.seq - Bacterial sequence entries, part 400.
539. gbbct401.seq - Bacterial sequence entries, part 401.
540. gbbct402.seq - Bacterial sequence entries, part 402.
541. gbbct403.seq - Bacterial sequence entries, part 403.
542. gbbct404.seq - Bacterial sequence entries, part 404.
543. gbbct405.seq - Bacterial sequence entries, part 405.
544. gbbct406.seq - Bacterial sequence entries, part 406.
545. gbbct407.seq - Bacterial sequence entries, part 407.
546. gbbct408.seq - Bacterial sequence entries, part 408.
547. gbbct409.seq - Bacterial sequence entries, part 409.
548. gbbct41.seq - Bacterial sequence entries, part 41.
549. gbbct410.seq - Bacterial sequence entries, part 410.
550. gbbct411.seq - Bacterial sequence entries, part 411.
551. gbbct412.seq - Bacterial sequence entries, part 412.
552. gbbct413.seq - Bacterial sequence entries, part 413.
553. gbbct414.seq - Bacterial sequence entries, part 414.
554. gbbct415.seq - Bacterial sequence entries, part 415.
555. gbbct416.seq - Bacterial sequence entries, part 416.
556. gbbct417.seq - Bacterial sequence entries, part 417.
557. gbbct418.seq - Bacterial sequence entries, part 418.
558. gbbct419.seq - Bacterial sequence entries, part 419.
559. gbbct42.seq - Bacterial sequence entries, part 42.
560. gbbct420.seq - Bacterial sequence entries, part 420.
561. gbbct421.seq - Bacterial sequence entries, part 421.
562. gbbct422.seq - Bacterial sequence entries, part 422.
563. gbbct423.seq - Bacterial sequence entries, part 423.
564. gbbct424.seq - Bacterial sequence entries, part 424.
565. gbbct425.seq - Bacterial sequence entries, part 425.
566. gbbct426.seq - Bacterial sequence entries, part 426.
567. gbbct427.seq - Bacterial sequence entries, part 427.
568. gbbct428.seq - Bacterial sequence entries, part 428.
569. gbbct429.seq - Bacterial sequence entries, part 429.
570. gbbct43.seq - Bacterial sequence entries, part 43.
571. gbbct430.seq - Bacterial sequence entries, part 430.
572. gbbct431.seq - Bacterial sequence entries, part 431.
573. gbbct432.seq - Bacterial sequence entries, part 432.
574. gbbct433.seq - Bacterial sequence entries, part 433.
575. gbbct434.seq - Bacterial sequence entries, part 434.
576. gbbct435.seq - Bacterial sequence entries, part 435.
577. gbbct436.seq - Bacterial sequence entries, part 436.
578. gbbct437.seq - Bacterial sequence entries, part 437.
579. gbbct438.seq - Bacterial sequence entries, part 438.
580. gbbct439.seq - Bacterial sequence entries, part 439.
581. gbbct44.seq - Bacterial sequence entries, part 44.
582. gbbct440.seq - Bacterial sequence entries, part 440.
583. gbbct441.seq - Bacterial sequence entries, part 441.
584. gbbct442.seq - Bacterial sequence entries, part 442.
585. gbbct443.seq - Bacterial sequence entries, part 443.
586. gbbct444.seq - Bacterial sequence entries, part 444.
587. gbbct445.seq - Bacterial sequence entries, part 445.
588. gbbct446.seq - Bacterial sequence entries, part 446.
589. gbbct447.seq - Bacterial sequence entries, part 447.
590. gbbct448.seq - Bacterial sequence entries, part 448.
591. gbbct449.seq - Bacterial sequence entries, part 449.
592. gbbct45.seq - Bacterial sequence entries, part 45.
593. gbbct450.seq - Bacterial sequence entries, part 450.
594. gbbct451.seq - Bacterial sequence entries, part 451.
595. gbbct452.seq - Bacterial sequence entries, part 452.
596. gbbct453.seq - Bacterial sequence entries, part 453.
597. gbbct454.seq - Bacterial sequence entries, part 454.
598. gbbct455.seq - Bacterial sequence entries, part 455.
599. gbbct456.seq - Bacterial sequence entries, part 456.
600. gbbct457.seq - Bacterial sequence entries, part 457.
601. gbbct458.seq - Bacterial sequence entries, part 458.
602. gbbct459.seq - Bacterial sequence entries, part 459.
603. gbbct46.seq - Bacterial sequence entries, part 46.
604. gbbct460.seq - Bacterial sequence entries, part 460.
605. gbbct461.seq - Bacterial sequence entries, part 461.
606. gbbct462.seq - Bacterial sequence entries, part 462.
607. gbbct463.seq - Bacterial sequence entries, part 463.
608. gbbct464.seq - Bacterial sequence entries, part 464.
609. gbbct465.seq - Bacterial sequence entries, part 465.
610. gbbct466.seq - Bacterial sequence entries, part 466.
611. gbbct467.seq - Bacterial sequence entries, part 467.
612. gbbct468.seq - Bacterial sequence entries, part 468.
613. gbbct469.seq - Bacterial sequence entries, part 469.
614. gbbct47.seq - Bacterial sequence entries, part 47.
615. gbbct470.seq - Bacterial sequence entries, part 470.
616. gbbct471.seq - Bacterial sequence entries, part 471.
617. gbbct472.seq - Bacterial sequence entries, part 472.
618. gbbct473.seq - Bacterial sequence entries, part 473.
619. gbbct474.seq - Bacterial sequence entries, part 474.
620. gbbct475.seq - Bacterial sequence entries, part 475.
621. gbbct476.seq - Bacterial sequence entries, part 476.
622. gbbct477.seq - Bacterial sequence entries, part 477.
623. gbbct478.seq - Bacterial sequence entries, part 478.
624. gbbct479.seq - Bacterial sequence entries, part 479.
625. gbbct48.seq - Bacterial sequence entries, part 48.
626. gbbct480.seq - Bacterial sequence entries, part 480.
627. gbbct481.seq - Bacterial sequence entries, part 481.
628. gbbct482.seq - Bacterial sequence entries, part 482.
629. gbbct483.seq - Bacterial sequence entries, part 483.
630. gbbct484.seq - Bacterial sequence entries, part 484.
631. gbbct485.seq - Bacterial sequence entries, part 485.
632. gbbct486.seq - Bacterial sequence entries, part 486.
633. gbbct487.seq - Bacterial sequence entries, part 487.
634. gbbct488.seq - Bacterial sequence entries, part 488.
635. gbbct489.seq - Bacterial sequence entries, part 489.
636. gbbct49.seq - Bacterial sequence entries, part 49.
637. gbbct490.seq - Bacterial sequence entries, part 490.
638. gbbct491.seq - Bacterial sequence entries, part 491.
639. gbbct492.seq - Bacterial sequence entries, part 492.
640. gbbct493.seq - Bacterial sequence entries, part 493.
641. gbbct494.seq - Bacterial sequence entries, part 494.
642. gbbct495.seq - Bacterial sequence entries, part 495.
643. gbbct496.seq - Bacterial sequence entries, part 496.
644. gbbct497.seq - Bacterial sequence entries, part 497.
645. gbbct498.seq - Bacterial sequence entries, part 498.
646. gbbct499.seq - Bacterial sequence entries, part 499.
647. gbbct5.seq - Bacterial sequence entries, part 5.
648. gbbct50.seq - Bacterial sequence entries, part 50.
649. gbbct500.seq - Bacterial sequence entries, part 500.
650. gbbct501.seq - Bacterial sequence entries, part 501.
651. gbbct502.seq - Bacterial sequence entries, part 502.
652. gbbct503.seq - Bacterial sequence entries, part 503.
653. gbbct504.seq - Bacterial sequence entries, part 504.
654. gbbct505.seq - Bacterial sequence entries, part 505.
655. gbbct506.seq - Bacterial sequence entries, part 506.
656. gbbct507.seq - Bacterial sequence entries, part 507.
657. gbbct508.seq - Bacterial sequence entries, part 508.
658. gbbct509.seq - Bacterial sequence entries, part 509.
659. gbbct51.seq - Bacterial sequence entries, part 51.
660. gbbct510.seq - Bacterial sequence entries, part 510.
661. gbbct511.seq - Bacterial sequence entries, part 511.
662. gbbct512.seq - Bacterial sequence entries, part 512.
663. gbbct513.seq - Bacterial sequence entries, part 513.
664. gbbct514.seq - Bacterial sequence entries, part 514.
665. gbbct515.seq - Bacterial sequence entries, part 515.
666. gbbct516.seq - Bacterial sequence entries, part 516.
667. gbbct517.seq - Bacterial sequence entries, part 517.
668. gbbct518.seq - Bacterial sequence entries, part 518.
669. gbbct519.seq - Bacterial sequence entries, part 519.
670. gbbct52.seq - Bacterial sequence entries, part 52.
671. gbbct520.seq - Bacterial sequence entries, part 520.
672. gbbct521.seq - Bacterial sequence entries, part 521.
673. gbbct522.seq - Bacterial sequence entries, part 522.
674. gbbct523.seq - Bacterial sequence entries, part 523.
675. gbbct524.seq - Bacterial sequence entries, part 524.
676. gbbct525.seq - Bacterial sequence entries, part 525.
677. gbbct526.seq - Bacterial sequence entries, part 526.
678. gbbct527.seq - Bacterial sequence entries, part 527.
679. gbbct528.seq - Bacterial sequence entries, part 528.
680. gbbct529.seq - Bacterial sequence entries, part 529.
681. gbbct53.seq - Bacterial sequence entries, part 53.
682. gbbct530.seq - Bacterial sequence entries, part 530.
683. gbbct531.seq - Bacterial sequence entries, part 531.
684. gbbct532.seq - Bacterial sequence entries, part 532.
685. gbbct533.seq - Bacterial sequence entries, part 533.
686. gbbct534.seq - Bacterial sequence entries, part 534.
687. gbbct535.seq - Bacterial sequence entries, part 535.
688. gbbct536.seq - Bacterial sequence entries, part 536.
689. gbbct537.seq - Bacterial sequence entries, part 537.
690. gbbct538.seq - Bacterial sequence entries, part 538.
691. gbbct539.seq - Bacterial sequence entries, part 539.
692. gbbct54.seq - Bacterial sequence entries, part 54.
693. gbbct540.seq - Bacterial sequence entries, part 540.
694. gbbct541.seq - Bacterial sequence entries, part 541.
695. gbbct542.seq - Bacterial sequence entries, part 542.
696. gbbct543.seq - Bacterial sequence entries, part 543.
697. gbbct544.seq - Bacterial sequence entries, part 544.
698. gbbct545.seq - Bacterial sequence entries, part 545.
699. gbbct546.seq - Bacterial sequence entries, part 546.
700. gbbct547.seq - Bacterial sequence entries, part 547.
701. gbbct548.seq - Bacterial sequence entries, part 548.
702. gbbct549.seq - Bacterial sequence entries, part 549.
703. gbbct55.seq - Bacterial sequence entries, part 55.
704. gbbct550.seq - Bacterial sequence entries, part 550.
705. gbbct551.seq - Bacterial sequence entries, part 551.
706. gbbct552.seq - Bacterial sequence entries, part 552.
707. gbbct553.seq - Bacterial sequence entries, part 553.
708. gbbct554.seq - Bacterial sequence entries, part 554.
709. gbbct555.seq - Bacterial sequence entries, part 555.
710. gbbct556.seq - Bacterial sequence entries, part 556.
711. gbbct557.seq - Bacterial sequence entries, part 557.
712. gbbct558.seq - Bacterial sequence entries, part 558.
713. gbbct559.seq - Bacterial sequence entries, part 559.
714. gbbct56.seq - Bacterial sequence entries, part 56.
715. gbbct560.seq - Bacterial sequence entries, part 560.
716. gbbct561.seq - Bacterial sequence entries, part 561.
717. gbbct562.seq - Bacterial sequence entries, part 562.
718. gbbct563.seq - Bacterial sequence entries, part 563.
719. gbbct564.seq - Bacterial sequence entries, part 564.
720. gbbct565.seq - Bacterial sequence entries, part 565.
721. gbbct566.seq - Bacterial sequence entries, part 566.
722. gbbct567.seq - Bacterial sequence entries, part 567.
723. gbbct568.seq - Bacterial sequence entries, part 568.
724. gbbct569.seq - Bacterial sequence entries, part 569.
725. gbbct57.seq - Bacterial sequence entries, part 57.
726. gbbct570.seq - Bacterial sequence entries, part 570.
727. gbbct571.seq - Bacterial sequence entries, part 571.
728. gbbct572.seq - Bacterial sequence entries, part 572.
729. gbbct573.seq - Bacterial sequence entries, part 573.
730. gbbct574.seq - Bacterial sequence entries, part 574.
731. gbbct575.seq - Bacterial sequence entries, part 575.
732. gbbct576.seq - Bacterial sequence entries, part 576.
733. gbbct577.seq - Bacterial sequence entries, part 577.
734. gbbct578.seq - Bacterial sequence entries, part 578.
735. gbbct579.seq - Bacterial sequence entries, part 579.
736. gbbct58.seq - Bacterial sequence entries, part 58.
737. gbbct580.seq - Bacterial sequence entries, part 580.
738. gbbct581.seq - Bacterial sequence entries, part 581.
739. gbbct582.seq - Bacterial sequence entries, part 582.
740. gbbct583.seq - Bacterial sequence entries, part 583.
741. gbbct584.seq - Bacterial sequence entries, part 584.
742. gbbct585.seq - Bacterial sequence entries, part 585.
743. gbbct586.seq - Bacterial sequence entries, part 586.
744. gbbct587.seq - Bacterial sequence entries, part 587.
745. gbbct588.seq - Bacterial sequence entries, part 588.
746. gbbct589.seq - Bacterial sequence entries, part 589.
747. gbbct59.seq - Bacterial sequence entries, part 59.
748. gbbct590.seq - Bacterial sequence entries, part 590.
749. gbbct591.seq - Bacterial sequence entries, part 591.
750. gbbct592.seq - Bacterial sequence entries, part 592.
751. gbbct593.seq - Bacterial sequence entries, part 593.
752. gbbct594.seq - Bacterial sequence entries, part 594.
753. gbbct595.seq - Bacterial sequence entries, part 595.
754. gbbct596.seq - Bacterial sequence entries, part 596.
755. gbbct597.seq - Bacterial sequence entries, part 597.
756. gbbct598.seq - Bacterial sequence entries, part 598.
757. gbbct599.seq - Bacterial sequence entries, part 599.
758. gbbct6.seq - Bacterial sequence entries, part 6.
759. gbbct60.seq - Bacterial sequence entries, part 60.
760. gbbct600.seq - Bacterial sequence entries, part 600.
761. gbbct601.seq - Bacterial sequence entries, part 601.
762. gbbct602.seq - Bacterial sequence entries, part 602.
763. gbbct603.seq - Bacterial sequence entries, part 603.
764. gbbct604.seq - Bacterial sequence entries, part 604.
765. gbbct605.seq - Bacterial sequence entries, part 605.
766. gbbct606.seq - Bacterial sequence entries, part 606.
767. gbbct607.seq - Bacterial sequence entries, part 607.
768. gbbct608.seq - Bacterial sequence entries, part 608.
769. gbbct609.seq - Bacterial sequence entries, part 609.
770. gbbct61.seq - Bacterial sequence entries, part 61.
771. gbbct610.seq - Bacterial sequence entries, part 610.
772. gbbct611.seq - Bacterial sequence entries, part 611.
773. gbbct612.seq - Bacterial sequence entries, part 612.
774. gbbct613.seq - Bacterial sequence entries, part 613.
775. gbbct614.seq - Bacterial sequence entries, part 614.
776. gbbct615.seq - Bacterial sequence entries, part 615.
777. gbbct616.seq - Bacterial sequence entries, part 616.
778. gbbct617.seq - Bacterial sequence entries, part 617.
779. gbbct618.seq - Bacterial sequence entries, part 618.
780. gbbct619.seq - Bacterial sequence entries, part 619.
781. gbbct62.seq - Bacterial sequence entries, part 62.
782. gbbct620.seq - Bacterial sequence entries, part 620.
783. gbbct621.seq - Bacterial sequence entries, part 621.
784. gbbct622.seq - Bacterial sequence entries, part 622.
785. gbbct623.seq - Bacterial sequence entries, part 623.
786. gbbct624.seq - Bacterial sequence entries, part 624.
787. gbbct625.seq - Bacterial sequence entries, part 625.
788. gbbct626.seq - Bacterial sequence entries, part 626.
789. gbbct627.seq - Bacterial sequence entries, part 627.
790. gbbct628.seq - Bacterial sequence entries, part 628.
791. gbbct629.seq - Bacterial sequence entries, part 629.
792. gbbct63.seq - Bacterial sequence entries, part 63.
793. gbbct630.seq - Bacterial sequence entries, part 630.
794. gbbct631.seq - Bacterial sequence entries, part 631.
795. gbbct632.seq - Bacterial sequence entries, part 632.
796. gbbct633.seq - Bacterial sequence entries, part 633.
797. gbbct634.seq - Bacterial sequence entries, part 634.
798. gbbct635.seq - Bacterial sequence entries, part 635.
799. gbbct636.seq - Bacterial sequence entries, part 636.
800. gbbct637.seq - Bacterial sequence entries, part 637.
801. gbbct638.seq - Bacterial sequence entries, part 638.
802. gbbct639.seq - Bacterial sequence entries, part 639.
803. gbbct64.seq - Bacterial sequence entries, part 64.
804. gbbct640.seq - Bacterial sequence entries, part 640.
805. gbbct641.seq - Bacterial sequence entries, part 641.
806. gbbct642.seq - Bacterial sequence entries, part 642.
807. gbbct643.seq - Bacterial sequence entries, part 643.
808. gbbct644.seq - Bacterial sequence entries, part 644.
809. gbbct645.seq - Bacterial sequence entries, part 645.
810. gbbct646.seq - Bacterial sequence entries, part 646.
811. gbbct647.seq - Bacterial sequence entries, part 647.
812. gbbct648.seq - Bacterial sequence entries, part 648.
813. gbbct649.seq - Bacterial sequence entries, part 649.
814. gbbct65.seq - Bacterial sequence entries, part 65.
815. gbbct650.seq - Bacterial sequence entries, part 650.
816. gbbct651.seq - Bacterial sequence entries, part 651.
817. gbbct652.seq - Bacterial sequence entries, part 652.
818. gbbct653.seq - Bacterial sequence entries, part 653.
819. gbbct654.seq - Bacterial sequence entries, part 654.
820. gbbct655.seq - Bacterial sequence entries, part 655.
821. gbbct656.seq - Bacterial sequence entries, part 656.
822. gbbct657.seq - Bacterial sequence entries, part 657.
823. gbbct658.seq - Bacterial sequence entries, part 658.
824. gbbct659.seq - Bacterial sequence entries, part 659.
825. gbbct66.seq - Bacterial sequence entries, part 66.
826. gbbct660.seq - Bacterial sequence entries, part 660.
827. gbbct661.seq - Bacterial sequence entries, part 661.
828. gbbct662.seq - Bacterial sequence entries, part 662.
829. gbbct663.seq - Bacterial sequence entries, part 663.
830. gbbct664.seq - Bacterial sequence entries, part 664.
831. gbbct665.seq - Bacterial sequence entries, part 665.
832. gbbct666.seq - Bacterial sequence entries, part 666.
833. gbbct667.seq - Bacterial sequence entries, part 667.
834. gbbct668.seq - Bacterial sequence entries, part 668.
835. gbbct669.seq - Bacterial sequence entries, part 669.
836. gbbct67.seq - Bacterial sequence entries, part 67.
837. gbbct670.seq - Bacterial sequence entries, part 670.
838. gbbct671.seq - Bacterial sequence entries, part 671.
839. gbbct672.seq - Bacterial sequence entries, part 672.
840. gbbct673.seq - Bacterial sequence entries, part 673.
841. gbbct674.seq - Bacterial sequence entries, part 674.
842. gbbct675.seq - Bacterial sequence entries, part 675.
843. gbbct676.seq - Bacterial sequence entries, part 676.
844. gbbct677.seq - Bacterial sequence entries, part 677.
845. gbbct678.seq - Bacterial sequence entries, part 678.
846. gbbct679.seq - Bacterial sequence entries, part 679.
847. gbbct68.seq - Bacterial sequence entries, part 68.
848. gbbct680.seq - Bacterial sequence entries, part 680.
849. gbbct681.seq - Bacterial sequence entries, part 681.
850. gbbct682.seq - Bacterial sequence entries, part 682.
851. gbbct683.seq - Bacterial sequence entries, part 683.
852. gbbct684.seq - Bacterial sequence entries, part 684.
853. gbbct685.seq - Bacterial sequence entries, part 685.
854. gbbct686.seq - Bacterial sequence entries, part 686.
855. gbbct687.seq - Bacterial sequence entries, part 687.
856. gbbct688.seq - Bacterial sequence entries, part 688.
857. gbbct689.seq - Bacterial sequence entries, part 689.
858. gbbct69.seq - Bacterial sequence entries, part 69.
859. gbbct690.seq - Bacterial sequence entries, part 690.
860. gbbct691.seq - Bacterial sequence entries, part 691.
861. gbbct692.seq - Bacterial sequence entries, part 692.
862. gbbct693.seq - Bacterial sequence entries, part 693.
863. gbbct694.seq - Bacterial sequence entries, part 694.
864. gbbct695.seq - Bacterial sequence entries, part 695.
865. gbbct696.seq - Bacterial sequence entries, part 696.
866. gbbct697.seq - Bacterial sequence entries, part 697.
867. gbbct698.seq - Bacterial sequence entries, part 698.
868. gbbct699.seq - Bacterial sequence entries, part 699.
869. gbbct7.seq - Bacterial sequence entries, part 7.
870. gbbct70.seq - Bacterial sequence entries, part 70.
871. gbbct700.seq - Bacterial sequence entries, part 700.
872. gbbct701.seq - Bacterial sequence entries, part 701.
873. gbbct702.seq - Bacterial sequence entries, part 702.
874. gbbct703.seq - Bacterial sequence entries, part 703.
875. gbbct704.seq - Bacterial sequence entries, part 704.
876. gbbct705.seq - Bacterial sequence entries, part 705.
877. gbbct706.seq - Bacterial sequence entries, part 706.
878. gbbct707.seq - Bacterial sequence entries, part 707.
879. gbbct708.seq - Bacterial sequence entries, part 708.
880. gbbct709.seq - Bacterial sequence entries, part 709.
881. gbbct71.seq - Bacterial sequence entries, part 71.
882. gbbct710.seq - Bacterial sequence entries, part 710.
883. gbbct711.seq - Bacterial sequence entries, part 711.
884. gbbct712.seq - Bacterial sequence entries, part 712.
885. gbbct713.seq - Bacterial sequence entries, part 713.
886. gbbct714.seq - Bacterial sequence entries, part 714.
887. gbbct715.seq - Bacterial sequence entries, part 715.
888. gbbct716.seq - Bacterial sequence entries, part 716.
889. gbbct717.seq - Bacterial sequence entries, part 717.
890. gbbct718.seq - Bacterial sequence entries, part 718.
891. gbbct719.seq - Bacterial sequence entries, part 719.
892. gbbct72.seq - Bacterial sequence entries, part 72.
893. gbbct720.seq - Bacterial sequence entries, part 720.
894. gbbct721.seq - Bacterial sequence entries, part 721.
895. gbbct722.seq - Bacterial sequence entries, part 722.
896. gbbct723.seq - Bacterial sequence entries, part 723.
897. gbbct724.seq - Bacterial sequence entries, part 724.
898. gbbct725.seq - Bacterial sequence entries, part 725.
899. gbbct726.seq - Bacterial sequence entries, part 726.
900. gbbct727.seq - Bacterial sequence entries, part 727.
901. gbbct728.seq - Bacterial sequence entries, part 728.
902. gbbct729.seq - Bacterial sequence entries, part 729.
903. gbbct73.seq - Bacterial sequence entries, part 73.
904. gbbct730.seq - Bacterial sequence entries, part 730.
905. gbbct731.seq - Bacterial sequence entries, part 731.
906. gbbct732.seq - Bacterial sequence entries, part 732.
907. gbbct733.seq - Bacterial sequence entries, part 733.
908. gbbct734.seq - Bacterial sequence entries, part 734.
909. gbbct735.seq - Bacterial sequence entries, part 735.
910. gbbct736.seq - Bacterial sequence entries, part 736.
911. gbbct737.seq - Bacterial sequence entries, part 737.
912. gbbct738.seq - Bacterial sequence entries, part 738.
913. gbbct739.seq - Bacterial sequence entries, part 739.
914. gbbct74.seq - Bacterial sequence entries, part 74.
915. gbbct740.seq - Bacterial sequence entries, part 740.
916. gbbct741.seq - Bacterial sequence entries, part 741.
917. gbbct742.seq - Bacterial sequence entries, part 742.
918. gbbct743.seq - Bacterial sequence entries, part 743.
919. gbbct744.seq - Bacterial sequence entries, part 744.
920. gbbct745.seq - Bacterial sequence entries, part 745.
921. gbbct746.seq - Bacterial sequence entries, part 746.
922. gbbct747.seq - Bacterial sequence entries, part 747.
923. gbbct748.seq - Bacterial sequence entries, part 748.
924. gbbct749.seq - Bacterial sequence entries, part 749.
925. gbbct75.seq - Bacterial sequence entries, part 75.
926. gbbct750.seq - Bacterial sequence entries, part 750.
927. gbbct751.seq - Bacterial sequence entries, part 751.
928. gbbct752.seq - Bacterial sequence entries, part 752.
929. gbbct753.seq - Bacterial sequence entries, part 753.
930. gbbct754.seq - Bacterial sequence entries, part 754.
931. gbbct755.seq - Bacterial sequence entries, part 755.
932. gbbct756.seq - Bacterial sequence entries, part 756.
933. gbbct757.seq - Bacterial sequence entries, part 757.
934. gbbct758.seq - Bacterial sequence entries, part 758.
935. gbbct759.seq - Bacterial sequence entries, part 759.
936. gbbct76.seq - Bacterial sequence entries, part 76.
937. gbbct760.seq - Bacterial sequence entries, part 760.
938. gbbct761.seq - Bacterial sequence entries, part 761.
939. gbbct762.seq - Bacterial sequence entries, part 762.
940. gbbct763.seq - Bacterial sequence entries, part 763.
941. gbbct764.seq - Bacterial sequence entries, part 764.
942. gbbct765.seq - Bacterial sequence entries, part 765.
943. gbbct766.seq - Bacterial sequence entries, part 766.
944. gbbct767.seq - Bacterial sequence entries, part 767.
945. gbbct768.seq - Bacterial sequence entries, part 768.
946. gbbct769.seq - Bacterial sequence entries, part 769.
947. gbbct77.seq - Bacterial sequence entries, part 77.
948. gbbct770.seq - Bacterial sequence entries, part 770.
949. gbbct771.seq - Bacterial sequence entries, part 771.
950. gbbct772.seq - Bacterial sequence entries, part 772.
951. gbbct773.seq - Bacterial sequence entries, part 773.
952. gbbct774.seq - Bacterial sequence entries, part 774.
953. gbbct775.seq - Bacterial sequence entries, part 775.
954. gbbct776.seq - Bacterial sequence entries, part 776.
955. gbbct777.seq - Bacterial sequence entries, part 777.
956. gbbct778.seq - Bacterial sequence entries, part 778.
957. gbbct779.seq - Bacterial sequence entries, part 779.
958. gbbct78.seq - Bacterial sequence entries, part 78.
959. gbbct780.seq - Bacterial sequence entries, part 780.
960. gbbct781.seq - Bacterial sequence entries, part 781.
961. gbbct782.seq - Bacterial sequence entries, part 782.
962. gbbct783.seq - Bacterial sequence entries, part 783.
963. gbbct784.seq - Bacterial sequence entries, part 784.
964. gbbct785.seq - Bacterial sequence entries, part 785.
965. gbbct786.seq - Bacterial sequence entries, part 786.
966. gbbct787.seq - Bacterial sequence entries, part 787.
967. gbbct788.seq - Bacterial sequence entries, part 788.
968. gbbct789.seq - Bacterial sequence entries, part 789.
969. gbbct79.seq - Bacterial sequence entries, part 79.
970. gbbct790.seq - Bacterial sequence entries, part 790.
971. gbbct791.seq - Bacterial sequence entries, part 791.
972. gbbct792.seq - Bacterial sequence entries, part 792.
973. gbbct793.seq - Bacterial sequence entries, part 793.
974. gbbct794.seq - Bacterial sequence entries, part 794.
975. gbbct795.seq - Bacterial sequence entries, part 795.
976. gbbct796.seq - Bacterial sequence entries, part 796.
977. gbbct797.seq - Bacterial sequence entries, part 797.
978. gbbct798.seq - Bacterial sequence entries, part 798.
979. gbbct799.seq - Bacterial sequence entries, part 799.
980. gbbct8.seq - Bacterial sequence entries, part 8.
981. gbbct80.seq - Bacterial sequence entries, part 80.
982. gbbct800.seq - Bacterial sequence entries, part 800.
983. gbbct801.seq - Bacterial sequence entries, part 801.
984. gbbct802.seq - Bacterial sequence entries, part 802.
985. gbbct803.seq - Bacterial sequence entries, part 803.
986. gbbct804.seq - Bacterial sequence entries, part 804.
987. gbbct805.seq - Bacterial sequence entries, part 805.
988. gbbct806.seq - Bacterial sequence entries, part 806.
989. gbbct807.seq - Bacterial sequence entries, part 807.
990. gbbct808.seq - Bacterial sequence entries, part 808.
991. gbbct809.seq - Bacterial sequence entries, part 809.
992. gbbct81.seq - Bacterial sequence entries, part 81.
993. gbbct810.seq - Bacterial sequence entries, part 810.
994. gbbct811.seq - Bacterial sequence entries, part 811.
995. gbbct812.seq - Bacterial sequence entries, part 812.
996. gbbct813.seq - Bacterial sequence entries, part 813.
997. gbbct814.seq - Bacterial sequence entries, part 814.
998. gbbct815.seq - Bacterial sequence entries, part 815.
999. gbbct816.seq - Bacterial sequence entries, part 816.
1000. gbbct817.seq - Bacterial sequence entries, part 817.
1001. gbbct818.seq - Bacterial sequence entries, part 818.
1002. gbbct819.seq - Bacterial sequence entries, part 819.
1003. gbbct82.seq - Bacterial sequence entries, part 82.
1004. gbbct820.seq - Bacterial sequence entries, part 820.
1005. gbbct821.seq - Bacterial sequence entries, part 821.
1006. gbbct822.seq - Bacterial sequence entries, part 822.
1007. gbbct823.seq - Bacterial sequence entries, part 823.
1008. gbbct824.seq - Bacterial sequence entries, part 824.
1009. gbbct825.seq - Bacterial sequence entries, part 825.
1010. gbbct826.seq - Bacterial sequence entries, part 826.
1011. gbbct827.seq - Bacterial sequence entries, part 827.
1012. gbbct828.seq - Bacterial sequence entries, part 828.
1013. gbbct829.seq - Bacterial sequence entries, part 829.
1014. gbbct83.seq - Bacterial sequence entries, part 83.
1015. gbbct830.seq - Bacterial sequence entries, part 830.
1016. gbbct831.seq - Bacterial sequence entries, part 831.
1017. gbbct832.seq - Bacterial sequence entries, part 832.
1018. gbbct833.seq - Bacterial sequence entries, part 833.
1019. gbbct834.seq - Bacterial sequence entries, part 834.
1020. gbbct835.seq - Bacterial sequence entries, part 835.
1021. gbbct836.seq - Bacterial sequence entries, part 836.
1022. gbbct837.seq - Bacterial sequence entries, part 837.
1023. gbbct838.seq - Bacterial sequence entries, part 838.
1024. gbbct839.seq - Bacterial sequence entries, part 839.
1025. gbbct84.seq - Bacterial sequence entries, part 84.
1026. gbbct840.seq - Bacterial sequence entries, part 840.
1027. gbbct841.seq - Bacterial sequence entries, part 841.
1028. gbbct842.seq - Bacterial sequence entries, part 842.
1029. gbbct843.seq - Bacterial sequence entries, part 843.
1030. gbbct844.seq - Bacterial sequence entries, part 844.
1031. gbbct845.seq - Bacterial sequence entries, part 845.
1032. gbbct846.seq - Bacterial sequence entries, part 846.
1033. gbbct847.seq - Bacterial sequence entries, part 847.
1034. gbbct848.seq - Bacterial sequence entries, part 848.
1035. gbbct849.seq - Bacterial sequence entries, part 849.
1036. gbbct85.seq - Bacterial sequence entries, part 85.
1037. gbbct850.seq - Bacterial sequence entries, part 850.
1038. gbbct851.seq - Bacterial sequence entries, part 851.
1039. gbbct852.seq - Bacterial sequence entries, part 852.
1040. gbbct853.seq - Bacterial sequence entries, part 853.
1041. gbbct854.seq - Bacterial sequence entries, part 854.
1042. gbbct855.seq - Bacterial sequence entries, part 855.
1043. gbbct856.seq - Bacterial sequence entries, part 856.
1044. gbbct857.seq - Bacterial sequence entries, part 857.
1045. gbbct858.seq - Bacterial sequence entries, part 858.
1046. gbbct859.seq - Bacterial sequence entries, part 859.
1047. gbbct86.seq - Bacterial sequence entries, part 86.
1048. gbbct860.seq - Bacterial sequence entries, part 860.
1049. gbbct861.seq - Bacterial sequence entries, part 861.
1050. gbbct862.seq - Bacterial sequence entries, part 862.
1051. gbbct863.seq - Bacterial sequence entries, part 863.
1052. gbbct864.seq - Bacterial sequence entries, part 864.
1053. gbbct865.seq - Bacterial sequence entries, part 865.
1054. gbbct866.seq - Bacterial sequence entries, part 866.
1055. gbbct867.seq - Bacterial sequence entries, part 867.
1056. gbbct868.seq - Bacterial sequence entries, part 868.
1057. gbbct869.seq - Bacterial sequence entries, part 869.
1058. gbbct87.seq - Bacterial sequence entries, part 87.
1059. gbbct870.seq - Bacterial sequence entries, part 870.
1060. gbbct871.seq - Bacterial sequence entries, part 871.
1061. gbbct872.seq - Bacterial sequence entries, part 872.
1062. gbbct873.seq - Bacterial sequence entries, part 873.
1063. gbbct874.seq - Bacterial sequence entries, part 874.
1064. gbbct875.seq - Bacterial sequence entries, part 875.
1065. gbbct876.seq - Bacterial sequence entries, part 876.
1066. gbbct877.seq - Bacterial sequence entries, part 877.
1067. gbbct878.seq - Bacterial sequence entries, part 878.
1068. gbbct879.seq - Bacterial sequence entries, part 879.
1069. gbbct88.seq - Bacterial sequence entries, part 88.
1070. gbbct880.seq - Bacterial sequence entries, part 880.
1071. gbbct881.seq - Bacterial sequence entries, part 881.
1072. gbbct882.seq - Bacterial sequence entries, part 882.
1073. gbbct883.seq - Bacterial sequence entries, part 883.
1074. gbbct884.seq - Bacterial sequence entries, part 884.
1075. gbbct885.seq - Bacterial sequence entries, part 885.
1076. gbbct886.seq - Bacterial sequence entries, part 886.
1077. gbbct887.seq - Bacterial sequence entries, part 887.
1078. gbbct888.seq - Bacterial sequence entries, part 888.
1079. gbbct889.seq - Bacterial sequence entries, part 889.
1080. gbbct89.seq - Bacterial sequence entries, part 89.
1081. gbbct890.seq - Bacterial sequence entries, part 890.
1082. gbbct891.seq - Bacterial sequence entries, part 891.
1083. gbbct892.seq - Bacterial sequence entries, part 892.
1084. gbbct893.seq - Bacterial sequence entries, part 893.
1085. gbbct894.seq - Bacterial sequence entries, part 894.
1086. gbbct895.seq - Bacterial sequence entries, part 895.
1087. gbbct896.seq - Bacterial sequence entries, part 896.
1088. gbbct897.seq - Bacterial sequence entries, part 897.
1089. gbbct898.seq - Bacterial sequence entries, part 898.
1090. gbbct899.seq - Bacterial sequence entries, part 899.
1091. gbbct9.seq - Bacterial sequence entries, part 9.
1092. gbbct90.seq - Bacterial sequence entries, part 90.
1093. gbbct900.seq - Bacterial sequence entries, part 900.
1094. gbbct901.seq - Bacterial sequence entries, part 901.
1095. gbbct902.seq - Bacterial sequence entries, part 902.
1096. gbbct903.seq - Bacterial sequence entries, part 903.
1097. gbbct904.seq - Bacterial sequence entries, part 904.
1098. gbbct905.seq - Bacterial sequence entries, part 905.
1099. gbbct906.seq - Bacterial sequence entries, part 906.
1100. gbbct907.seq - Bacterial sequence entries, part 907.
1101. gbbct908.seq - Bacterial sequence entries, part 908.
1102. gbbct909.seq - Bacterial sequence entries, part 909.
1103. gbbct91.seq - Bacterial sequence entries, part 91.
1104. gbbct910.seq - Bacterial sequence entries, part 910.
1105. gbbct911.seq - Bacterial sequence entries, part 911.
1106. gbbct912.seq - Bacterial sequence entries, part 912.
1107. gbbct913.seq - Bacterial sequence entries, part 913.
1108. gbbct914.seq - Bacterial sequence entries, part 914.
1109. gbbct915.seq - Bacterial sequence entries, part 915.
1110. gbbct916.seq - Bacterial sequence entries, part 916.
1111. gbbct917.seq - Bacterial sequence entries, part 917.
1112. gbbct918.seq - Bacterial sequence entries, part 918.
1113. gbbct919.seq - Bacterial sequence entries, part 919.
1114. gbbct92.seq - Bacterial sequence entries, part 92.
1115. gbbct920.seq - Bacterial sequence entries, part 920.
1116. gbbct921.seq - Bacterial sequence entries, part 921.
1117. gbbct922.seq - Bacterial sequence entries, part 922.
1118. gbbct923.seq - Bacterial sequence entries, part 923.
1119. gbbct924.seq - Bacterial sequence entries, part 924.
1120. gbbct925.seq - Bacterial sequence entries, part 925.
1121. gbbct926.seq - Bacterial sequence entries, part 926.
1122. gbbct927.seq - Bacterial sequence entries, part 927.
1123. gbbct928.seq - Bacterial sequence entries, part 928.
1124. gbbct929.seq - Bacterial sequence entries, part 929.
1125. gbbct93.seq - Bacterial sequence entries, part 93.
1126. gbbct930.seq - Bacterial sequence entries, part 930.
1127. gbbct931.seq - Bacterial sequence entries, part 931.
1128. gbbct932.seq - Bacterial sequence entries, part 932.
1129. gbbct933.seq - Bacterial sequence entries, part 933.
1130. gbbct934.seq - Bacterial sequence entries, part 934.
1131. gbbct935.seq - Bacterial sequence entries, part 935.
1132. gbbct936.seq - Bacterial sequence entries, part 936.
1133. gbbct937.seq - Bacterial sequence entries, part 937.
1134. gbbct938.seq - Bacterial sequence entries, part 938.
1135. gbbct939.seq - Bacterial sequence entries, part 939.
1136. gbbct94.seq - Bacterial sequence entries, part 94.
1137. gbbct940.seq - Bacterial sequence entries, part 940.
1138. gbbct941.seq - Bacterial sequence entries, part 941.
1139. gbbct942.seq - Bacterial sequence entries, part 942.
1140. gbbct943.seq - Bacterial sequence entries, part 943.
1141. gbbct944.seq - Bacterial sequence entries, part 944.
1142. gbbct945.seq - Bacterial sequence entries, part 945.
1143. gbbct946.seq - Bacterial sequence entries, part 946.
1144. gbbct947.seq - Bacterial sequence entries, part 947.
1145. gbbct948.seq - Bacterial sequence entries, part 948.
1146. gbbct949.seq - Bacterial sequence entries, part 949.
1147. gbbct95.seq - Bacterial sequence entries, part 95.
1148. gbbct950.seq - Bacterial sequence entries, part 950.
1149. gbbct951.seq - Bacterial sequence entries, part 951.
1150. gbbct952.seq - Bacterial sequence entries, part 952.
1151. gbbct953.seq - Bacterial sequence entries, part 953.
1152. gbbct954.seq - Bacterial sequence entries, part 954.
1153. gbbct955.seq - Bacterial sequence entries, part 955.
1154. gbbct956.seq - Bacterial sequence entries, part 956.
1155. gbbct957.seq - Bacterial sequence entries, part 957.
1156. gbbct958.seq - Bacterial sequence entries, part 958.
1157. gbbct959.seq - Bacterial sequence entries, part 959.
1158. gbbct96.seq - Bacterial sequence entries, part 96.
1159. gbbct960.seq - Bacterial sequence entries, part 960.
1160. gbbct961.seq - Bacterial sequence entries, part 961.
1161. gbbct962.seq - Bacterial sequence entries, part 962.
1162. gbbct963.seq - Bacterial sequence entries, part 963.
1163. gbbct964.seq - Bacterial sequence entries, part 964.
1164. gbbct965.seq - Bacterial sequence entries, part 965.
1165. gbbct966.seq - Bacterial sequence entries, part 966.
1166. gbbct967.seq - Bacterial sequence entries, part 967.
1167. gbbct968.seq - Bacterial sequence entries, part 968.
1168. gbbct969.seq - Bacterial sequence entries, part 969.
1169. gbbct97.seq - Bacterial sequence entries, part 97.
1170. gbbct970.seq - Bacterial sequence entries, part 970.
1171. gbbct971.seq - Bacterial sequence entries, part 971.
1172. gbbct972.seq - Bacterial sequence entries, part 972.
1173. gbbct973.seq - Bacterial sequence entries, part 973.
1174. gbbct974.seq - Bacterial sequence entries, part 974.
1175. gbbct975.seq - Bacterial sequence entries, part 975.
1176. gbbct976.seq - Bacterial sequence entries, part 976.
1177. gbbct977.seq - Bacterial sequence entries, part 977.
1178. gbbct978.seq - Bacterial sequence entries, part 978.
1179. gbbct979.seq - Bacterial sequence entries, part 979.
1180. gbbct98.seq - Bacterial sequence entries, part 98.
1181. gbbct980.seq - Bacterial sequence entries, part 980.
1182. gbbct981.seq - Bacterial sequence entries, part 981.
1183. gbbct982.seq - Bacterial sequence entries, part 982.
1184. gbbct983.seq - Bacterial sequence entries, part 983.
1185. gbbct984.seq - Bacterial sequence entries, part 984.
1186. gbbct985.seq - Bacterial sequence entries, part 985.
1187. gbbct986.seq - Bacterial sequence entries, part 986.
1188. gbbct987.seq - Bacterial sequence entries, part 987.
1189. gbbct988.seq - Bacterial sequence entries, part 988.
1190. gbbct989.seq - Bacterial sequence entries, part 989.
1191. gbbct99.seq - Bacterial sequence entries, part 99.
1192. gbbct990.seq - Bacterial sequence entries, part 990.
1193. gbbct991.seq - Bacterial sequence entries, part 991.
1194. gbbct992.seq - Bacterial sequence entries, part 992.
1195. gbbct993.seq - Bacterial sequence entries, part 993.
1196. gbbct994.seq - Bacterial sequence entries, part 994.
1197. gbbct995.seq - Bacterial sequence entries, part 995.
1198. gbbct996.seq - Bacterial sequence entries, part 996.
1199. gbbct997.seq - Bacterial sequence entries, part 997.
1200. gbbct998.seq - Bacterial sequence entries, part 998.
1201. gbbct999.seq - Bacterial sequence entries, part 999.
1202. gbchg.txt - Accession numbers of entries updated since the previous release.
1203. gbcon1.seq - Constructed sequence entries, part 1.
1204. gbcon10.seq - Constructed sequence entries, part 10.
1205. gbcon100.seq - Constructed sequence entries, part 100.
1206. gbcon101.seq - Constructed sequence entries, part 101.
1207. gbcon102.seq - Constructed sequence entries, part 102.
1208. gbcon103.seq - Constructed sequence entries, part 103.
1209. gbcon104.seq - Constructed sequence entries, part 104.
1210. gbcon105.seq - Constructed sequence entries, part 105.
1211. gbcon106.seq - Constructed sequence entries, part 106.
1212. gbcon107.seq - Constructed sequence entries, part 107.
1213. gbcon108.seq - Constructed sequence entries, part 108.
1214. gbcon109.seq - Constructed sequence entries, part 109.
1215. gbcon11.seq - Constructed sequence entries, part 11.
1216. gbcon110.seq - Constructed sequence entries, part 110.
1217. gbcon111.seq - Constructed sequence entries, part 111.
1218. gbcon112.seq - Constructed sequence entries, part 112.
1219. gbcon113.seq - Constructed sequence entries, part 113.
1220. gbcon114.seq - Constructed sequence entries, part 114.
1221. gbcon115.seq - Constructed sequence entries, part 115.
1222. gbcon116.seq - Constructed sequence entries, part 116.
1223. gbcon117.seq - Constructed sequence entries, part 117.
1224. gbcon118.seq - Constructed sequence entries, part 118.
1225. gbcon119.seq - Constructed sequence entries, part 119.
1226. gbcon12.seq - Constructed sequence entries, part 12.
1227. gbcon120.seq - Constructed sequence entries, part 120.
1228. gbcon121.seq - Constructed sequence entries, part 121.
1229. gbcon122.seq - Constructed sequence entries, part 122.
1230. gbcon123.seq - Constructed sequence entries, part 123.
1231. gbcon124.seq - Constructed sequence entries, part 124.
1232. gbcon125.seq - Constructed sequence entries, part 125.
1233. gbcon126.seq - Constructed sequence entries, part 126.
1234. gbcon127.seq - Constructed sequence entries, part 127.
1235. gbcon128.seq - Constructed sequence entries, part 128.
1236. gbcon129.seq - Constructed sequence entries, part 129.
1237. gbcon13.seq - Constructed sequence entries, part 13.
1238. gbcon130.seq - Constructed sequence entries, part 130.
1239. gbcon131.seq - Constructed sequence entries, part 131.
1240. gbcon132.seq - Constructed sequence entries, part 132.
1241. gbcon133.seq - Constructed sequence entries, part 133.
1242. gbcon134.seq - Constructed sequence entries, part 134.
1243. gbcon135.seq - Constructed sequence entries, part 135.
1244. gbcon136.seq - Constructed sequence entries, part 136.
1245. gbcon137.seq - Constructed sequence entries, part 137.
1246. gbcon138.seq - Constructed sequence entries, part 138.
1247. gbcon139.seq - Constructed sequence entries, part 139.
1248. gbcon14.seq - Constructed sequence entries, part 14.
1249. gbcon140.seq - Constructed sequence entries, part 140.
1250. gbcon141.seq - Constructed sequence entries, part 141.
1251. gbcon142.seq - Constructed sequence entries, part 142.
1252. gbcon143.seq - Constructed sequence entries, part 143.
1253. gbcon144.seq - Constructed sequence entries, part 144.
1254. gbcon145.seq - Constructed sequence entries, part 145.
1255. gbcon146.seq - Constructed sequence entries, part 146.
1256. gbcon147.seq - Constructed sequence entries, part 147.
1257. gbcon148.seq - Constructed sequence entries, part 148.
1258. gbcon149.seq - Constructed sequence entries, part 149.
1259. gbcon15.seq - Constructed sequence entries, part 15.
1260. gbcon150.seq - Constructed sequence entries, part 150.
1261. gbcon151.seq - Constructed sequence entries, part 151.
1262. gbcon152.seq - Constructed sequence entries, part 152.
1263. gbcon153.seq - Constructed sequence entries, part 153.
1264. gbcon154.seq - Constructed sequence entries, part 154.
1265. gbcon155.seq - Constructed sequence entries, part 155.
1266. gbcon156.seq - Constructed sequence entries, part 156.
1267. gbcon157.seq - Constructed sequence entries, part 157.
1268. gbcon158.seq - Constructed sequence entries, part 158.
1269. gbcon159.seq - Constructed sequence entries, part 159.
1270. gbcon16.seq - Constructed sequence entries, part 16.
1271. gbcon160.seq - Constructed sequence entries, part 160.
1272. gbcon161.seq - Constructed sequence entries, part 161.
1273. gbcon162.seq - Constructed sequence entries, part 162.
1274. gbcon163.seq - Constructed sequence entries, part 163.
1275. gbcon164.seq - Constructed sequence entries, part 164.
1276. gbcon165.seq - Constructed sequence entries, part 165.
1277. gbcon166.seq - Constructed sequence entries, part 166.
1278. gbcon167.seq - Constructed sequence entries, part 167.
1279. gbcon168.seq - Constructed sequence entries, part 168.
1280. gbcon169.seq - Constructed sequence entries, part 169.
1281. gbcon17.seq - Constructed sequence entries, part 17.
1282. gbcon170.seq - Constructed sequence entries, part 170.
1283. gbcon171.seq - Constructed sequence entries, part 171.
1284. gbcon172.seq - Constructed sequence entries, part 172.
1285. gbcon173.seq - Constructed sequence entries, part 173.
1286. gbcon174.seq - Constructed sequence entries, part 174.
1287. gbcon175.seq - Constructed sequence entries, part 175.
1288. gbcon176.seq - Constructed sequence entries, part 176.
1289. gbcon177.seq - Constructed sequence entries, part 177.
1290. gbcon178.seq - Constructed sequence entries, part 178.
1291. gbcon179.seq - Constructed sequence entries, part 179.
1292. gbcon18.seq - Constructed sequence entries, part 18.
1293. gbcon180.seq - Constructed sequence entries, part 180.
1294. gbcon181.seq - Constructed sequence entries, part 181.
1295. gbcon182.seq - Constructed sequence entries, part 182.
1296. gbcon183.seq - Constructed sequence entries, part 183.
1297. gbcon184.seq - Constructed sequence entries, part 184.
1298. gbcon185.seq - Constructed sequence entries, part 185.
1299. gbcon186.seq - Constructed sequence entries, part 186.
1300. gbcon187.seq - Constructed sequence entries, part 187.
1301. gbcon188.seq - Constructed sequence entries, part 188.
1302. gbcon189.seq - Constructed sequence entries, part 189.
1303. gbcon19.seq - Constructed sequence entries, part 19.
1304. gbcon190.seq - Constructed sequence entries, part 190.
1305. gbcon191.seq - Constructed sequence entries, part 191.
1306. gbcon192.seq - Constructed sequence entries, part 192.
1307. gbcon193.seq - Constructed sequence entries, part 193.
1308. gbcon194.seq - Constructed sequence entries, part 194.
1309. gbcon195.seq - Constructed sequence entries, part 195.
1310. gbcon196.seq - Constructed sequence entries, part 196.
1311. gbcon197.seq - Constructed sequence entries, part 197.
1312. gbcon198.seq - Constructed sequence entries, part 198.
1313. gbcon199.seq - Constructed sequence entries, part 199.
1314. gbcon2.seq - Constructed sequence entries, part 2.
1315. gbcon20.seq - Constructed sequence entries, part 20.
1316. gbcon200.seq - Constructed sequence entries, part 200.
1317. gbcon201.seq - Constructed sequence entries, part 201.
1318. gbcon202.seq - Constructed sequence entries, part 202.
1319. gbcon203.seq - Constructed sequence entries, part 203.
1320. gbcon204.seq - Constructed sequence entries, part 204.
1321. gbcon205.seq - Constructed sequence entries, part 205.
1322. gbcon206.seq - Constructed sequence entries, part 206.
1323. gbcon207.seq - Constructed sequence entries, part 207.
1324. gbcon208.seq - Constructed sequence entries, part 208.
1325. gbcon209.seq - Constructed sequence entries, part 209.
1326. gbcon21.seq - Constructed sequence entries, part 21.
1327. gbcon210.seq - Constructed sequence entries, part 210.
1328. gbcon211.seq - Constructed sequence entries, part 211.
1329. gbcon212.seq - Constructed sequence entries, part 212.
1330. gbcon213.seq - Constructed sequence entries, part 213.
1331. gbcon214.seq - Constructed sequence entries, part 214.
1332. gbcon215.seq - Constructed sequence entries, part 215.
1333. gbcon216.seq - Constructed sequence entries, part 216.
1334. gbcon217.seq - Constructed sequence entries, part 217.
1335. gbcon218.seq - Constructed sequence entries, part 218.
1336. gbcon219.seq - Constructed sequence entries, part 219.
1337. gbcon22.seq - Constructed sequence entries, part 22.
1338. gbcon220.seq - Constructed sequence entries, part 220.
1339. gbcon221.seq - Constructed sequence entries, part 221.
1340. gbcon222.seq - Constructed sequence entries, part 222.
1341. gbcon223.seq - Constructed sequence entries, part 223.
1342. gbcon224.seq - Constructed sequence entries, part 224.
1343. gbcon225.seq - Constructed sequence entries, part 225.
1344. gbcon226.seq - Constructed sequence entries, part 226.
1345. gbcon227.seq - Constructed sequence entries, part 227.
1346. gbcon228.seq - Constructed sequence entries, part 228.
1347. gbcon229.seq - Constructed sequence entries, part 229.
1348. gbcon23.seq - Constructed sequence entries, part 23.
1349. gbcon230.seq - Constructed sequence entries, part 230.
1350. gbcon231.seq - Constructed sequence entries, part 231.
1351. gbcon232.seq - Constructed sequence entries, part 232.
1352. gbcon233.seq - Constructed sequence entries, part 233.
1353. gbcon234.seq - Constructed sequence entries, part 234.
1354. gbcon235.seq - Constructed sequence entries, part 235.
1355. gbcon236.seq - Constructed sequence entries, part 236.
1356. gbcon237.seq - Constructed sequence entries, part 237.
1357. gbcon238.seq - Constructed sequence entries, part 238.
1358. gbcon239.seq - Constructed sequence entries, part 239.
1359. gbcon24.seq - Constructed sequence entries, part 24.
1360. gbcon240.seq - Constructed sequence entries, part 240.
1361. gbcon25.seq - Constructed sequence entries, part 25.
1362. gbcon26.seq - Constructed sequence entries, part 26.
1363. gbcon27.seq - Constructed sequence entries, part 27.
1364. gbcon28.seq - Constructed sequence entries, part 28.
1365. gbcon29.seq - Constructed sequence entries, part 29.
1366. gbcon3.seq - Constructed sequence entries, part 3.
1367. gbcon30.seq - Constructed sequence entries, part 30.
1368. gbcon31.seq - Constructed sequence entries, part 31.
1369. gbcon32.seq - Constructed sequence entries, part 32.
1370. gbcon33.seq - Constructed sequence entries, part 33.
1371. gbcon34.seq - Constructed sequence entries, part 34.
1372. gbcon35.seq - Constructed sequence entries, part 35.
1373. gbcon36.seq - Constructed sequence entries, part 36.
1374. gbcon37.seq - Constructed sequence entries, part 37.
1375. gbcon38.seq - Constructed sequence entries, part 38.
1376. gbcon39.seq - Constructed sequence entries, part 39.
1377. gbcon4.seq - Constructed sequence entries, part 4.
1378. gbcon40.seq - Constructed sequence entries, part 40.
1379. gbcon41.seq - Constructed sequence entries, part 41.
1380. gbcon42.seq - Constructed sequence entries, part 42.
1381. gbcon43.seq - Constructed sequence entries, part 43.
1382. gbcon44.seq - Constructed sequence entries, part 44.
1383. gbcon45.seq - Constructed sequence entries, part 45.
1384. gbcon46.seq - Constructed sequence entries, part 46.
1385. gbcon47.seq - Constructed sequence entries, part 47.
1386. gbcon48.seq - Constructed sequence entries, part 48.
1387. gbcon49.seq - Constructed sequence entries, part 49.
1388. gbcon5.seq - Constructed sequence entries, part 5.
1389. gbcon50.seq - Constructed sequence entries, part 50.
1390. gbcon51.seq - Constructed sequence entries, part 51.
1391. gbcon52.seq - Constructed sequence entries, part 52.
1392. gbcon53.seq - Constructed sequence entries, part 53.
1393. gbcon54.seq - Constructed sequence entries, part 54.
1394. gbcon55.seq - Constructed sequence entries, part 55.
1395. gbcon56.seq - Constructed sequence entries, part 56.
1396. gbcon57.seq - Constructed sequence entries, part 57.
1397. gbcon58.seq - Constructed sequence entries, part 58.
1398. gbcon59.seq - Constructed sequence entries, part 59.
1399. gbcon6.seq - Constructed sequence entries, part 6.
1400. gbcon60.seq - Constructed sequence entries, part 60.
1401. gbcon61.seq - Constructed sequence entries, part 61.
1402. gbcon62.seq - Constructed sequence entries, part 62.
1403. gbcon63.seq - Constructed sequence entries, part 63.
1404. gbcon64.seq - Constructed sequence entries, part 64.
1405. gbcon65.seq - Constructed sequence entries, part 65.
1406. gbcon66.seq - Constructed sequence entries, part 66.
1407. gbcon67.seq - Constructed sequence entries, part 67.
1408. gbcon68.seq - Constructed sequence entries, part 68.
1409. gbcon69.seq - Constructed sequence entries, part 69.
1410. gbcon7.seq - Constructed sequence entries, part 7.
1411. gbcon70.seq - Constructed sequence entries, part 70.
1412. gbcon71.seq - Constructed sequence entries, part 71.
1413. gbcon72.seq - Constructed sequence entries, part 72.
1414. gbcon73.seq - Constructed sequence entries, part 73.
1415. gbcon74.seq - Constructed sequence entries, part 74.
1416. gbcon75.seq - Constructed sequence entries, part 75.
1417. gbcon76.seq - Constructed sequence entries, part 76.
1418. gbcon77.seq - Constructed sequence entries, part 77.
1419. gbcon78.seq - Constructed sequence entries, part 78.
1420. gbcon79.seq - Constructed sequence entries, part 79.
1421. gbcon8.seq - Constructed sequence entries, part 8.
1422. gbcon80.seq - Constructed sequence entries, part 80.
1423. gbcon81.seq - Constructed sequence entries, part 81.
1424. gbcon82.seq - Constructed sequence entries, part 82.
1425. gbcon83.seq - Constructed sequence entries, part 83.
1426. gbcon84.seq - Constructed sequence entries, part 84.
1427. gbcon85.seq - Constructed sequence entries, part 85.
1428. gbcon86.seq - Constructed sequence entries, part 86.
1429. gbcon87.seq - Constructed sequence entries, part 87.
1430. gbcon88.seq - Constructed sequence entries, part 88.
1431. gbcon89.seq - Constructed sequence entries, part 89.
1432. gbcon9.seq - Constructed sequence entries, part 9.
1433. gbcon90.seq - Constructed sequence entries, part 90.
1434. gbcon91.seq - Constructed sequence entries, part 91.
1435. gbcon92.seq - Constructed sequence entries, part 92.
1436. gbcon93.seq - Constructed sequence entries, part 93.
1437. gbcon94.seq - Constructed sequence entries, part 94.
1438. gbcon95.seq - Constructed sequence entries, part 95.
1439. gbcon96.seq - Constructed sequence entries, part 96.
1440. gbcon97.seq - Constructed sequence entries, part 97.
1441. gbcon98.seq - Constructed sequence entries, part 98.
1442. gbcon99.seq - Constructed sequence entries, part 99.
1443. gbdel.txt - Accession numbers of entries deleted since the previous release.
1444. gbenv1.seq - Environmental sampling sequence entries, part 1.
1445. gbenv10.seq - Environmental sampling sequence entries, part 10.
1446. gbenv11.seq - Environmental sampling sequence entries, part 11.
1447. gbenv12.seq - Environmental sampling sequence entries, part 12.
1448. gbenv13.seq - Environmental sampling sequence entries, part 13.
1449. gbenv14.seq - Environmental sampling sequence entries, part 14.
1450. gbenv15.seq - Environmental sampling sequence entries, part 15.
1451. gbenv16.seq - Environmental sampling sequence entries, part 16.
1452. gbenv17.seq - Environmental sampling sequence entries, part 17.
1453. gbenv18.seq - Environmental sampling sequence entries, part 18.
1454. gbenv19.seq - Environmental sampling sequence entries, part 19.
1455. gbenv2.seq - Environmental sampling sequence entries, part 2.
1456. gbenv20.seq - Environmental sampling sequence entries, part 20.
1457. gbenv21.seq - Environmental sampling sequence entries, part 21.
1458. gbenv22.seq - Environmental sampling sequence entries, part 22.
1459. gbenv23.seq - Environmental sampling sequence entries, part 23.
1460. gbenv24.seq - Environmental sampling sequence entries, part 24.
1461. gbenv25.seq - Environmental sampling sequence entries, part 25.
1462. gbenv26.seq - Environmental sampling sequence entries, part 26.
1463. gbenv27.seq - Environmental sampling sequence entries, part 27.
1464. gbenv28.seq - Environmental sampling sequence entries, part 28.
1465. gbenv29.seq - Environmental sampling sequence entries, part 29.
1466. gbenv3.seq - Environmental sampling sequence entries, part 3.
1467. gbenv30.seq - Environmental sampling sequence entries, part 30.
1468. gbenv31.seq - Environmental sampling sequence entries, part 31.
1469. gbenv32.seq - Environmental sampling sequence entries, part 32.
1470. gbenv33.seq - Environmental sampling sequence entries, part 33.
1471. gbenv34.seq - Environmental sampling sequence entries, part 34.
1472. gbenv35.seq - Environmental sampling sequence entries, part 35.
1473. gbenv36.seq - Environmental sampling sequence entries, part 36.
1474. gbenv37.seq - Environmental sampling sequence entries, part 37.
1475. gbenv38.seq - Environmental sampling sequence entries, part 38.
1476. gbenv39.seq - Environmental sampling sequence entries, part 39.
1477. gbenv4.seq - Environmental sampling sequence entries, part 4.
1478. gbenv40.seq - Environmental sampling sequence entries, part 40.
1479. gbenv41.seq - Environmental sampling sequence entries, part 41.
1480. gbenv42.seq - Environmental sampling sequence entries, part 42.
1481. gbenv43.seq - Environmental sampling sequence entries, part 43.
1482. gbenv44.seq - Environmental sampling sequence entries, part 44.
1483. gbenv45.seq - Environmental sampling sequence entries, part 45.
1484. gbenv46.seq - Environmental sampling sequence entries, part 46.
1485. gbenv47.seq - Environmental sampling sequence entries, part 47.
1486. gbenv48.seq - Environmental sampling sequence entries, part 48.
1487. gbenv49.seq - Environmental sampling sequence entries, part 49.
1488. gbenv5.seq - Environmental sampling sequence entries, part 5.
1489. gbenv50.seq - Environmental sampling sequence entries, part 50.
1490. gbenv51.seq - Environmental sampling sequence entries, part 51.
1491. gbenv52.seq - Environmental sampling sequence entries, part 52.
1492. gbenv53.seq - Environmental sampling sequence entries, part 53.
1493. gbenv54.seq - Environmental sampling sequence entries, part 54.
1494. gbenv55.seq - Environmental sampling sequence entries, part 55.
1495. gbenv56.seq - Environmental sampling sequence entries, part 56.
1496. gbenv57.seq - Environmental sampling sequence entries, part 57.
1497. gbenv58.seq - Environmental sampling sequence entries, part 58.
1498. gbenv59.seq - Environmental sampling sequence entries, part 59.
1499. gbenv6.seq - Environmental sampling sequence entries, part 6.
1500. gbenv60.seq - Environmental sampling sequence entries, part 60.
1501. gbenv61.seq - Environmental sampling sequence entries, part 61.
1502. gbenv62.seq - Environmental sampling sequence entries, part 62.
1503. gbenv63.seq - Environmental sampling sequence entries, part 63.
1504. gbenv64.seq - Environmental sampling sequence entries, part 64.
1505. gbenv65.seq - Environmental sampling sequence entries, part 65.
1506. gbenv66.seq - Environmental sampling sequence entries, part 66.
1507. gbenv67.seq - Environmental sampling sequence entries, part 67.
1508. gbenv68.seq - Environmental sampling sequence entries, part 68.
1509. gbenv69.seq - Environmental sampling sequence entries, part 69.
1510. gbenv7.seq - Environmental sampling sequence entries, part 7.
1511. gbenv70.seq - Environmental sampling sequence entries, part 70.
1512. gbenv71.seq - Environmental sampling sequence entries, part 71.
1513. gbenv72.seq - Environmental sampling sequence entries, part 72.
1514. gbenv73.seq - Environmental sampling sequence entries, part 73.
1515. gbenv74.seq - Environmental sampling sequence entries, part 74.
1516. gbenv75.seq - Environmental sampling sequence entries, part 75.
1517. gbenv76.seq - Environmental sampling sequence entries, part 76.
1518. gbenv77.seq - Environmental sampling sequence entries, part 77.
1519. gbenv78.seq - Environmental sampling sequence entries, part 78.
1520. gbenv79.seq - Environmental sampling sequence entries, part 79.
1521. gbenv8.seq - Environmental sampling sequence entries, part 8.
1522. gbenv80.seq - Environmental sampling sequence entries, part 80.
1523. gbenv81.seq - Environmental sampling sequence entries, part 81.
1524. gbenv82.seq - Environmental sampling sequence entries, part 82.
1525. gbenv83.seq - Environmental sampling sequence entries, part 83.
1526. gbenv84.seq - Environmental sampling sequence entries, part 84.
1527. gbenv85.seq - Environmental sampling sequence entries, part 85.
1528. gbenv86.seq - Environmental sampling sequence entries, part 86.
1529. gbenv87.seq - Environmental sampling sequence entries, part 87.
1530. gbenv88.seq - Environmental sampling sequence entries, part 88.
1531. gbenv89.seq - Environmental sampling sequence entries, part 89.
1532. gbenv9.seq - Environmental sampling sequence entries, part 9.
1533. gbenv90.seq - Environmental sampling sequence entries, part 90.
1534. gbenv91.seq - Environmental sampling sequence entries, part 91.
1535. gbenv92.seq - Environmental sampling sequence entries, part 92.
1536. gbenv93.seq - Environmental sampling sequence entries, part 93.
1537. gbenv94.seq - Environmental sampling sequence entries, part 94.
1538. gbenv95.seq - Environmental sampling sequence entries, part 95.
1539. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1540. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1541. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1542. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1543. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1544. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1545. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1546. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1547. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1548. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1549. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1550. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1551. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1552. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1553. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1554. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1555. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1556. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1557. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1558. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1559. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1560. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1561. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1562. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1563. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1564. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1565. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1566. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1567. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1568. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1569. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1570. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1571. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1572. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1573. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1574. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1575. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1576. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1577. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1578. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1579. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1580. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1581. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1582. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1583. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1584. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1585. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1586. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1587. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1588. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1589. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1590. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1591. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1592. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1593. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1594. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1595. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1596. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1597. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1598. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1599. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1600. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1601. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1602. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1603. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1604. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1605. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1606. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1607. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1608. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1609. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1610. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1611. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1612. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1613. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1614. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1615. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1616. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1617. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1618. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1619. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1620. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1621. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1622. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1623. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1624. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1625. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1626. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1627. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1628. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1629. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1630. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1631. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1632. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1633. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1634. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1635. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1636. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1637. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1638. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1639. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1640. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1641. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1642. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1643. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1644. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1645. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1646. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1647. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1648. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1649. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1650. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1651. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1652. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1653. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1654. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1655. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1656. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1657. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1658. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1659. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1660. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1661. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1662. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1663. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1664. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1665. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1666. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1667. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1668. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1669. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1670. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1671. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1672. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1673. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1674. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1675. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1676. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1677. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1678. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1679. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1680. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1681. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1682. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1683. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1684. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1685. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1686. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1687. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1688. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1689. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1690. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1691. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1692. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1693. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1694. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1695. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1696. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1697. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1698. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1699. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1700. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1701. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1702. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1703. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1704. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1705. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1706. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1707. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1708. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1709. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1710. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1711. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1712. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1713. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1714. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1715. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1716. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1717. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1718. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1719. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1720. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1721. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1722. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1723. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1724. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1725. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1726. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1727. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1728. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1729. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1730. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1731. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1732. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1733. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1734. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1735. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1736. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1737. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1738. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1739. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1740. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1741. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1742. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1743. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1744. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1745. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1746. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1747. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1748. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1749. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1750. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1751. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1752. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1753. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1754. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1755. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1756. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1757. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1758. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1759. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1760. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1761. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1762. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1763. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1764. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1765. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1766. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1767. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1768. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1769. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1770. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1771. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1772. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1773. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1774. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1775. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1776. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1777. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1778. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1779. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1780. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1781. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1782. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1783. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1784. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1785. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1786. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1787. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1788. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1789. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1790. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1791. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1792. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1793. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1794. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1795. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1796. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1797. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1798. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1799. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1800. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1801. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1802. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1803. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1804. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1805. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1806. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1807. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1808. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1809. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1810. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1811. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1812. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1813. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1814. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1815. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1816. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1817. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1818. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1819. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1820. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1821. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1822. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1823. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1824. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1825. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1826. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1827. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1828. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1829. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1830. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1831. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1832. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1833. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1834. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1835. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1836. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1837. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1838. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1839. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1840. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1841. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1842. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1843. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1844. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1845. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1846. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1847. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1848. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1849. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1850. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1851. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1852. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1853. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1854. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1855. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1856. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1857. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1858. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1859. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1860. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1861. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1862. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1863. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1864. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1865. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1866. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1867. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1868. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1869. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1870. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1871. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1872. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1873. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1874. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1875. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1876. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1877. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1878. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1879. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1880. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1881. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1882. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1883. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1884. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1885. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1886. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1887. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1888. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1889. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1890. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1891. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1892. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1893. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1894. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1895. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1896. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1897. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1898. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1899. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1900. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1901. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1902. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1903. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1904. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1905. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1906. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1907. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1908. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1909. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1910. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1911. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1912. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1913. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1914. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1915. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1916. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1917. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1918. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1919. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1920. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1921. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1922. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1923. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1924. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1925. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1926. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1927. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1928. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1929. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1930. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1931. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1932. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1933. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1934. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1935. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1936. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1937. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1938. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1939. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1940. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1941. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1942. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1943. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1944. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1945. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1946. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1947. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1948. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1949. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1950. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1951. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1952. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1953. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1954. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1955. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1956. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1957. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1958. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1959. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1960. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1961. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1962. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1963. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1964. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1965. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1966. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1967. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1968. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1969. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1970. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1971. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1972. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1973. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1974. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1975. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1976. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1977. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1978. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1979. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1980. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1981. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1982. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1983. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1984. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1985. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1986. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1987. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1988. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1989. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1990. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1991. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1992. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1993. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1994. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1995. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1996. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1997. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1998. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1999. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
2000. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
2001. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
2002. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
2003. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
2004. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
2005. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
2006. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
2007. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
2008. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
2009. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
2010. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
2011. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
2012. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
2013. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
2014. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
2015. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
2016. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
2017. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
2018. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
2019. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
2020. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
2021. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
2022. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
2023. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
2024. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
2025. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
2026. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
2027. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
2028. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
2029. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
2030. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
2031. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
2032. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
2033. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
2034. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
2035. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
2036. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
2037. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
2038. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
2039. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
2040. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
2041. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
2042. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
2043. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
2044. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
2045. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
2046. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
2047. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
2048. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
2049. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
2050. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
2051. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
2052. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
2053. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
2054. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
2055. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
2056. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
2057. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
2058. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
2059. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
2060. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
2061. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
2062. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
2063. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
2064. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
2065. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
2066. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
2067. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
2068. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
2069. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
2070. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
2071. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
2072. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
2073. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
2074. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
2075. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
2076. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
2077. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
2078. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
2079. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
2080. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
2081. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
2082. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
2083. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
2084. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
2085. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
2086. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
2087. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
2088. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
2089. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
2090. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
2091. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
2092. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
2093. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
2094. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
2095. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
2096. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
2097. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
2098. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
2099. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
2100. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
2101. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
2102. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
2103. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
2104. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
2105. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
2106. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
2107. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
2108. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
2109. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
2110. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
2111. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
2112. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
2113. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
2114. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
2115. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
2116. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
2117. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
2118. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
2119. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
2120. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
2121. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
2122. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
2123. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
2124. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
2125. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
2126. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
2127. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
2128. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
2129. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
2130. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
2131. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
2132. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
2133. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
2134. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
2135. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
2136. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
2137. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
2138. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
2139. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
2140. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
2141. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
2142. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
2143. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
2144. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
2145. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
2146. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
2147. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
2148. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
2149. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
2150. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
2151. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
2152. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
2153. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
2154. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
2155. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
2156. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
2157. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
2158. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
2159. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
2160. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
2161. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
2162. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
2163. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
2164. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
2165. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
2166. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
2167. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
2168. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
2169. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
2170. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
2171. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
2172. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
2173. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
2174. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
2175. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
2176. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
2177. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
2178. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
2179. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
2180. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
2181. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
2182. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
2183. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
2184. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
2185. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
2186. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
2187. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
2188. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
2189. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
2190. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
2191. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
2192. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
2193. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
2194. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
2195. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
2196. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
2197. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
2198. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
2199. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
2200. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
2201. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
2202. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
2203. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
2204. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
2205. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
2206. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
2207. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
2208. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
2209. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
2210. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
2211. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
2212. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
2213. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
2214. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
2215. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
2216. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
2217. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
2218. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
2219. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
2220. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
2221. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
2222. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
2223. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
2224. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
2225. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
2226. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
2227. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
2228. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
2229. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
2230. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
2231. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
2232. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
2233. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
2234. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
2235. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
2236. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
2237. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
2238. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
2239. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
2240. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
2241. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
2242. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
2243. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
2244. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
2245. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
2246. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
2247. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
2248. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
2249. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
2250. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
2251. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
2252. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
2253. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
2254. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
2255. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
2256. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
2257. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
2258. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
2259. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
2260. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
2261. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
2262. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
2263. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
2264. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
2265. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
2266. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
2267. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
2268. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
2269. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
2270. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
2271. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
2272. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
2273. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
2274. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
2275. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
2276. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
2277. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
2278. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
2279. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
2280. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
2281. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
2282. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
2283. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
2284. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
2285. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
2286. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
2287. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
2288. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
2289. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
2290. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
2291. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
2292. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
2293. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
2294. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
2295. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
2296. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
2297. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
2298. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
2299. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
2300. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
2301. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
2302. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
2303. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
2304. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
2305. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
2306. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
2307. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
2308. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
2309. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
2310. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
2311. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
2312. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
2313. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
2314. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
2315. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
2316. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
2317. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
2318. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
2319. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
2320. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
2321. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
2322. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
2323. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
2324. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
2325. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
2326. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
2327. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
2328. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
2329. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
2330. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
2331. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
2332. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
2333. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
2334. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
2335. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
2336. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
2337. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
2338. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
2339. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
2340. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
2341. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
2342. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
2343. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
2344. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
2345. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
2346. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
2347. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
2348. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
2349. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
2350. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
2351. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
2352. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
2353. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
2354. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
2355. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
2356. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
2357. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
2358. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
2359. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
2360. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
2361. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
2362. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
2363. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
2364. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
2365. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
2366. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
2367. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
2368. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
2369. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
2370. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
2371. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
2372. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
2373. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
2374. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
2375. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
2376. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
2377. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
2378. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
2379. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
2380. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
2381. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
2382. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
2383. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
2384. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
2385. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
2386. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
2387. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
2388. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
2389. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
2390. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
2391. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
2392. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
2393. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
2394. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
2395. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
2396. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
2397. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
2398. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
2399. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
2400. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
2401. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
2402. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
2403. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
2404. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
2405. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
2406. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
2407. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
2408. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
2409. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
2410. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
2411. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
2412. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
2413. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
2414. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
2415. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
2416. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
2417. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
2418. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
2419. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2420. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2421. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2422. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2423. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2424. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2425. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2426. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2427. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2428. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2429. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2430. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2431. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2432. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2433. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2434. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2435. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2436. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2437. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2438. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2439. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2440. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2441. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2442. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2443. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2444. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2445. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2446. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2447. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2448. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2449. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2450. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2451. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2452. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2453. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2454. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2455. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2456. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2457. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2458. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2459. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2460. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2461. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2462. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2463. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2464. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2465. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2466. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2467. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2468. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2469. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2470. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2471. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2472. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2473. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2474. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2475. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2476. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2477. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2478. gbinv1.seq - Invertebrate sequence entries, part 1.
2479. gbinv10.seq - Invertebrate sequence entries, part 10.
2480. gbinv100.seq - Invertebrate sequence entries, part 100.
2481. gbinv1000.seq - Invertebrate sequence entries, part 1000.
2482. gbinv1001.seq - Invertebrate sequence entries, part 1001.
2483. gbinv1002.seq - Invertebrate sequence entries, part 1002.
2484. gbinv1003.seq - Invertebrate sequence entries, part 1003.
2485. gbinv1004.seq - Invertebrate sequence entries, part 1004.
2486. gbinv1005.seq - Invertebrate sequence entries, part 1005.
2487. gbinv1006.seq - Invertebrate sequence entries, part 1006.
2488. gbinv1007.seq - Invertebrate sequence entries, part 1007.
2489. gbinv1008.seq - Invertebrate sequence entries, part 1008.
2490. gbinv1009.seq - Invertebrate sequence entries, part 1009.
2491. gbinv101.seq - Invertebrate sequence entries, part 101.
2492. gbinv1010.seq - Invertebrate sequence entries, part 1010.
2493. gbinv1011.seq - Invertebrate sequence entries, part 1011.
2494. gbinv1012.seq - Invertebrate sequence entries, part 1012.
2495. gbinv1013.seq - Invertebrate sequence entries, part 1013.
2496. gbinv1014.seq - Invertebrate sequence entries, part 1014.
2497. gbinv1015.seq - Invertebrate sequence entries, part 1015.
2498. gbinv1016.seq - Invertebrate sequence entries, part 1016.
2499. gbinv1017.seq - Invertebrate sequence entries, part 1017.
2500. gbinv1018.seq - Invertebrate sequence entries, part 1018.
2501. gbinv1019.seq - Invertebrate sequence entries, part 1019.
2502. gbinv102.seq - Invertebrate sequence entries, part 102.
2503. gbinv1020.seq - Invertebrate sequence entries, part 1020.
2504. gbinv1021.seq - Invertebrate sequence entries, part 1021.
2505. gbinv1022.seq - Invertebrate sequence entries, part 1022.
2506. gbinv1023.seq - Invertebrate sequence entries, part 1023.
2507. gbinv1024.seq - Invertebrate sequence entries, part 1024.
2508. gbinv1025.seq - Invertebrate sequence entries, part 1025.
2509. gbinv1026.seq - Invertebrate sequence entries, part 1026.
2510. gbinv1027.seq - Invertebrate sequence entries, part 1027.
2511. gbinv1028.seq - Invertebrate sequence entries, part 1028.
2512. gbinv1029.seq - Invertebrate sequence entries, part 1029.
2513. gbinv103.seq - Invertebrate sequence entries, part 103.
2514. gbinv1030.seq - Invertebrate sequence entries, part 1030.
2515. gbinv1031.seq - Invertebrate sequence entries, part 1031.
2516. gbinv1032.seq - Invertebrate sequence entries, part 1032.
2517. gbinv1033.seq - Invertebrate sequence entries, part 1033.
2518. gbinv1034.seq - Invertebrate sequence entries, part 1034.
2519. gbinv1035.seq - Invertebrate sequence entries, part 1035.
2520. gbinv1036.seq - Invertebrate sequence entries, part 1036.
2521. gbinv1037.seq - Invertebrate sequence entries, part 1037.
2522. gbinv1038.seq - Invertebrate sequence entries, part 1038.
2523. gbinv1039.seq - Invertebrate sequence entries, part 1039.
2524. gbinv104.seq - Invertebrate sequence entries, part 104.
2525. gbinv1040.seq - Invertebrate sequence entries, part 1040.
2526. gbinv1041.seq - Invertebrate sequence entries, part 1041.
2527. gbinv1042.seq - Invertebrate sequence entries, part 1042.
2528. gbinv1043.seq - Invertebrate sequence entries, part 1043.
2529. gbinv1044.seq - Invertebrate sequence entries, part 1044.
2530. gbinv1045.seq - Invertebrate sequence entries, part 1045.
2531. gbinv1046.seq - Invertebrate sequence entries, part 1046.
2532. gbinv1047.seq - Invertebrate sequence entries, part 1047.
2533. gbinv1048.seq - Invertebrate sequence entries, part 1048.
2534. gbinv1049.seq - Invertebrate sequence entries, part 1049.
2535. gbinv105.seq - Invertebrate sequence entries, part 105.
2536. gbinv1050.seq - Invertebrate sequence entries, part 1050.
2537. gbinv1051.seq - Invertebrate sequence entries, part 1051.
2538. gbinv1052.seq - Invertebrate sequence entries, part 1052.
2539. gbinv1053.seq - Invertebrate sequence entries, part 1053.
2540. gbinv1054.seq - Invertebrate sequence entries, part 1054.
2541. gbinv1055.seq - Invertebrate sequence entries, part 1055.
2542. gbinv1056.seq - Invertebrate sequence entries, part 1056.
2543. gbinv1057.seq - Invertebrate sequence entries, part 1057.
2544. gbinv1058.seq - Invertebrate sequence entries, part 1058.
2545. gbinv1059.seq - Invertebrate sequence entries, part 1059.
2546. gbinv106.seq - Invertebrate sequence entries, part 106.
2547. gbinv1060.seq - Invertebrate sequence entries, part 1060.
2548. gbinv1061.seq - Invertebrate sequence entries, part 1061.
2549. gbinv1062.seq - Invertebrate sequence entries, part 1062.
2550. gbinv1063.seq - Invertebrate sequence entries, part 1063.
2551. gbinv1064.seq - Invertebrate sequence entries, part 1064.
2552. gbinv1065.seq - Invertebrate sequence entries, part 1065.
2553. gbinv1066.seq - Invertebrate sequence entries, part 1066.
2554. gbinv1067.seq - Invertebrate sequence entries, part 1067.
2555. gbinv1068.seq - Invertebrate sequence entries, part 1068.
2556. gbinv1069.seq - Invertebrate sequence entries, part 1069.
2557. gbinv107.seq - Invertebrate sequence entries, part 107.
2558. gbinv1070.seq - Invertebrate sequence entries, part 1070.
2559. gbinv1071.seq - Invertebrate sequence entries, part 1071.
2560. gbinv1072.seq - Invertebrate sequence entries, part 1072.
2561. gbinv1073.seq - Invertebrate sequence entries, part 1073.
2562. gbinv1074.seq - Invertebrate sequence entries, part 1074.
2563. gbinv1075.seq - Invertebrate sequence entries, part 1075.
2564. gbinv1076.seq - Invertebrate sequence entries, part 1076.
2565. gbinv1077.seq - Invertebrate sequence entries, part 1077.
2566. gbinv1078.seq - Invertebrate sequence entries, part 1078.
2567. gbinv1079.seq - Invertebrate sequence entries, part 1079.
2568. gbinv108.seq - Invertebrate sequence entries, part 108.
2569. gbinv1080.seq - Invertebrate sequence entries, part 1080.
2570. gbinv1081.seq - Invertebrate sequence entries, part 1081.
2571. gbinv1082.seq - Invertebrate sequence entries, part 1082.
2572. gbinv1083.seq - Invertebrate sequence entries, part 1083.
2573. gbinv1084.seq - Invertebrate sequence entries, part 1084.
2574. gbinv1085.seq - Invertebrate sequence entries, part 1085.
2575. gbinv1086.seq - Invertebrate sequence entries, part 1086.
2576. gbinv1087.seq - Invertebrate sequence entries, part 1087.
2577. gbinv1088.seq - Invertebrate sequence entries, part 1088.
2578. gbinv1089.seq - Invertebrate sequence entries, part 1089.
2579. gbinv109.seq - Invertebrate sequence entries, part 109.
2580. gbinv1090.seq - Invertebrate sequence entries, part 1090.
2581. gbinv1091.seq - Invertebrate sequence entries, part 1091.
2582. gbinv1092.seq - Invertebrate sequence entries, part 1092.
2583. gbinv1093.seq - Invertebrate sequence entries, part 1093.
2584. gbinv1094.seq - Invertebrate sequence entries, part 1094.
2585. gbinv1095.seq - Invertebrate sequence entries, part 1095.
2586. gbinv1096.seq - Invertebrate sequence entries, part 1096.
2587. gbinv1097.seq - Invertebrate sequence entries, part 1097.
2588. gbinv1098.seq - Invertebrate sequence entries, part 1098.
2589. gbinv1099.seq - Invertebrate sequence entries, part 1099.
2590. gbinv11.seq - Invertebrate sequence entries, part 11.
2591. gbinv110.seq - Invertebrate sequence entries, part 110.
2592. gbinv1100.seq - Invertebrate sequence entries, part 1100.
2593. gbinv1101.seq - Invertebrate sequence entries, part 1101.
2594. gbinv1102.seq - Invertebrate sequence entries, part 1102.
2595. gbinv1103.seq - Invertebrate sequence entries, part 1103.
2596. gbinv1104.seq - Invertebrate sequence entries, part 1104.
2597. gbinv1105.seq - Invertebrate sequence entries, part 1105.
2598. gbinv1106.seq - Invertebrate sequence entries, part 1106.
2599. gbinv1107.seq - Invertebrate sequence entries, part 1107.
2600. gbinv1108.seq - Invertebrate sequence entries, part 1108.
2601. gbinv1109.seq - Invertebrate sequence entries, part 1109.
2602. gbinv111.seq - Invertebrate sequence entries, part 111.
2603. gbinv1110.seq - Invertebrate sequence entries, part 1110.
2604. gbinv1111.seq - Invertebrate sequence entries, part 1111.
2605. gbinv1112.seq - Invertebrate sequence entries, part 1112.
2606. gbinv1113.seq - Invertebrate sequence entries, part 1113.
2607. gbinv1114.seq - Invertebrate sequence entries, part 1114.
2608. gbinv1115.seq - Invertebrate sequence entries, part 1115.
2609. gbinv1116.seq - Invertebrate sequence entries, part 1116.
2610. gbinv1117.seq - Invertebrate sequence entries, part 1117.
2611. gbinv1118.seq - Invertebrate sequence entries, part 1118.
2612. gbinv1119.seq - Invertebrate sequence entries, part 1119.
2613. gbinv112.seq - Invertebrate sequence entries, part 112.
2614. gbinv1120.seq - Invertebrate sequence entries, part 1120.
2615. gbinv1121.seq - Invertebrate sequence entries, part 1121.
2616. gbinv1122.seq - Invertebrate sequence entries, part 1122.
2617. gbinv1123.seq - Invertebrate sequence entries, part 1123.
2618. gbinv1124.seq - Invertebrate sequence entries, part 1124.
2619. gbinv1125.seq - Invertebrate sequence entries, part 1125.
2620. gbinv1126.seq - Invertebrate sequence entries, part 1126.
2621. gbinv1127.seq - Invertebrate sequence entries, part 1127.
2622. gbinv1128.seq - Invertebrate sequence entries, part 1128.
2623. gbinv1129.seq - Invertebrate sequence entries, part 1129.
2624. gbinv113.seq - Invertebrate sequence entries, part 113.
2625. gbinv1130.seq - Invertebrate sequence entries, part 1130.
2626. gbinv1131.seq - Invertebrate sequence entries, part 1131.
2627. gbinv1132.seq - Invertebrate sequence entries, part 1132.
2628. gbinv1133.seq - Invertebrate sequence entries, part 1133.
2629. gbinv1134.seq - Invertebrate sequence entries, part 1134.
2630. gbinv1135.seq - Invertebrate sequence entries, part 1135.
2631. gbinv1136.seq - Invertebrate sequence entries, part 1136.
2632. gbinv1137.seq - Invertebrate sequence entries, part 1137.
2633. gbinv1138.seq - Invertebrate sequence entries, part 1138.
2634. gbinv1139.seq - Invertebrate sequence entries, part 1139.
2635. gbinv114.seq - Invertebrate sequence entries, part 114.
2636. gbinv1140.seq - Invertebrate sequence entries, part 1140.
2637. gbinv1141.seq - Invertebrate sequence entries, part 1141.
2638. gbinv1142.seq - Invertebrate sequence entries, part 1142.
2639. gbinv1143.seq - Invertebrate sequence entries, part 1143.
2640. gbinv1144.seq - Invertebrate sequence entries, part 1144.
2641. gbinv1145.seq - Invertebrate sequence entries, part 1145.
2642. gbinv1146.seq - Invertebrate sequence entries, part 1146.
2643. gbinv1147.seq - Invertebrate sequence entries, part 1147.
2644. gbinv1148.seq - Invertebrate sequence entries, part 1148.
2645. gbinv1149.seq - Invertebrate sequence entries, part 1149.
2646. gbinv115.seq - Invertebrate sequence entries, part 115.
2647. gbinv1150.seq - Invertebrate sequence entries, part 1150.
2648. gbinv1151.seq - Invertebrate sequence entries, part 1151.
2649. gbinv1152.seq - Invertebrate sequence entries, part 1152.
2650. gbinv1153.seq - Invertebrate sequence entries, part 1153.
2651. gbinv1154.seq - Invertebrate sequence entries, part 1154.
2652. gbinv1155.seq - Invertebrate sequence entries, part 1155.
2653. gbinv1156.seq - Invertebrate sequence entries, part 1156.
2654. gbinv1157.seq - Invertebrate sequence entries, part 1157.
2655. gbinv1158.seq - Invertebrate sequence entries, part 1158.
2656. gbinv1159.seq - Invertebrate sequence entries, part 1159.
2657. gbinv116.seq - Invertebrate sequence entries, part 116.
2658. gbinv1160.seq - Invertebrate sequence entries, part 1160.
2659. gbinv1161.seq - Invertebrate sequence entries, part 1161.
2660. gbinv1162.seq - Invertebrate sequence entries, part 1162.
2661. gbinv1163.seq - Invertebrate sequence entries, part 1163.
2662. gbinv1164.seq - Invertebrate sequence entries, part 1164.
2663. gbinv1165.seq - Invertebrate sequence entries, part 1165.
2664. gbinv1166.seq - Invertebrate sequence entries, part 1166.
2665. gbinv1167.seq - Invertebrate sequence entries, part 1167.
2666. gbinv1168.seq - Invertebrate sequence entries, part 1168.
2667. gbinv1169.seq - Invertebrate sequence entries, part 1169.
2668. gbinv117.seq - Invertebrate sequence entries, part 117.
2669. gbinv1170.seq - Invertebrate sequence entries, part 1170.
2670. gbinv1171.seq - Invertebrate sequence entries, part 1171.
2671. gbinv1172.seq - Invertebrate sequence entries, part 1172.
2672. gbinv1173.seq - Invertebrate sequence entries, part 1173.
2673. gbinv1174.seq - Invertebrate sequence entries, part 1174.
2674. gbinv1175.seq - Invertebrate sequence entries, part 1175.
2675. gbinv1176.seq - Invertebrate sequence entries, part 1176.
2676. gbinv1177.seq - Invertebrate sequence entries, part 1177.
2677. gbinv1178.seq - Invertebrate sequence entries, part 1178.
2678. gbinv1179.seq - Invertebrate sequence entries, part 1179.
2679. gbinv118.seq - Invertebrate sequence entries, part 118.
2680. gbinv1180.seq - Invertebrate sequence entries, part 1180.
2681. gbinv1181.seq - Invertebrate sequence entries, part 1181.
2682. gbinv1182.seq - Invertebrate sequence entries, part 1182.
2683. gbinv1183.seq - Invertebrate sequence entries, part 1183.
2684. gbinv1184.seq - Invertebrate sequence entries, part 1184.
2685. gbinv1185.seq - Invertebrate sequence entries, part 1185.
2686. gbinv1186.seq - Invertebrate sequence entries, part 1186.
2687. gbinv1187.seq - Invertebrate sequence entries, part 1187.
2688. gbinv1188.seq - Invertebrate sequence entries, part 1188.
2689. gbinv1189.seq - Invertebrate sequence entries, part 1189.
2690. gbinv119.seq - Invertebrate sequence entries, part 119.
2691. gbinv1190.seq - Invertebrate sequence entries, part 1190.
2692. gbinv1191.seq - Invertebrate sequence entries, part 1191.
2693. gbinv1192.seq - Invertebrate sequence entries, part 1192.
2694. gbinv1193.seq - Invertebrate sequence entries, part 1193.
2695. gbinv1194.seq - Invertebrate sequence entries, part 1194.
2696. gbinv1195.seq - Invertebrate sequence entries, part 1195.
2697. gbinv1196.seq - Invertebrate sequence entries, part 1196.
2698. gbinv1197.seq - Invertebrate sequence entries, part 1197.
2699. gbinv1198.seq - Invertebrate sequence entries, part 1198.
2700. gbinv1199.seq - Invertebrate sequence entries, part 1199.
2701. gbinv12.seq - Invertebrate sequence entries, part 12.
2702. gbinv120.seq - Invertebrate sequence entries, part 120.
2703. gbinv1200.seq - Invertebrate sequence entries, part 1200.
2704. gbinv1201.seq - Invertebrate sequence entries, part 1201.
2705. gbinv1202.seq - Invertebrate sequence entries, part 1202.
2706. gbinv1203.seq - Invertebrate sequence entries, part 1203.
2707. gbinv1204.seq - Invertebrate sequence entries, part 1204.
2708. gbinv1205.seq - Invertebrate sequence entries, part 1205.
2709. gbinv1206.seq - Invertebrate sequence entries, part 1206.
2710. gbinv1207.seq - Invertebrate sequence entries, part 1207.
2711. gbinv1208.seq - Invertebrate sequence entries, part 1208.
2712. gbinv1209.seq - Invertebrate sequence entries, part 1209.
2713. gbinv121.seq - Invertebrate sequence entries, part 121.
2714. gbinv1210.seq - Invertebrate sequence entries, part 1210.
2715. gbinv1211.seq - Invertebrate sequence entries, part 1211.
2716. gbinv1212.seq - Invertebrate sequence entries, part 1212.
2717. gbinv1213.seq - Invertebrate sequence entries, part 1213.
2718. gbinv1214.seq - Invertebrate sequence entries, part 1214.
2719. gbinv1215.seq - Invertebrate sequence entries, part 1215.
2720. gbinv1216.seq - Invertebrate sequence entries, part 1216.
2721. gbinv1217.seq - Invertebrate sequence entries, part 1217.
2722. gbinv1218.seq - Invertebrate sequence entries, part 1218.
2723. gbinv1219.seq - Invertebrate sequence entries, part 1219.
2724. gbinv122.seq - Invertebrate sequence entries, part 122.
2725. gbinv1220.seq - Invertebrate sequence entries, part 1220.
2726. gbinv1221.seq - Invertebrate sequence entries, part 1221.
2727. gbinv1222.seq - Invertebrate sequence entries, part 1222.
2728. gbinv1223.seq - Invertebrate sequence entries, part 1223.
2729. gbinv1224.seq - Invertebrate sequence entries, part 1224.
2730. gbinv1225.seq - Invertebrate sequence entries, part 1225.
2731. gbinv1226.seq - Invertebrate sequence entries, part 1226.
2732. gbinv1227.seq - Invertebrate sequence entries, part 1227.
2733. gbinv1228.seq - Invertebrate sequence entries, part 1228.
2734. gbinv1229.seq - Invertebrate sequence entries, part 1229.
2735. gbinv123.seq - Invertebrate sequence entries, part 123.
2736. gbinv1230.seq - Invertebrate sequence entries, part 1230.
2737. gbinv1231.seq - Invertebrate sequence entries, part 1231.
2738. gbinv1232.seq - Invertebrate sequence entries, part 1232.
2739. gbinv1233.seq - Invertebrate sequence entries, part 1233.
2740. gbinv1234.seq - Invertebrate sequence entries, part 1234.
2741. gbinv1235.seq - Invertebrate sequence entries, part 1235.
2742. gbinv1236.seq - Invertebrate sequence entries, part 1236.
2743. gbinv1237.seq - Invertebrate sequence entries, part 1237.
2744. gbinv1238.seq - Invertebrate sequence entries, part 1238.
2745. gbinv1239.seq - Invertebrate sequence entries, part 1239.
2746. gbinv124.seq - Invertebrate sequence entries, part 124.
2747. gbinv1240.seq - Invertebrate sequence entries, part 1240.
2748. gbinv1241.seq - Invertebrate sequence entries, part 1241.
2749. gbinv1242.seq - Invertebrate sequence entries, part 1242.
2750. gbinv1243.seq - Invertebrate sequence entries, part 1243.
2751. gbinv1244.seq - Invertebrate sequence entries, part 1244.
2752. gbinv1245.seq - Invertebrate sequence entries, part 1245.
2753. gbinv1246.seq - Invertebrate sequence entries, part 1246.
2754. gbinv1247.seq - Invertebrate sequence entries, part 1247.
2755. gbinv1248.seq - Invertebrate sequence entries, part 1248.
2756. gbinv1249.seq - Invertebrate sequence entries, part 1249.
2757. gbinv125.seq - Invertebrate sequence entries, part 125.
2758. gbinv1250.seq - Invertebrate sequence entries, part 1250.
2759. gbinv1251.seq - Invertebrate sequence entries, part 1251.
2760. gbinv1252.seq - Invertebrate sequence entries, part 1252.
2761. gbinv1253.seq - Invertebrate sequence entries, part 1253.
2762. gbinv1254.seq - Invertebrate sequence entries, part 1254.
2763. gbinv1255.seq - Invertebrate sequence entries, part 1255.
2764. gbinv1256.seq - Invertebrate sequence entries, part 1256.
2765. gbinv1257.seq - Invertebrate sequence entries, part 1257.
2766. gbinv1258.seq - Invertebrate sequence entries, part 1258.
2767. gbinv1259.seq - Invertebrate sequence entries, part 1259.
2768. gbinv126.seq - Invertebrate sequence entries, part 126.
2769. gbinv1260.seq - Invertebrate sequence entries, part 1260.
2770. gbinv1261.seq - Invertebrate sequence entries, part 1261.
2771. gbinv1262.seq - Invertebrate sequence entries, part 1262.
2772. gbinv1263.seq - Invertebrate sequence entries, part 1263.
2773. gbinv1264.seq - Invertebrate sequence entries, part 1264.
2774. gbinv1265.seq - Invertebrate sequence entries, part 1265.
2775. gbinv1266.seq - Invertebrate sequence entries, part 1266.
2776. gbinv1267.seq - Invertebrate sequence entries, part 1267.
2777. gbinv1268.seq - Invertebrate sequence entries, part 1268.
2778. gbinv1269.seq - Invertebrate sequence entries, part 1269.
2779. gbinv127.seq - Invertebrate sequence entries, part 127.
2780. gbinv1270.seq - Invertebrate sequence entries, part 1270.
2781. gbinv1271.seq - Invertebrate sequence entries, part 1271.
2782. gbinv1272.seq - Invertebrate sequence entries, part 1272.
2783. gbinv1273.seq - Invertebrate sequence entries, part 1273.
2784. gbinv1274.seq - Invertebrate sequence entries, part 1274.
2785. gbinv1275.seq - Invertebrate sequence entries, part 1275.
2786. gbinv1276.seq - Invertebrate sequence entries, part 1276.
2787. gbinv1277.seq - Invertebrate sequence entries, part 1277.
2788. gbinv1278.seq - Invertebrate sequence entries, part 1278.
2789. gbinv1279.seq - Invertebrate sequence entries, part 1279.
2790. gbinv128.seq - Invertebrate sequence entries, part 128.
2791. gbinv1280.seq - Invertebrate sequence entries, part 1280.
2792. gbinv1281.seq - Invertebrate sequence entries, part 1281.
2793. gbinv1282.seq - Invertebrate sequence entries, part 1282.
2794. gbinv1283.seq - Invertebrate sequence entries, part 1283.
2795. gbinv1284.seq - Invertebrate sequence entries, part 1284.
2796. gbinv1285.seq - Invertebrate sequence entries, part 1285.
2797. gbinv1286.seq - Invertebrate sequence entries, part 1286.
2798. gbinv1287.seq - Invertebrate sequence entries, part 1287.
2799. gbinv1288.seq - Invertebrate sequence entries, part 1288.
2800. gbinv1289.seq - Invertebrate sequence entries, part 1289.
2801. gbinv129.seq - Invertebrate sequence entries, part 129.
2802. gbinv1290.seq - Invertebrate sequence entries, part 1290.
2803. gbinv1291.seq - Invertebrate sequence entries, part 1291.
2804. gbinv1292.seq - Invertebrate sequence entries, part 1292.
2805. gbinv1293.seq - Invertebrate sequence entries, part 1293.
2806. gbinv1294.seq - Invertebrate sequence entries, part 1294.
2807. gbinv1295.seq - Invertebrate sequence entries, part 1295.
2808. gbinv1296.seq - Invertebrate sequence entries, part 1296.
2809. gbinv1297.seq - Invertebrate sequence entries, part 1297.
2810. gbinv1298.seq - Invertebrate sequence entries, part 1298.
2811. gbinv1299.seq - Invertebrate sequence entries, part 1299.
2812. gbinv13.seq - Invertebrate sequence entries, part 13.
2813. gbinv130.seq - Invertebrate sequence entries, part 130.
2814. gbinv1300.seq - Invertebrate sequence entries, part 1300.
2815. gbinv1301.seq - Invertebrate sequence entries, part 1301.
2816. gbinv1302.seq - Invertebrate sequence entries, part 1302.
2817. gbinv1303.seq - Invertebrate sequence entries, part 1303.
2818. gbinv1304.seq - Invertebrate sequence entries, part 1304.
2819. gbinv1305.seq - Invertebrate sequence entries, part 1305.
2820. gbinv1306.seq - Invertebrate sequence entries, part 1306.
2821. gbinv1307.seq - Invertebrate sequence entries, part 1307.
2822. gbinv1308.seq - Invertebrate sequence entries, part 1308.
2823. gbinv1309.seq - Invertebrate sequence entries, part 1309.
2824. gbinv131.seq - Invertebrate sequence entries, part 131.
2825. gbinv1310.seq - Invertebrate sequence entries, part 1310.
2826. gbinv1311.seq - Invertebrate sequence entries, part 1311.
2827. gbinv1312.seq - Invertebrate sequence entries, part 1312.
2828. gbinv1313.seq - Invertebrate sequence entries, part 1313.
2829. gbinv1314.seq - Invertebrate sequence entries, part 1314.
2830. gbinv1315.seq - Invertebrate sequence entries, part 1315.
2831. gbinv1316.seq - Invertebrate sequence entries, part 1316.
2832. gbinv1317.seq - Invertebrate sequence entries, part 1317.
2833. gbinv1318.seq - Invertebrate sequence entries, part 1318.
2834. gbinv1319.seq - Invertebrate sequence entries, part 1319.
2835. gbinv132.seq - Invertebrate sequence entries, part 132.
2836. gbinv1320.seq - Invertebrate sequence entries, part 1320.
2837. gbinv1321.seq - Invertebrate sequence entries, part 1321.
2838. gbinv1322.seq - Invertebrate sequence entries, part 1322.
2839. gbinv1323.seq - Invertebrate sequence entries, part 1323.
2840. gbinv1324.seq - Invertebrate sequence entries, part 1324.
2841. gbinv1325.seq - Invertebrate sequence entries, part 1325.
2842. gbinv1326.seq - Invertebrate sequence entries, part 1326.
2843. gbinv1327.seq - Invertebrate sequence entries, part 1327.
2844. gbinv1328.seq - Invertebrate sequence entries, part 1328.
2845. gbinv1329.seq - Invertebrate sequence entries, part 1329.
2846. gbinv133.seq - Invertebrate sequence entries, part 133.
2847. gbinv1330.seq - Invertebrate sequence entries, part 1330.
2848. gbinv1331.seq - Invertebrate sequence entries, part 1331.
2849. gbinv1332.seq - Invertebrate sequence entries, part 1332.
2850. gbinv1333.seq - Invertebrate sequence entries, part 1333.
2851. gbinv1334.seq - Invertebrate sequence entries, part 1334.
2852. gbinv1335.seq - Invertebrate sequence entries, part 1335.
2853. gbinv1336.seq - Invertebrate sequence entries, part 1336.
2854. gbinv1337.seq - Invertebrate sequence entries, part 1337.
2855. gbinv1338.seq - Invertebrate sequence entries, part 1338.
2856. gbinv1339.seq - Invertebrate sequence entries, part 1339.
2857. gbinv134.seq - Invertebrate sequence entries, part 134.
2858. gbinv1340.seq - Invertebrate sequence entries, part 1340.
2859. gbinv1341.seq - Invertebrate sequence entries, part 1341.
2860. gbinv1342.seq - Invertebrate sequence entries, part 1342.
2861. gbinv1343.seq - Invertebrate sequence entries, part 1343.
2862. gbinv1344.seq - Invertebrate sequence entries, part 1344.
2863. gbinv1345.seq - Invertebrate sequence entries, part 1345.
2864. gbinv1346.seq - Invertebrate sequence entries, part 1346.
2865. gbinv1347.seq - Invertebrate sequence entries, part 1347.
2866. gbinv1348.seq - Invertebrate sequence entries, part 1348.
2867. gbinv1349.seq - Invertebrate sequence entries, part 1349.
2868. gbinv135.seq - Invertebrate sequence entries, part 135.
2869. gbinv1350.seq - Invertebrate sequence entries, part 1350.
2870. gbinv1351.seq - Invertebrate sequence entries, part 1351.
2871. gbinv1352.seq - Invertebrate sequence entries, part 1352.
2872. gbinv1353.seq - Invertebrate sequence entries, part 1353.
2873. gbinv1354.seq - Invertebrate sequence entries, part 1354.
2874. gbinv1355.seq - Invertebrate sequence entries, part 1355.
2875. gbinv1356.seq - Invertebrate sequence entries, part 1356.
2876. gbinv1357.seq - Invertebrate sequence entries, part 1357.
2877. gbinv1358.seq - Invertebrate sequence entries, part 1358.
2878. gbinv1359.seq - Invertebrate sequence entries, part 1359.
2879. gbinv136.seq - Invertebrate sequence entries, part 136.
2880. gbinv1360.seq - Invertebrate sequence entries, part 1360.
2881. gbinv1361.seq - Invertebrate sequence entries, part 1361.
2882. gbinv1362.seq - Invertebrate sequence entries, part 1362.
2883. gbinv1363.seq - Invertebrate sequence entries, part 1363.
2884. gbinv1364.seq - Invertebrate sequence entries, part 1364.
2885. gbinv1365.seq - Invertebrate sequence entries, part 1365.
2886. gbinv1366.seq - Invertebrate sequence entries, part 1366.
2887. gbinv1367.seq - Invertebrate sequence entries, part 1367.
2888. gbinv1368.seq - Invertebrate sequence entries, part 1368.
2889. gbinv1369.seq - Invertebrate sequence entries, part 1369.
2890. gbinv137.seq - Invertebrate sequence entries, part 137.
2891. gbinv1370.seq - Invertebrate sequence entries, part 1370.
2892. gbinv1371.seq - Invertebrate sequence entries, part 1371.
2893. gbinv1372.seq - Invertebrate sequence entries, part 1372.
2894. gbinv1373.seq - Invertebrate sequence entries, part 1373.
2895. gbinv1374.seq - Invertebrate sequence entries, part 1374.
2896. gbinv1375.seq - Invertebrate sequence entries, part 1375.
2897. gbinv1376.seq - Invertebrate sequence entries, part 1376.
2898. gbinv1377.seq - Invertebrate sequence entries, part 1377.
2899. gbinv1378.seq - Invertebrate sequence entries, part 1378.
2900. gbinv1379.seq - Invertebrate sequence entries, part 1379.
2901. gbinv138.seq - Invertebrate sequence entries, part 138.
2902. gbinv1380.seq - Invertebrate sequence entries, part 1380.
2903. gbinv1381.seq - Invertebrate sequence entries, part 1381.
2904. gbinv1382.seq - Invertebrate sequence entries, part 1382.
2905. gbinv1383.seq - Invertebrate sequence entries, part 1383.
2906. gbinv1384.seq - Invertebrate sequence entries, part 1384.
2907. gbinv1385.seq - Invertebrate sequence entries, part 1385.
2908. gbinv1386.seq - Invertebrate sequence entries, part 1386.
2909. gbinv1387.seq - Invertebrate sequence entries, part 1387.
2910. gbinv1388.seq - Invertebrate sequence entries, part 1388.
2911. gbinv1389.seq - Invertebrate sequence entries, part 1389.
2912. gbinv139.seq - Invertebrate sequence entries, part 139.
2913. gbinv1390.seq - Invertebrate sequence entries, part 1390.
2914. gbinv1391.seq - Invertebrate sequence entries, part 1391.
2915. gbinv1392.seq - Invertebrate sequence entries, part 1392.
2916. gbinv1393.seq - Invertebrate sequence entries, part 1393.
2917. gbinv1394.seq - Invertebrate sequence entries, part 1394.
2918. gbinv1395.seq - Invertebrate sequence entries, part 1395.
2919. gbinv1396.seq - Invertebrate sequence entries, part 1396.
2920. gbinv1397.seq - Invertebrate sequence entries, part 1397.
2921. gbinv1398.seq - Invertebrate sequence entries, part 1398.
2922. gbinv1399.seq - Invertebrate sequence entries, part 1399.
2923. gbinv14.seq - Invertebrate sequence entries, part 14.
2924. gbinv140.seq - Invertebrate sequence entries, part 140.
2925. gbinv1400.seq - Invertebrate sequence entries, part 1400.
2926. gbinv1401.seq - Invertebrate sequence entries, part 1401.
2927. gbinv1402.seq - Invertebrate sequence entries, part 1402.
2928. gbinv1403.seq - Invertebrate sequence entries, part 1403.
2929. gbinv1404.seq - Invertebrate sequence entries, part 1404.
2930. gbinv1405.seq - Invertebrate sequence entries, part 1405.
2931. gbinv1406.seq - Invertebrate sequence entries, part 1406.
2932. gbinv1407.seq - Invertebrate sequence entries, part 1407.
2933. gbinv1408.seq - Invertebrate sequence entries, part 1408.
2934. gbinv1409.seq - Invertebrate sequence entries, part 1409.
2935. gbinv141.seq - Invertebrate sequence entries, part 141.
2936. gbinv1410.seq - Invertebrate sequence entries, part 1410.
2937. gbinv1411.seq - Invertebrate sequence entries, part 1411.
2938. gbinv1412.seq - Invertebrate sequence entries, part 1412.
2939. gbinv1413.seq - Invertebrate sequence entries, part 1413.
2940. gbinv1414.seq - Invertebrate sequence entries, part 1414.
2941. gbinv1415.seq - Invertebrate sequence entries, part 1415.
2942. gbinv1416.seq - Invertebrate sequence entries, part 1416.
2943. gbinv1417.seq - Invertebrate sequence entries, part 1417.
2944. gbinv1418.seq - Invertebrate sequence entries, part 1418.
2945. gbinv1419.seq - Invertebrate sequence entries, part 1419.
2946. gbinv142.seq - Invertebrate sequence entries, part 142.
2947. gbinv1420.seq - Invertebrate sequence entries, part 1420.
2948. gbinv1421.seq - Invertebrate sequence entries, part 1421.
2949. gbinv1422.seq - Invertebrate sequence entries, part 1422.
2950. gbinv1423.seq - Invertebrate sequence entries, part 1423.
2951. gbinv1424.seq - Invertebrate sequence entries, part 1424.
2952. gbinv1425.seq - Invertebrate sequence entries, part 1425.
2953. gbinv1426.seq - Invertebrate sequence entries, part 1426.
2954. gbinv1427.seq - Invertebrate sequence entries, part 1427.
2955. gbinv1428.seq - Invertebrate sequence entries, part 1428.
2956. gbinv1429.seq - Invertebrate sequence entries, part 1429.
2957. gbinv143.seq - Invertebrate sequence entries, part 143.
2958. gbinv1430.seq - Invertebrate sequence entries, part 1430.
2959. gbinv1431.seq - Invertebrate sequence entries, part 1431.
2960. gbinv1432.seq - Invertebrate sequence entries, part 1432.
2961. gbinv1433.seq - Invertebrate sequence entries, part 1433.
2962. gbinv1434.seq - Invertebrate sequence entries, part 1434.
2963. gbinv1435.seq - Invertebrate sequence entries, part 1435.
2964. gbinv1436.seq - Invertebrate sequence entries, part 1436.
2965. gbinv1437.seq - Invertebrate sequence entries, part 1437.
2966. gbinv1438.seq - Invertebrate sequence entries, part 1438.
2967. gbinv1439.seq - Invertebrate sequence entries, part 1439.
2968. gbinv144.seq - Invertebrate sequence entries, part 144.
2969. gbinv1440.seq - Invertebrate sequence entries, part 1440.
2970. gbinv1441.seq - Invertebrate sequence entries, part 1441.
2971. gbinv1442.seq - Invertebrate sequence entries, part 1442.
2972. gbinv1443.seq - Invertebrate sequence entries, part 1443.
2973. gbinv1444.seq - Invertebrate sequence entries, part 1444.
2974. gbinv1445.seq - Invertebrate sequence entries, part 1445.
2975. gbinv1446.seq - Invertebrate sequence entries, part 1446.
2976. gbinv1447.seq - Invertebrate sequence entries, part 1447.
2977. gbinv1448.seq - Invertebrate sequence entries, part 1448.
2978. gbinv1449.seq - Invertebrate sequence entries, part 1449.
2979. gbinv145.seq - Invertebrate sequence entries, part 145.
2980. gbinv1450.seq - Invertebrate sequence entries, part 1450.
2981. gbinv1451.seq - Invertebrate sequence entries, part 1451.
2982. gbinv1452.seq - Invertebrate sequence entries, part 1452.
2983. gbinv1453.seq - Invertebrate sequence entries, part 1453.
2984. gbinv1454.seq - Invertebrate sequence entries, part 1454.
2985. gbinv1455.seq - Invertebrate sequence entries, part 1455.
2986. gbinv1456.seq - Invertebrate sequence entries, part 1456.
2987. gbinv1457.seq - Invertebrate sequence entries, part 1457.
2988. gbinv1458.seq - Invertebrate sequence entries, part 1458.
2989. gbinv1459.seq - Invertebrate sequence entries, part 1459.
2990. gbinv146.seq - Invertebrate sequence entries, part 146.
2991. gbinv1460.seq - Invertebrate sequence entries, part 1460.
2992. gbinv1461.seq - Invertebrate sequence entries, part 1461.
2993. gbinv1462.seq - Invertebrate sequence entries, part 1462.
2994. gbinv1463.seq - Invertebrate sequence entries, part 1463.
2995. gbinv1464.seq - Invertebrate sequence entries, part 1464.
2996. gbinv1465.seq - Invertebrate sequence entries, part 1465.
2997. gbinv1466.seq - Invertebrate sequence entries, part 1466.
2998. gbinv1467.seq - Invertebrate sequence entries, part 1467.
2999. gbinv1468.seq - Invertebrate sequence entries, part 1468.
3000. gbinv1469.seq - Invertebrate sequence entries, part 1469.
3001. gbinv147.seq - Invertebrate sequence entries, part 147.
3002. gbinv1470.seq - Invertebrate sequence entries, part 1470.
3003. gbinv1471.seq - Invertebrate sequence entries, part 1471.
3004. gbinv1472.seq - Invertebrate sequence entries, part 1472.
3005. gbinv1473.seq - Invertebrate sequence entries, part 1473.
3006. gbinv1474.seq - Invertebrate sequence entries, part 1474.
3007. gbinv1475.seq - Invertebrate sequence entries, part 1475.
3008. gbinv1476.seq - Invertebrate sequence entries, part 1476.
3009. gbinv1477.seq - Invertebrate sequence entries, part 1477.
3010. gbinv1478.seq - Invertebrate sequence entries, part 1478.
3011. gbinv1479.seq - Invertebrate sequence entries, part 1479.
3012. gbinv148.seq - Invertebrate sequence entries, part 148.
3013. gbinv1480.seq - Invertebrate sequence entries, part 1480.
3014. gbinv1481.seq - Invertebrate sequence entries, part 1481.
3015. gbinv1482.seq - Invertebrate sequence entries, part 1482.
3016. gbinv1483.seq - Invertebrate sequence entries, part 1483.
3017. gbinv1484.seq - Invertebrate sequence entries, part 1484.
3018. gbinv1485.seq - Invertebrate sequence entries, part 1485.
3019. gbinv1486.seq - Invertebrate sequence entries, part 1486.
3020. gbinv1487.seq - Invertebrate sequence entries, part 1487.
3021. gbinv1488.seq - Invertebrate sequence entries, part 1488.
3022. gbinv1489.seq - Invertebrate sequence entries, part 1489.
3023. gbinv149.seq - Invertebrate sequence entries, part 149.
3024. gbinv1490.seq - Invertebrate sequence entries, part 1490.
3025. gbinv1491.seq - Invertebrate sequence entries, part 1491.
3026. gbinv1492.seq - Invertebrate sequence entries, part 1492.
3027. gbinv1493.seq - Invertebrate sequence entries, part 1493.
3028. gbinv1494.seq - Invertebrate sequence entries, part 1494.
3029. gbinv1495.seq - Invertebrate sequence entries, part 1495.
3030. gbinv1496.seq - Invertebrate sequence entries, part 1496.
3031. gbinv1497.seq - Invertebrate sequence entries, part 1497.
3032. gbinv1498.seq - Invertebrate sequence entries, part 1498.
3033. gbinv1499.seq - Invertebrate sequence entries, part 1499.
3034. gbinv15.seq - Invertebrate sequence entries, part 15.
3035. gbinv150.seq - Invertebrate sequence entries, part 150.
3036. gbinv1500.seq - Invertebrate sequence entries, part 1500.
3037. gbinv1501.seq - Invertebrate sequence entries, part 1501.
3038. gbinv1502.seq - Invertebrate sequence entries, part 1502.
3039. gbinv1503.seq - Invertebrate sequence entries, part 1503.
3040. gbinv1504.seq - Invertebrate sequence entries, part 1504.
3041. gbinv1505.seq - Invertebrate sequence entries, part 1505.
3042. gbinv1506.seq - Invertebrate sequence entries, part 1506.
3043. gbinv1507.seq - Invertebrate sequence entries, part 1507.
3044. gbinv1508.seq - Invertebrate sequence entries, part 1508.
3045. gbinv1509.seq - Invertebrate sequence entries, part 1509.
3046. gbinv151.seq - Invertebrate sequence entries, part 151.
3047. gbinv1510.seq - Invertebrate sequence entries, part 1510.
3048. gbinv1511.seq - Invertebrate sequence entries, part 1511.
3049. gbinv1512.seq - Invertebrate sequence entries, part 1512.
3050. gbinv1513.seq - Invertebrate sequence entries, part 1513.
3051. gbinv1514.seq - Invertebrate sequence entries, part 1514.
3052. gbinv1515.seq - Invertebrate sequence entries, part 1515.
3053. gbinv1516.seq - Invertebrate sequence entries, part 1516.
3054. gbinv1517.seq - Invertebrate sequence entries, part 1517.
3055. gbinv1518.seq - Invertebrate sequence entries, part 1518.
3056. gbinv1519.seq - Invertebrate sequence entries, part 1519.
3057. gbinv152.seq - Invertebrate sequence entries, part 152.
3058. gbinv1520.seq - Invertebrate sequence entries, part 1520.
3059. gbinv1521.seq - Invertebrate sequence entries, part 1521.
3060. gbinv1522.seq - Invertebrate sequence entries, part 1522.
3061. gbinv1523.seq - Invertebrate sequence entries, part 1523.
3062. gbinv1524.seq - Invertebrate sequence entries, part 1524.
3063. gbinv1525.seq - Invertebrate sequence entries, part 1525.
3064. gbinv1526.seq - Invertebrate sequence entries, part 1526.
3065. gbinv1527.seq - Invertebrate sequence entries, part 1527.
3066. gbinv1528.seq - Invertebrate sequence entries, part 1528.
3067. gbinv1529.seq - Invertebrate sequence entries, part 1529.
3068. gbinv153.seq - Invertebrate sequence entries, part 153.
3069. gbinv1530.seq - Invertebrate sequence entries, part 1530.
3070. gbinv1531.seq - Invertebrate sequence entries, part 1531.
3071. gbinv1532.seq - Invertebrate sequence entries, part 1532.
3072. gbinv1533.seq - Invertebrate sequence entries, part 1533.
3073. gbinv1534.seq - Invertebrate sequence entries, part 1534.
3074. gbinv1535.seq - Invertebrate sequence entries, part 1535.
3075. gbinv1536.seq - Invertebrate sequence entries, part 1536.
3076. gbinv1537.seq - Invertebrate sequence entries, part 1537.
3077. gbinv1538.seq - Invertebrate sequence entries, part 1538.
3078. gbinv1539.seq - Invertebrate sequence entries, part 1539.
3079. gbinv154.seq - Invertebrate sequence entries, part 154.
3080. gbinv1540.seq - Invertebrate sequence entries, part 1540.
3081. gbinv1541.seq - Invertebrate sequence entries, part 1541.
3082. gbinv1542.seq - Invertebrate sequence entries, part 1542.
3083. gbinv1543.seq - Invertebrate sequence entries, part 1543.
3084. gbinv1544.seq - Invertebrate sequence entries, part 1544.
3085. gbinv1545.seq - Invertebrate sequence entries, part 1545.
3086. gbinv1546.seq - Invertebrate sequence entries, part 1546.
3087. gbinv1547.seq - Invertebrate sequence entries, part 1547.
3088. gbinv1548.seq - Invertebrate sequence entries, part 1548.
3089. gbinv1549.seq - Invertebrate sequence entries, part 1549.
3090. gbinv155.seq - Invertebrate sequence entries, part 155.
3091. gbinv1550.seq - Invertebrate sequence entries, part 1550.
3092. gbinv1551.seq - Invertebrate sequence entries, part 1551.
3093. gbinv1552.seq - Invertebrate sequence entries, part 1552.
3094. gbinv1553.seq - Invertebrate sequence entries, part 1553.
3095. gbinv1554.seq - Invertebrate sequence entries, part 1554.
3096. gbinv1555.seq - Invertebrate sequence entries, part 1555.
3097. gbinv1556.seq - Invertebrate sequence entries, part 1556.
3098. gbinv1557.seq - Invertebrate sequence entries, part 1557.
3099. gbinv1558.seq - Invertebrate sequence entries, part 1558.
3100. gbinv1559.seq - Invertebrate sequence entries, part 1559.
3101. gbinv156.seq - Invertebrate sequence entries, part 156.
3102. gbinv1560.seq - Invertebrate sequence entries, part 1560.
3103. gbinv1561.seq - Invertebrate sequence entries, part 1561.
3104. gbinv1562.seq - Invertebrate sequence entries, part 1562.
3105. gbinv1563.seq - Invertebrate sequence entries, part 1563.
3106. gbinv1564.seq - Invertebrate sequence entries, part 1564.
3107. gbinv1565.seq - Invertebrate sequence entries, part 1565.
3108. gbinv1566.seq - Invertebrate sequence entries, part 1566.
3109. gbinv1567.seq - Invertebrate sequence entries, part 1567.
3110. gbinv1568.seq - Invertebrate sequence entries, part 1568.
3111. gbinv1569.seq - Invertebrate sequence entries, part 1569.
3112. gbinv157.seq - Invertebrate sequence entries, part 157.
3113. gbinv1570.seq - Invertebrate sequence entries, part 1570.
3114. gbinv1571.seq - Invertebrate sequence entries, part 1571.
3115. gbinv1572.seq - Invertebrate sequence entries, part 1572.
3116. gbinv1573.seq - Invertebrate sequence entries, part 1573.
3117. gbinv1574.seq - Invertebrate sequence entries, part 1574.
3118. gbinv1575.seq - Invertebrate sequence entries, part 1575.
3119. gbinv1576.seq - Invertebrate sequence entries, part 1576.
3120. gbinv1577.seq - Invertebrate sequence entries, part 1577.
3121. gbinv1578.seq - Invertebrate sequence entries, part 1578.
3122. gbinv1579.seq - Invertebrate sequence entries, part 1579.
3123. gbinv158.seq - Invertebrate sequence entries, part 158.
3124. gbinv1580.seq - Invertebrate sequence entries, part 1580.
3125. gbinv1581.seq - Invertebrate sequence entries, part 1581.
3126. gbinv1582.seq - Invertebrate sequence entries, part 1582.
3127. gbinv1583.seq - Invertebrate sequence entries, part 1583.
3128. gbinv1584.seq - Invertebrate sequence entries, part 1584.
3129. gbinv1585.seq - Invertebrate sequence entries, part 1585.
3130. gbinv1586.seq - Invertebrate sequence entries, part 1586.
3131. gbinv1587.seq - Invertebrate sequence entries, part 1587.
3132. gbinv1588.seq - Invertebrate sequence entries, part 1588.
3133. gbinv1589.seq - Invertebrate sequence entries, part 1589.
3134. gbinv159.seq - Invertebrate sequence entries, part 159.
3135. gbinv1590.seq - Invertebrate sequence entries, part 1590.
3136. gbinv1591.seq - Invertebrate sequence entries, part 1591.
3137. gbinv1592.seq - Invertebrate sequence entries, part 1592.
3138. gbinv1593.seq - Invertebrate sequence entries, part 1593.
3139. gbinv1594.seq - Invertebrate sequence entries, part 1594.
3140. gbinv1595.seq - Invertebrate sequence entries, part 1595.
3141. gbinv1596.seq - Invertebrate sequence entries, part 1596.
3142. gbinv1597.seq - Invertebrate sequence entries, part 1597.
3143. gbinv1598.seq - Invertebrate sequence entries, part 1598.
3144. gbinv1599.seq - Invertebrate sequence entries, part 1599.
3145. gbinv16.seq - Invertebrate sequence entries, part 16.
3146. gbinv160.seq - Invertebrate sequence entries, part 160.
3147. gbinv1600.seq - Invertebrate sequence entries, part 1600.
3148. gbinv1601.seq - Invertebrate sequence entries, part 1601.
3149. gbinv1602.seq - Invertebrate sequence entries, part 1602.
3150. gbinv1603.seq - Invertebrate sequence entries, part 1603.
3151. gbinv1604.seq - Invertebrate sequence entries, part 1604.
3152. gbinv1605.seq - Invertebrate sequence entries, part 1605.
3153. gbinv1606.seq - Invertebrate sequence entries, part 1606.
3154. gbinv1607.seq - Invertebrate sequence entries, part 1607.
3155. gbinv1608.seq - Invertebrate sequence entries, part 1608.
3156. gbinv1609.seq - Invertebrate sequence entries, part 1609.
3157. gbinv161.seq - Invertebrate sequence entries, part 161.
3158. gbinv1610.seq - Invertebrate sequence entries, part 1610.
3159. gbinv1611.seq - Invertebrate sequence entries, part 1611.
3160. gbinv1612.seq - Invertebrate sequence entries, part 1612.
3161. gbinv1613.seq - Invertebrate sequence entries, part 1613.
3162. gbinv1614.seq - Invertebrate sequence entries, part 1614.
3163. gbinv1615.seq - Invertebrate sequence entries, part 1615.
3164. gbinv1616.seq - Invertebrate sequence entries, part 1616.
3165. gbinv1617.seq - Invertebrate sequence entries, part 1617.
3166. gbinv1618.seq - Invertebrate sequence entries, part 1618.
3167. gbinv1619.seq - Invertebrate sequence entries, part 1619.
3168. gbinv162.seq - Invertebrate sequence entries, part 162.
3169. gbinv1620.seq - Invertebrate sequence entries, part 1620.
3170. gbinv1621.seq - Invertebrate sequence entries, part 1621.
3171. gbinv1622.seq - Invertebrate sequence entries, part 1622.
3172. gbinv1623.seq - Invertebrate sequence entries, part 1623.
3173. gbinv1624.seq - Invertebrate sequence entries, part 1624.
3174. gbinv1625.seq - Invertebrate sequence entries, part 1625.
3175. gbinv1626.seq - Invertebrate sequence entries, part 1626.
3176. gbinv1627.seq - Invertebrate sequence entries, part 1627.
3177. gbinv1628.seq - Invertebrate sequence entries, part 1628.
3178. gbinv1629.seq - Invertebrate sequence entries, part 1629.
3179. gbinv163.seq - Invertebrate sequence entries, part 163.
3180. gbinv1630.seq - Invertebrate sequence entries, part 1630.
3181. gbinv1631.seq - Invertebrate sequence entries, part 1631.
3182. gbinv1632.seq - Invertebrate sequence entries, part 1632.
3183. gbinv1633.seq - Invertebrate sequence entries, part 1633.
3184. gbinv1634.seq - Invertebrate sequence entries, part 1634.
3185. gbinv1635.seq - Invertebrate sequence entries, part 1635.
3186. gbinv1636.seq - Invertebrate sequence entries, part 1636.
3187. gbinv1637.seq - Invertebrate sequence entries, part 1637.
3188. gbinv1638.seq - Invertebrate sequence entries, part 1638.
3189. gbinv1639.seq - Invertebrate sequence entries, part 1639.
3190. gbinv164.seq - Invertebrate sequence entries, part 164.
3191. gbinv1640.seq - Invertebrate sequence entries, part 1640.
3192. gbinv1641.seq - Invertebrate sequence entries, part 1641.
3193. gbinv1642.seq - Invertebrate sequence entries, part 1642.
3194. gbinv1643.seq - Invertebrate sequence entries, part 1643.
3195. gbinv1644.seq - Invertebrate sequence entries, part 1644.
3196. gbinv1645.seq - Invertebrate sequence entries, part 1645.
3197. gbinv1646.seq - Invertebrate sequence entries, part 1646.
3198. gbinv1647.seq - Invertebrate sequence entries, part 1647.
3199. gbinv1648.seq - Invertebrate sequence entries, part 1648.
3200. gbinv1649.seq - Invertebrate sequence entries, part 1649.
3201. gbinv165.seq - Invertebrate sequence entries, part 165.
3202. gbinv1650.seq - Invertebrate sequence entries, part 1650.
3203. gbinv1651.seq - Invertebrate sequence entries, part 1651.
3204. gbinv1652.seq - Invertebrate sequence entries, part 1652.
3205. gbinv1653.seq - Invertebrate sequence entries, part 1653.
3206. gbinv1654.seq - Invertebrate sequence entries, part 1654.
3207. gbinv1655.seq - Invertebrate sequence entries, part 1655.
3208. gbinv1656.seq - Invertebrate sequence entries, part 1656.
3209. gbinv1657.seq - Invertebrate sequence entries, part 1657.
3210. gbinv1658.seq - Invertebrate sequence entries, part 1658.
3211. gbinv1659.seq - Invertebrate sequence entries, part 1659.
3212. gbinv166.seq - Invertebrate sequence entries, part 166.
3213. gbinv1660.seq - Invertebrate sequence entries, part 1660.
3214. gbinv1661.seq - Invertebrate sequence entries, part 1661.
3215. gbinv1662.seq - Invertebrate sequence entries, part 1662.
3216. gbinv1663.seq - Invertebrate sequence entries, part 1663.
3217. gbinv1664.seq - Invertebrate sequence entries, part 1664.
3218. gbinv1665.seq - Invertebrate sequence entries, part 1665.
3219. gbinv1666.seq - Invertebrate sequence entries, part 1666.
3220. gbinv1667.seq - Invertebrate sequence entries, part 1667.
3221. gbinv1668.seq - Invertebrate sequence entries, part 1668.
3222. gbinv1669.seq - Invertebrate sequence entries, part 1669.
3223. gbinv167.seq - Invertebrate sequence entries, part 167.
3224. gbinv1670.seq - Invertebrate sequence entries, part 1670.
3225. gbinv1671.seq - Invertebrate sequence entries, part 1671.
3226. gbinv1672.seq - Invertebrate sequence entries, part 1672.
3227. gbinv1673.seq - Invertebrate sequence entries, part 1673.
3228. gbinv1674.seq - Invertebrate sequence entries, part 1674.
3229. gbinv1675.seq - Invertebrate sequence entries, part 1675.
3230. gbinv1676.seq - Invertebrate sequence entries, part 1676.
3231. gbinv1677.seq - Invertebrate sequence entries, part 1677.
3232. gbinv1678.seq - Invertebrate sequence entries, part 1678.
3233. gbinv1679.seq - Invertebrate sequence entries, part 1679.
3234. gbinv168.seq - Invertebrate sequence entries, part 168.
3235. gbinv1680.seq - Invertebrate sequence entries, part 1680.
3236. gbinv1681.seq - Invertebrate sequence entries, part 1681.
3237. gbinv1682.seq - Invertebrate sequence entries, part 1682.
3238. gbinv1683.seq - Invertebrate sequence entries, part 1683.
3239. gbinv1684.seq - Invertebrate sequence entries, part 1684.
3240. gbinv1685.seq - Invertebrate sequence entries, part 1685.
3241. gbinv1686.seq - Invertebrate sequence entries, part 1686.
3242. gbinv1687.seq - Invertebrate sequence entries, part 1687.
3243. gbinv1688.seq - Invertebrate sequence entries, part 1688.
3244. gbinv1689.seq - Invertebrate sequence entries, part 1689.
3245. gbinv169.seq - Invertebrate sequence entries, part 169.
3246. gbinv1690.seq - Invertebrate sequence entries, part 1690.
3247. gbinv1691.seq - Invertebrate sequence entries, part 1691.
3248. gbinv1692.seq - Invertebrate sequence entries, part 1692.
3249. gbinv1693.seq - Invertebrate sequence entries, part 1693.
3250. gbinv1694.seq - Invertebrate sequence entries, part 1694.
3251. gbinv1695.seq - Invertebrate sequence entries, part 1695.
3252. gbinv1696.seq - Invertebrate sequence entries, part 1696.
3253. gbinv1697.seq - Invertebrate sequence entries, part 1697.
3254. gbinv1698.seq - Invertebrate sequence entries, part 1698.
3255. gbinv1699.seq - Invertebrate sequence entries, part 1699.
3256. gbinv17.seq - Invertebrate sequence entries, part 17.
3257. gbinv170.seq - Invertebrate sequence entries, part 170.
3258. gbinv1700.seq - Invertebrate sequence entries, part 1700.
3259. gbinv1701.seq - Invertebrate sequence entries, part 1701.
3260. gbinv1702.seq - Invertebrate sequence entries, part 1702.
3261. gbinv1703.seq - Invertebrate sequence entries, part 1703.
3262. gbinv1704.seq - Invertebrate sequence entries, part 1704.
3263. gbinv1705.seq - Invertebrate sequence entries, part 1705.
3264. gbinv1706.seq - Invertebrate sequence entries, part 1706.
3265. gbinv1707.seq - Invertebrate sequence entries, part 1707.
3266. gbinv1708.seq - Invertebrate sequence entries, part 1708.
3267. gbinv1709.seq - Invertebrate sequence entries, part 1709.
3268. gbinv171.seq - Invertebrate sequence entries, part 171.
3269. gbinv1710.seq - Invertebrate sequence entries, part 1710.
3270. gbinv1711.seq - Invertebrate sequence entries, part 1711.
3271. gbinv1712.seq - Invertebrate sequence entries, part 1712.
3272. gbinv1713.seq - Invertebrate sequence entries, part 1713.
3273. gbinv1714.seq - Invertebrate sequence entries, part 1714.
3274. gbinv1715.seq - Invertebrate sequence entries, part 1715.
3275. gbinv1716.seq - Invertebrate sequence entries, part 1716.
3276. gbinv1717.seq - Invertebrate sequence entries, part 1717.
3277. gbinv1718.seq - Invertebrate sequence entries, part 1718.
3278. gbinv1719.seq - Invertebrate sequence entries, part 1719.
3279. gbinv172.seq - Invertebrate sequence entries, part 172.
3280. gbinv1720.seq - Invertebrate sequence entries, part 1720.
3281. gbinv1721.seq - Invertebrate sequence entries, part 1721.
3282. gbinv1722.seq - Invertebrate sequence entries, part 1722.
3283. gbinv1723.seq - Invertebrate sequence entries, part 1723.
3284. gbinv1724.seq - Invertebrate sequence entries, part 1724.
3285. gbinv1725.seq - Invertebrate sequence entries, part 1725.
3286. gbinv1726.seq - Invertebrate sequence entries, part 1726.
3287. gbinv1727.seq - Invertebrate sequence entries, part 1727.
3288. gbinv1728.seq - Invertebrate sequence entries, part 1728.
3289. gbinv1729.seq - Invertebrate sequence entries, part 1729.
3290. gbinv173.seq - Invertebrate sequence entries, part 173.
3291. gbinv1730.seq - Invertebrate sequence entries, part 1730.
3292. gbinv1731.seq - Invertebrate sequence entries, part 1731.
3293. gbinv1732.seq - Invertebrate sequence entries, part 1732.
3294. gbinv1733.seq - Invertebrate sequence entries, part 1733.
3295. gbinv1734.seq - Invertebrate sequence entries, part 1734.
3296. gbinv1735.seq - Invertebrate sequence entries, part 1735.
3297. gbinv1736.seq - Invertebrate sequence entries, part 1736.
3298. gbinv1737.seq - Invertebrate sequence entries, part 1737.
3299. gbinv1738.seq - Invertebrate sequence entries, part 1738.
3300. gbinv1739.seq - Invertebrate sequence entries, part 1739.
3301. gbinv174.seq - Invertebrate sequence entries, part 174.
3302. gbinv1740.seq - Invertebrate sequence entries, part 1740.
3303. gbinv1741.seq - Invertebrate sequence entries, part 1741.
3304. gbinv1742.seq - Invertebrate sequence entries, part 1742.
3305. gbinv1743.seq - Invertebrate sequence entries, part 1743.
3306. gbinv1744.seq - Invertebrate sequence entries, part 1744.
3307. gbinv1745.seq - Invertebrate sequence entries, part 1745.
3308. gbinv1746.seq - Invertebrate sequence entries, part 1746.
3309. gbinv1747.seq - Invertebrate sequence entries, part 1747.
3310. gbinv1748.seq - Invertebrate sequence entries, part 1748.
3311. gbinv1749.seq - Invertebrate sequence entries, part 1749.
3312. gbinv175.seq - Invertebrate sequence entries, part 175.
3313. gbinv1750.seq - Invertebrate sequence entries, part 1750.
3314. gbinv1751.seq - Invertebrate sequence entries, part 1751.
3315. gbinv1752.seq - Invertebrate sequence entries, part 1752.
3316. gbinv1753.seq - Invertebrate sequence entries, part 1753.
3317. gbinv1754.seq - Invertebrate sequence entries, part 1754.
3318. gbinv1755.seq - Invertebrate sequence entries, part 1755.
3319. gbinv1756.seq - Invertebrate sequence entries, part 1756.
3320. gbinv1757.seq - Invertebrate sequence entries, part 1757.
3321. gbinv1758.seq - Invertebrate sequence entries, part 1758.
3322. gbinv1759.seq - Invertebrate sequence entries, part 1759.
3323. gbinv176.seq - Invertebrate sequence entries, part 176.
3324. gbinv1760.seq - Invertebrate sequence entries, part 1760.
3325. gbinv1761.seq - Invertebrate sequence entries, part 1761.
3326. gbinv1762.seq - Invertebrate sequence entries, part 1762.
3327. gbinv1763.seq - Invertebrate sequence entries, part 1763.
3328. gbinv1764.seq - Invertebrate sequence entries, part 1764.
3329. gbinv1765.seq - Invertebrate sequence entries, part 1765.
3330. gbinv1766.seq - Invertebrate sequence entries, part 1766.
3331. gbinv1767.seq - Invertebrate sequence entries, part 1767.
3332. gbinv1768.seq - Invertebrate sequence entries, part 1768.
3333. gbinv1769.seq - Invertebrate sequence entries, part 1769.
3334. gbinv177.seq - Invertebrate sequence entries, part 177.
3335. gbinv1770.seq - Invertebrate sequence entries, part 1770.
3336. gbinv1771.seq - Invertebrate sequence entries, part 1771.
3337. gbinv1772.seq - Invertebrate sequence entries, part 1772.
3338. gbinv1773.seq - Invertebrate sequence entries, part 1773.
3339. gbinv1774.seq - Invertebrate sequence entries, part 1774.
3340. gbinv1775.seq - Invertebrate sequence entries, part 1775.
3341. gbinv1776.seq - Invertebrate sequence entries, part 1776.
3342. gbinv1777.seq - Invertebrate sequence entries, part 1777.
3343. gbinv1778.seq - Invertebrate sequence entries, part 1778.
3344. gbinv1779.seq - Invertebrate sequence entries, part 1779.
3345. gbinv178.seq - Invertebrate sequence entries, part 178.
3346. gbinv1780.seq - Invertebrate sequence entries, part 1780.
3347. gbinv1781.seq - Invertebrate sequence entries, part 1781.
3348. gbinv1782.seq - Invertebrate sequence entries, part 1782.
3349. gbinv1783.seq - Invertebrate sequence entries, part 1783.
3350. gbinv1784.seq - Invertebrate sequence entries, part 1784.
3351. gbinv1785.seq - Invertebrate sequence entries, part 1785.
3352. gbinv1786.seq - Invertebrate sequence entries, part 1786.
3353. gbinv1787.seq - Invertebrate sequence entries, part 1787.
3354. gbinv1788.seq - Invertebrate sequence entries, part 1788.
3355. gbinv1789.seq - Invertebrate sequence entries, part 1789.
3356. gbinv179.seq - Invertebrate sequence entries, part 179.
3357. gbinv1790.seq - Invertebrate sequence entries, part 1790.
3358. gbinv1791.seq - Invertebrate sequence entries, part 1791.
3359. gbinv1792.seq - Invertebrate sequence entries, part 1792.
3360. gbinv1793.seq - Invertebrate sequence entries, part 1793.
3361. gbinv1794.seq - Invertebrate sequence entries, part 1794.
3362. gbinv1795.seq - Invertebrate sequence entries, part 1795.
3363. gbinv1796.seq - Invertebrate sequence entries, part 1796.
3364. gbinv1797.seq - Invertebrate sequence entries, part 1797.
3365. gbinv1798.seq - Invertebrate sequence entries, part 1798.
3366. gbinv1799.seq - Invertebrate sequence entries, part 1799.
3367. gbinv18.seq - Invertebrate sequence entries, part 18.
3368. gbinv180.seq - Invertebrate sequence entries, part 180.
3369. gbinv1800.seq - Invertebrate sequence entries, part 1800.
3370. gbinv1801.seq - Invertebrate sequence entries, part 1801.
3371. gbinv1802.seq - Invertebrate sequence entries, part 1802.
3372. gbinv1803.seq - Invertebrate sequence entries, part 1803.
3373. gbinv1804.seq - Invertebrate sequence entries, part 1804.
3374. gbinv1805.seq - Invertebrate sequence entries, part 1805.
3375. gbinv1806.seq - Invertebrate sequence entries, part 1806.
3376. gbinv1807.seq - Invertebrate sequence entries, part 1807.
3377. gbinv1808.seq - Invertebrate sequence entries, part 1808.
3378. gbinv1809.seq - Invertebrate sequence entries, part 1809.
3379. gbinv181.seq - Invertebrate sequence entries, part 181.
3380. gbinv1810.seq - Invertebrate sequence entries, part 1810.
3381. gbinv1811.seq - Invertebrate sequence entries, part 1811.
3382. gbinv1812.seq - Invertebrate sequence entries, part 1812.
3383. gbinv1813.seq - Invertebrate sequence entries, part 1813.
3384. gbinv1814.seq - Invertebrate sequence entries, part 1814.
3385. gbinv1815.seq - Invertebrate sequence entries, part 1815.
3386. gbinv1816.seq - Invertebrate sequence entries, part 1816.
3387. gbinv1817.seq - Invertebrate sequence entries, part 1817.
3388. gbinv1818.seq - Invertebrate sequence entries, part 1818.
3389. gbinv1819.seq - Invertebrate sequence entries, part 1819.
3390. gbinv182.seq - Invertebrate sequence entries, part 182.
3391. gbinv1820.seq - Invertebrate sequence entries, part 1820.
3392. gbinv1821.seq - Invertebrate sequence entries, part 1821.
3393. gbinv1822.seq - Invertebrate sequence entries, part 1822.
3394. gbinv1823.seq - Invertebrate sequence entries, part 1823.
3395. gbinv1824.seq - Invertebrate sequence entries, part 1824.
3396. gbinv1825.seq - Invertebrate sequence entries, part 1825.
3397. gbinv1826.seq - Invertebrate sequence entries, part 1826.
3398. gbinv1827.seq - Invertebrate sequence entries, part 1827.
3399. gbinv1828.seq - Invertebrate sequence entries, part 1828.
3400. gbinv1829.seq - Invertebrate sequence entries, part 1829.
3401. gbinv183.seq - Invertebrate sequence entries, part 183.
3402. gbinv1830.seq - Invertebrate sequence entries, part 1830.
3403. gbinv1831.seq - Invertebrate sequence entries, part 1831.
3404. gbinv1832.seq - Invertebrate sequence entries, part 1832.
3405. gbinv1833.seq - Invertebrate sequence entries, part 1833.
3406. gbinv1834.seq - Invertebrate sequence entries, part 1834.
3407. gbinv1835.seq - Invertebrate sequence entries, part 1835.
3408. gbinv1836.seq - Invertebrate sequence entries, part 1836.
3409. gbinv1837.seq - Invertebrate sequence entries, part 1837.
3410. gbinv1838.seq - Invertebrate sequence entries, part 1838.
3411. gbinv1839.seq - Invertebrate sequence entries, part 1839.
3412. gbinv184.seq - Invertebrate sequence entries, part 184.
3413. gbinv1840.seq - Invertebrate sequence entries, part 1840.
3414. gbinv1841.seq - Invertebrate sequence entries, part 1841.
3415. gbinv1842.seq - Invertebrate sequence entries, part 1842.
3416. gbinv1843.seq - Invertebrate sequence entries, part 1843.
3417. gbinv1844.seq - Invertebrate sequence entries, part 1844.
3418. gbinv1845.seq - Invertebrate sequence entries, part 1845.
3419. gbinv1846.seq - Invertebrate sequence entries, part 1846.
3420. gbinv1847.seq - Invertebrate sequence entries, part 1847.
3421. gbinv1848.seq - Invertebrate sequence entries, part 1848.
3422. gbinv1849.seq - Invertebrate sequence entries, part 1849.
3423. gbinv185.seq - Invertebrate sequence entries, part 185.
3424. gbinv1850.seq - Invertebrate sequence entries, part 1850.
3425. gbinv1851.seq - Invertebrate sequence entries, part 1851.
3426. gbinv1852.seq - Invertebrate sequence entries, part 1852.
3427. gbinv1853.seq - Invertebrate sequence entries, part 1853.
3428. gbinv1854.seq - Invertebrate sequence entries, part 1854.
3429. gbinv1855.seq - Invertebrate sequence entries, part 1855.
3430. gbinv1856.seq - Invertebrate sequence entries, part 1856.
3431. gbinv1857.seq - Invertebrate sequence entries, part 1857.
3432. gbinv1858.seq - Invertebrate sequence entries, part 1858.
3433. gbinv1859.seq - Invertebrate sequence entries, part 1859.
3434. gbinv186.seq - Invertebrate sequence entries, part 186.
3435. gbinv1860.seq - Invertebrate sequence entries, part 1860.
3436. gbinv1861.seq - Invertebrate sequence entries, part 1861.
3437. gbinv1862.seq - Invertebrate sequence entries, part 1862.
3438. gbinv1863.seq - Invertebrate sequence entries, part 1863.
3439. gbinv1864.seq - Invertebrate sequence entries, part 1864.
3440. gbinv1865.seq - Invertebrate sequence entries, part 1865.
3441. gbinv1866.seq - Invertebrate sequence entries, part 1866.
3442. gbinv1867.seq - Invertebrate sequence entries, part 1867.
3443. gbinv1868.seq - Invertebrate sequence entries, part 1868.
3444. gbinv1869.seq - Invertebrate sequence entries, part 1869.
3445. gbinv187.seq - Invertebrate sequence entries, part 187.
3446. gbinv1870.seq - Invertebrate sequence entries, part 1870.
3447. gbinv1871.seq - Invertebrate sequence entries, part 1871.
3448. gbinv1872.seq - Invertebrate sequence entries, part 1872.
3449. gbinv1873.seq - Invertebrate sequence entries, part 1873.
3450. gbinv1874.seq - Invertebrate sequence entries, part 1874.
3451. gbinv1875.seq - Invertebrate sequence entries, part 1875.
3452. gbinv1876.seq - Invertebrate sequence entries, part 1876.
3453. gbinv1877.seq - Invertebrate sequence entries, part 1877.
3454. gbinv1878.seq - Invertebrate sequence entries, part 1878.
3455. gbinv1879.seq - Invertebrate sequence entries, part 1879.
3456. gbinv188.seq - Invertebrate sequence entries, part 188.
3457. gbinv1880.seq - Invertebrate sequence entries, part 1880.
3458. gbinv1881.seq - Invertebrate sequence entries, part 1881.
3459. gbinv1882.seq - Invertebrate sequence entries, part 1882.
3460. gbinv1883.seq - Invertebrate sequence entries, part 1883.
3461. gbinv1884.seq - Invertebrate sequence entries, part 1884.
3462. gbinv1885.seq - Invertebrate sequence entries, part 1885.
3463. gbinv1886.seq - Invertebrate sequence entries, part 1886.
3464. gbinv1887.seq - Invertebrate sequence entries, part 1887.
3465. gbinv1888.seq - Invertebrate sequence entries, part 1888.
3466. gbinv1889.seq - Invertebrate sequence entries, part 1889.
3467. gbinv189.seq - Invertebrate sequence entries, part 189.
3468. gbinv1890.seq - Invertebrate sequence entries, part 1890.
3469. gbinv1891.seq - Invertebrate sequence entries, part 1891.
3470. gbinv1892.seq - Invertebrate sequence entries, part 1892.
3471. gbinv1893.seq - Invertebrate sequence entries, part 1893.
3472. gbinv1894.seq - Invertebrate sequence entries, part 1894.
3473. gbinv1895.seq - Invertebrate sequence entries, part 1895.
3474. gbinv1896.seq - Invertebrate sequence entries, part 1896.
3475. gbinv1897.seq - Invertebrate sequence entries, part 1897.
3476. gbinv1898.seq - Invertebrate sequence entries, part 1898.
3477. gbinv1899.seq - Invertebrate sequence entries, part 1899.
3478. gbinv19.seq - Invertebrate sequence entries, part 19.
3479. gbinv190.seq - Invertebrate sequence entries, part 190.
3480. gbinv1900.seq - Invertebrate sequence entries, part 1900.
3481. gbinv1901.seq - Invertebrate sequence entries, part 1901.
3482. gbinv1902.seq - Invertebrate sequence entries, part 1902.
3483. gbinv1903.seq - Invertebrate sequence entries, part 1903.
3484. gbinv1904.seq - Invertebrate sequence entries, part 1904.
3485. gbinv1905.seq - Invertebrate sequence entries, part 1905.
3486. gbinv1906.seq - Invertebrate sequence entries, part 1906.
3487. gbinv1907.seq - Invertebrate sequence entries, part 1907.
3488. gbinv1908.seq - Invertebrate sequence entries, part 1908.
3489. gbinv1909.seq - Invertebrate sequence entries, part 1909.
3490. gbinv191.seq - Invertebrate sequence entries, part 191.
3491. gbinv1910.seq - Invertebrate sequence entries, part 1910.
3492. gbinv1911.seq - Invertebrate sequence entries, part 1911.
3493. gbinv1912.seq - Invertebrate sequence entries, part 1912.
3494. gbinv1913.seq - Invertebrate sequence entries, part 1913.
3495. gbinv1914.seq - Invertebrate sequence entries, part 1914.
3496. gbinv1915.seq - Invertebrate sequence entries, part 1915.
3497. gbinv1916.seq - Invertebrate sequence entries, part 1916.
3498. gbinv1917.seq - Invertebrate sequence entries, part 1917.
3499. gbinv1918.seq - Invertebrate sequence entries, part 1918.
3500. gbinv1919.seq - Invertebrate sequence entries, part 1919.
3501. gbinv192.seq - Invertebrate sequence entries, part 192.
3502. gbinv1920.seq - Invertebrate sequence entries, part 1920.
3503. gbinv1921.seq - Invertebrate sequence entries, part 1921.
3504. gbinv1922.seq - Invertebrate sequence entries, part 1922.
3505. gbinv1923.seq - Invertebrate sequence entries, part 1923.
3506. gbinv1924.seq - Invertebrate sequence entries, part 1924.
3507. gbinv1925.seq - Invertebrate sequence entries, part 1925.
3508. gbinv1926.seq - Invertebrate sequence entries, part 1926.
3509. gbinv1927.seq - Invertebrate sequence entries, part 1927.
3510. gbinv1928.seq - Invertebrate sequence entries, part 1928.
3511. gbinv1929.seq - Invertebrate sequence entries, part 1929.
3512. gbinv193.seq - Invertebrate sequence entries, part 193.
3513. gbinv1930.seq - Invertebrate sequence entries, part 1930.
3514. gbinv1931.seq - Invertebrate sequence entries, part 1931.
3515. gbinv1932.seq - Invertebrate sequence entries, part 1932.
3516. gbinv1933.seq - Invertebrate sequence entries, part 1933.
3517. gbinv1934.seq - Invertebrate sequence entries, part 1934.
3518. gbinv1935.seq - Invertebrate sequence entries, part 1935.
3519. gbinv1936.seq - Invertebrate sequence entries, part 1936.
3520. gbinv1937.seq - Invertebrate sequence entries, part 1937.
3521. gbinv1938.seq - Invertebrate sequence entries, part 1938.
3522. gbinv1939.seq - Invertebrate sequence entries, part 1939.
3523. gbinv194.seq - Invertebrate sequence entries, part 194.
3524. gbinv1940.seq - Invertebrate sequence entries, part 1940.
3525. gbinv1941.seq - Invertebrate sequence entries, part 1941.
3526. gbinv1942.seq - Invertebrate sequence entries, part 1942.
3527. gbinv1943.seq - Invertebrate sequence entries, part 1943.
3528. gbinv1944.seq - Invertebrate sequence entries, part 1944.
3529. gbinv1945.seq - Invertebrate sequence entries, part 1945.
3530. gbinv1946.seq - Invertebrate sequence entries, part 1946.
3531. gbinv1947.seq - Invertebrate sequence entries, part 1947.
3532. gbinv1948.seq - Invertebrate sequence entries, part 1948.
3533. gbinv1949.seq - Invertebrate sequence entries, part 1949.
3534. gbinv195.seq - Invertebrate sequence entries, part 195.
3535. gbinv1950.seq - Invertebrate sequence entries, part 1950.
3536. gbinv1951.seq - Invertebrate sequence entries, part 1951.
3537. gbinv1952.seq - Invertebrate sequence entries, part 1952.
3538. gbinv1953.seq - Invertebrate sequence entries, part 1953.
3539. gbinv1954.seq - Invertebrate sequence entries, part 1954.
3540. gbinv1955.seq - Invertebrate sequence entries, part 1955.
3541. gbinv1956.seq - Invertebrate sequence entries, part 1956.
3542. gbinv1957.seq - Invertebrate sequence entries, part 1957.
3543. gbinv1958.seq - Invertebrate sequence entries, part 1958.
3544. gbinv1959.seq - Invertebrate sequence entries, part 1959.
3545. gbinv196.seq - Invertebrate sequence entries, part 196.
3546. gbinv1960.seq - Invertebrate sequence entries, part 1960.
3547. gbinv1961.seq - Invertebrate sequence entries, part 1961.
3548. gbinv1962.seq - Invertebrate sequence entries, part 1962.
3549. gbinv1963.seq - Invertebrate sequence entries, part 1963.
3550. gbinv1964.seq - Invertebrate sequence entries, part 1964.
3551. gbinv1965.seq - Invertebrate sequence entries, part 1965.
3552. gbinv1966.seq - Invertebrate sequence entries, part 1966.
3553. gbinv1967.seq - Invertebrate sequence entries, part 1967.
3554. gbinv1968.seq - Invertebrate sequence entries, part 1968.
3555. gbinv1969.seq - Invertebrate sequence entries, part 1969.
3556. gbinv197.seq - Invertebrate sequence entries, part 197.
3557. gbinv1970.seq - Invertebrate sequence entries, part 1970.
3558. gbinv1971.seq - Invertebrate sequence entries, part 1971.
3559. gbinv1972.seq - Invertebrate sequence entries, part 1972.
3560. gbinv1973.seq - Invertebrate sequence entries, part 1973.
3561. gbinv1974.seq - Invertebrate sequence entries, part 1974.
3562. gbinv1975.seq - Invertebrate sequence entries, part 1975.
3563. gbinv1976.seq - Invertebrate sequence entries, part 1976.
3564. gbinv1977.seq - Invertebrate sequence entries, part 1977.
3565. gbinv1978.seq - Invertebrate sequence entries, part 1978.
3566. gbinv1979.seq - Invertebrate sequence entries, part 1979.
3567. gbinv198.seq - Invertebrate sequence entries, part 198.
3568. gbinv1980.seq - Invertebrate sequence entries, part 1980.
3569. gbinv1981.seq - Invertebrate sequence entries, part 1981.
3570. gbinv1982.seq - Invertebrate sequence entries, part 1982.
3571. gbinv1983.seq - Invertebrate sequence entries, part 1983.
3572. gbinv1984.seq - Invertebrate sequence entries, part 1984.
3573. gbinv1985.seq - Invertebrate sequence entries, part 1985.
3574. gbinv1986.seq - Invertebrate sequence entries, part 1986.
3575. gbinv1987.seq - Invertebrate sequence entries, part 1987.
3576. gbinv1988.seq - Invertebrate sequence entries, part 1988.
3577. gbinv1989.seq - Invertebrate sequence entries, part 1989.
3578. gbinv199.seq - Invertebrate sequence entries, part 199.
3579. gbinv1990.seq - Invertebrate sequence entries, part 1990.
3580. gbinv1991.seq - Invertebrate sequence entries, part 1991.
3581. gbinv1992.seq - Invertebrate sequence entries, part 1992.
3582. gbinv1993.seq - Invertebrate sequence entries, part 1993.
3583. gbinv1994.seq - Invertebrate sequence entries, part 1994.
3584. gbinv1995.seq - Invertebrate sequence entries, part 1995.
3585. gbinv1996.seq - Invertebrate sequence entries, part 1996.
3586. gbinv1997.seq - Invertebrate sequence entries, part 1997.
3587. gbinv1998.seq - Invertebrate sequence entries, part 1998.
3588. gbinv1999.seq - Invertebrate sequence entries, part 1999.
3589. gbinv2.seq - Invertebrate sequence entries, part 2.
3590. gbinv20.seq - Invertebrate sequence entries, part 20.
3591. gbinv200.seq - Invertebrate sequence entries, part 200.
3592. gbinv2000.seq - Invertebrate sequence entries, part 2000.
3593. gbinv2001.seq - Invertebrate sequence entries, part 2001.
3594. gbinv2002.seq - Invertebrate sequence entries, part 2002.
3595. gbinv2003.seq - Invertebrate sequence entries, part 2003.
3596. gbinv2004.seq - Invertebrate sequence entries, part 2004.
3597. gbinv2005.seq - Invertebrate sequence entries, part 2005.
3598. gbinv2006.seq - Invertebrate sequence entries, part 2006.
3599. gbinv2007.seq - Invertebrate sequence entries, part 2007.
3600. gbinv2008.seq - Invertebrate sequence entries, part 2008.
3601. gbinv2009.seq - Invertebrate sequence entries, part 2009.
3602. gbinv201.seq - Invertebrate sequence entries, part 201.
3603. gbinv2010.seq - Invertebrate sequence entries, part 2010.
3604. gbinv2011.seq - Invertebrate sequence entries, part 2011.
3605. gbinv2012.seq - Invertebrate sequence entries, part 2012.
3606. gbinv2013.seq - Invertebrate sequence entries, part 2013.
3607. gbinv2014.seq - Invertebrate sequence entries, part 2014.
3608. gbinv2015.seq - Invertebrate sequence entries, part 2015.
3609. gbinv2016.seq - Invertebrate sequence entries, part 2016.
3610. gbinv2017.seq - Invertebrate sequence entries, part 2017.
3611. gbinv2018.seq - Invertebrate sequence entries, part 2018.
3612. gbinv2019.seq - Invertebrate sequence entries, part 2019.
3613. gbinv202.seq - Invertebrate sequence entries, part 202.
3614. gbinv2020.seq - Invertebrate sequence entries, part 2020.
3615. gbinv2021.seq - Invertebrate sequence entries, part 2021.
3616. gbinv2022.seq - Invertebrate sequence entries, part 2022.
3617. gbinv2023.seq - Invertebrate sequence entries, part 2023.
3618. gbinv2024.seq - Invertebrate sequence entries, part 2024.
3619. gbinv2025.seq - Invertebrate sequence entries, part 2025.
3620. gbinv2026.seq - Invertebrate sequence entries, part 2026.
3621. gbinv2027.seq - Invertebrate sequence entries, part 2027.
3622. gbinv2028.seq - Invertebrate sequence entries, part 2028.
3623. gbinv2029.seq - Invertebrate sequence entries, part 2029.
3624. gbinv203.seq - Invertebrate sequence entries, part 203.
3625. gbinv2030.seq - Invertebrate sequence entries, part 2030.
3626. gbinv2031.seq - Invertebrate sequence entries, part 2031.
3627. gbinv2032.seq - Invertebrate sequence entries, part 2032.
3628. gbinv2033.seq - Invertebrate sequence entries, part 2033.
3629. gbinv2034.seq - Invertebrate sequence entries, part 2034.
3630. gbinv2035.seq - Invertebrate sequence entries, part 2035.
3631. gbinv2036.seq - Invertebrate sequence entries, part 2036.
3632. gbinv2037.seq - Invertebrate sequence entries, part 2037.
3633. gbinv2038.seq - Invertebrate sequence entries, part 2038.
3634. gbinv2039.seq - Invertebrate sequence entries, part 2039.
3635. gbinv204.seq - Invertebrate sequence entries, part 204.
3636. gbinv2040.seq - Invertebrate sequence entries, part 2040.
3637. gbinv2041.seq - Invertebrate sequence entries, part 2041.
3638. gbinv2042.seq - Invertebrate sequence entries, part 2042.
3639. gbinv2043.seq - Invertebrate sequence entries, part 2043.
3640. gbinv2044.seq - Invertebrate sequence entries, part 2044.
3641. gbinv2045.seq - Invertebrate sequence entries, part 2045.
3642. gbinv2046.seq - Invertebrate sequence entries, part 2046.
3643. gbinv2047.seq - Invertebrate sequence entries, part 2047.
3644. gbinv2048.seq - Invertebrate sequence entries, part 2048.
3645. gbinv2049.seq - Invertebrate sequence entries, part 2049.
3646. gbinv205.seq - Invertebrate sequence entries, part 205.
3647. gbinv2050.seq - Invertebrate sequence entries, part 2050.
3648. gbinv2051.seq - Invertebrate sequence entries, part 2051.
3649. gbinv2052.seq - Invertebrate sequence entries, part 2052.
3650. gbinv2053.seq - Invertebrate sequence entries, part 2053.
3651. gbinv2054.seq - Invertebrate sequence entries, part 2054.
3652. gbinv2055.seq - Invertebrate sequence entries, part 2055.
3653. gbinv2056.seq - Invertebrate sequence entries, part 2056.
3654. gbinv2057.seq - Invertebrate sequence entries, part 2057.
3655. gbinv2058.seq - Invertebrate sequence entries, part 2058.
3656. gbinv2059.seq - Invertebrate sequence entries, part 2059.
3657. gbinv206.seq - Invertebrate sequence entries, part 206.
3658. gbinv2060.seq - Invertebrate sequence entries, part 2060.
3659. gbinv2061.seq - Invertebrate sequence entries, part 2061.
3660. gbinv2062.seq - Invertebrate sequence entries, part 2062.
3661. gbinv2063.seq - Invertebrate sequence entries, part 2063.
3662. gbinv2064.seq - Invertebrate sequence entries, part 2064.
3663. gbinv2065.seq - Invertebrate sequence entries, part 2065.
3664. gbinv2066.seq - Invertebrate sequence entries, part 2066.
3665. gbinv2067.seq - Invertebrate sequence entries, part 2067.
3666. gbinv2068.seq - Invertebrate sequence entries, part 2068.
3667. gbinv2069.seq - Invertebrate sequence entries, part 2069.
3668. gbinv207.seq - Invertebrate sequence entries, part 207.
3669. gbinv2070.seq - Invertebrate sequence entries, part 2070.
3670. gbinv2071.seq - Invertebrate sequence entries, part 2071.
3671. gbinv2072.seq - Invertebrate sequence entries, part 2072.
3672. gbinv2073.seq - Invertebrate sequence entries, part 2073.
3673. gbinv2074.seq - Invertebrate sequence entries, part 2074.
3674. gbinv2075.seq - Invertebrate sequence entries, part 2075.
3675. gbinv2076.seq - Invertebrate sequence entries, part 2076.
3676. gbinv2077.seq - Invertebrate sequence entries, part 2077.
3677. gbinv2078.seq - Invertebrate sequence entries, part 2078.
3678. gbinv2079.seq - Invertebrate sequence entries, part 2079.
3679. gbinv208.seq - Invertebrate sequence entries, part 208.
3680. gbinv2080.seq - Invertebrate sequence entries, part 2080.
3681. gbinv2081.seq - Invertebrate sequence entries, part 2081.
3682. gbinv2082.seq - Invertebrate sequence entries, part 2082.
3683. gbinv2083.seq - Invertebrate sequence entries, part 2083.
3684. gbinv2084.seq - Invertebrate sequence entries, part 2084.
3685. gbinv2085.seq - Invertebrate sequence entries, part 2085.
3686. gbinv2086.seq - Invertebrate sequence entries, part 2086.
3687. gbinv2087.seq - Invertebrate sequence entries, part 2087.
3688. gbinv2088.seq - Invertebrate sequence entries, part 2088.
3689. gbinv2089.seq - Invertebrate sequence entries, part 2089.
3690. gbinv209.seq - Invertebrate sequence entries, part 209.
3691. gbinv2090.seq - Invertebrate sequence entries, part 2090.
3692. gbinv2091.seq - Invertebrate sequence entries, part 2091.
3693. gbinv2092.seq - Invertebrate sequence entries, part 2092.
3694. gbinv2093.seq - Invertebrate sequence entries, part 2093.
3695. gbinv2094.seq - Invertebrate sequence entries, part 2094.
3696. gbinv2095.seq - Invertebrate sequence entries, part 2095.
3697. gbinv2096.seq - Invertebrate sequence entries, part 2096.
3698. gbinv2097.seq - Invertebrate sequence entries, part 2097.
3699. gbinv2098.seq - Invertebrate sequence entries, part 2098.
3700. gbinv2099.seq - Invertebrate sequence entries, part 2099.
3701. gbinv21.seq - Invertebrate sequence entries, part 21.
3702. gbinv210.seq - Invertebrate sequence entries, part 210.
3703. gbinv2100.seq - Invertebrate sequence entries, part 2100.
3704. gbinv2101.seq - Invertebrate sequence entries, part 2101.
3705. gbinv2102.seq - Invertebrate sequence entries, part 2102.
3706. gbinv2103.seq - Invertebrate sequence entries, part 2103.
3707. gbinv2104.seq - Invertebrate sequence entries, part 2104.
3708. gbinv2105.seq - Invertebrate sequence entries, part 2105.
3709. gbinv2106.seq - Invertebrate sequence entries, part 2106.
3710. gbinv2107.seq - Invertebrate sequence entries, part 2107.
3711. gbinv2108.seq - Invertebrate sequence entries, part 2108.
3712. gbinv2109.seq - Invertebrate sequence entries, part 2109.
3713. gbinv211.seq - Invertebrate sequence entries, part 211.
3714. gbinv2110.seq - Invertebrate sequence entries, part 2110.
3715. gbinv2111.seq - Invertebrate sequence entries, part 2111.
3716. gbinv2112.seq - Invertebrate sequence entries, part 2112.
3717. gbinv2113.seq - Invertebrate sequence entries, part 2113.
3718. gbinv2114.seq - Invertebrate sequence entries, part 2114.
3719. gbinv2115.seq - Invertebrate sequence entries, part 2115.
3720. gbinv2116.seq - Invertebrate sequence entries, part 2116.
3721. gbinv2117.seq - Invertebrate sequence entries, part 2117.
3722. gbinv2118.seq - Invertebrate sequence entries, part 2118.
3723. gbinv2119.seq - Invertebrate sequence entries, part 2119.
3724. gbinv212.seq - Invertebrate sequence entries, part 212.
3725. gbinv2120.seq - Invertebrate sequence entries, part 2120.
3726. gbinv2121.seq - Invertebrate sequence entries, part 2121.
3727. gbinv2122.seq - Invertebrate sequence entries, part 2122.
3728. gbinv2123.seq - Invertebrate sequence entries, part 2123.
3729. gbinv2124.seq - Invertebrate sequence entries, part 2124.
3730. gbinv2125.seq - Invertebrate sequence entries, part 2125.
3731. gbinv2126.seq - Invertebrate sequence entries, part 2126.
3732. gbinv2127.seq - Invertebrate sequence entries, part 2127.
3733. gbinv2128.seq - Invertebrate sequence entries, part 2128.
3734. gbinv2129.seq - Invertebrate sequence entries, part 2129.
3735. gbinv213.seq - Invertebrate sequence entries, part 213.
3736. gbinv2130.seq - Invertebrate sequence entries, part 2130.
3737. gbinv2131.seq - Invertebrate sequence entries, part 2131.
3738. gbinv2132.seq - Invertebrate sequence entries, part 2132.
3739. gbinv2133.seq - Invertebrate sequence entries, part 2133.
3740. gbinv2134.seq - Invertebrate sequence entries, part 2134.
3741. gbinv2135.seq - Invertebrate sequence entries, part 2135.
3742. gbinv2136.seq - Invertebrate sequence entries, part 2136.
3743. gbinv2137.seq - Invertebrate sequence entries, part 2137.
3744. gbinv2138.seq - Invertebrate sequence entries, part 2138.
3745. gbinv2139.seq - Invertebrate sequence entries, part 2139.
3746. gbinv214.seq - Invertebrate sequence entries, part 214.
3747. gbinv2140.seq - Invertebrate sequence entries, part 2140.
3748. gbinv2141.seq - Invertebrate sequence entries, part 2141.
3749. gbinv2142.seq - Invertebrate sequence entries, part 2142.
3750. gbinv2143.seq - Invertebrate sequence entries, part 2143.
3751. gbinv2144.seq - Invertebrate sequence entries, part 2144.
3752. gbinv2145.seq - Invertebrate sequence entries, part 2145.
3753. gbinv2146.seq - Invertebrate sequence entries, part 2146.
3754. gbinv2147.seq - Invertebrate sequence entries, part 2147.
3755. gbinv2148.seq - Invertebrate sequence entries, part 2148.
3756. gbinv2149.seq - Invertebrate sequence entries, part 2149.
3757. gbinv215.seq - Invertebrate sequence entries, part 215.
3758. gbinv2150.seq - Invertebrate sequence entries, part 2150.
3759. gbinv2151.seq - Invertebrate sequence entries, part 2151.
3760. gbinv2152.seq - Invertebrate sequence entries, part 2152.
3761. gbinv2153.seq - Invertebrate sequence entries, part 2153.
3762. gbinv2154.seq - Invertebrate sequence entries, part 2154.
3763. gbinv2155.seq - Invertebrate sequence entries, part 2155.
3764. gbinv2156.seq - Invertebrate sequence entries, part 2156.
3765. gbinv2157.seq - Invertebrate sequence entries, part 2157.
3766. gbinv2158.seq - Invertebrate sequence entries, part 2158.
3767. gbinv2159.seq - Invertebrate sequence entries, part 2159.
3768. gbinv216.seq - Invertebrate sequence entries, part 216.
3769. gbinv2160.seq - Invertebrate sequence entries, part 2160.
3770. gbinv2161.seq - Invertebrate sequence entries, part 2161.
3771. gbinv2162.seq - Invertebrate sequence entries, part 2162.
3772. gbinv2163.seq - Invertebrate sequence entries, part 2163.
3773. gbinv2164.seq - Invertebrate sequence entries, part 2164.
3774. gbinv2165.seq - Invertebrate sequence entries, part 2165.
3775. gbinv2166.seq - Invertebrate sequence entries, part 2166.
3776. gbinv2167.seq - Invertebrate sequence entries, part 2167.
3777. gbinv2168.seq - Invertebrate sequence entries, part 2168.
3778. gbinv2169.seq - Invertebrate sequence entries, part 2169.
3779. gbinv217.seq - Invertebrate sequence entries, part 217.
3780. gbinv2170.seq - Invertebrate sequence entries, part 2170.
3781. gbinv2171.seq - Invertebrate sequence entries, part 2171.
3782. gbinv2172.seq - Invertebrate sequence entries, part 2172.
3783. gbinv2173.seq - Invertebrate sequence entries, part 2173.
3784. gbinv2174.seq - Invertebrate sequence entries, part 2174.
3785. gbinv2175.seq - Invertebrate sequence entries, part 2175.
3786. gbinv2176.seq - Invertebrate sequence entries, part 2176.
3787. gbinv2177.seq - Invertebrate sequence entries, part 2177.
3788. gbinv2178.seq - Invertebrate sequence entries, part 2178.
3789. gbinv2179.seq - Invertebrate sequence entries, part 2179.
3790. gbinv218.seq - Invertebrate sequence entries, part 218.
3791. gbinv2180.seq - Invertebrate sequence entries, part 2180.
3792. gbinv2181.seq - Invertebrate sequence entries, part 2181.
3793. gbinv2182.seq - Invertebrate sequence entries, part 2182.
3794. gbinv2183.seq - Invertebrate sequence entries, part 2183.
3795. gbinv2184.seq - Invertebrate sequence entries, part 2184.
3796. gbinv2185.seq - Invertebrate sequence entries, part 2185.
3797. gbinv2186.seq - Invertebrate sequence entries, part 2186.
3798. gbinv2187.seq - Invertebrate sequence entries, part 2187.
3799. gbinv2188.seq - Invertebrate sequence entries, part 2188.
3800. gbinv2189.seq - Invertebrate sequence entries, part 2189.
3801. gbinv219.seq - Invertebrate sequence entries, part 219.
3802. gbinv2190.seq - Invertebrate sequence entries, part 2190.
3803. gbinv2191.seq - Invertebrate sequence entries, part 2191.
3804. gbinv2192.seq - Invertebrate sequence entries, part 2192.
3805. gbinv2193.seq - Invertebrate sequence entries, part 2193.
3806. gbinv2194.seq - Invertebrate sequence entries, part 2194.
3807. gbinv2195.seq - Invertebrate sequence entries, part 2195.
3808. gbinv2196.seq - Invertebrate sequence entries, part 2196.
3809. gbinv2197.seq - Invertebrate sequence entries, part 2197.
3810. gbinv2198.seq - Invertebrate sequence entries, part 2198.
3811. gbinv2199.seq - Invertebrate sequence entries, part 2199.
3812. gbinv22.seq - Invertebrate sequence entries, part 22.
3813. gbinv220.seq - Invertebrate sequence entries, part 220.
3814. gbinv2200.seq - Invertebrate sequence entries, part 2200.
3815. gbinv2201.seq - Invertebrate sequence entries, part 2201.
3816. gbinv2202.seq - Invertebrate sequence entries, part 2202.
3817. gbinv2203.seq - Invertebrate sequence entries, part 2203.
3818. gbinv2204.seq - Invertebrate sequence entries, part 2204.
3819. gbinv2205.seq - Invertebrate sequence entries, part 2205.
3820. gbinv2206.seq - Invertebrate sequence entries, part 2206.
3821. gbinv2207.seq - Invertebrate sequence entries, part 2207.
3822. gbinv2208.seq - Invertebrate sequence entries, part 2208.
3823. gbinv2209.seq - Invertebrate sequence entries, part 2209.
3824. gbinv221.seq - Invertebrate sequence entries, part 221.
3825. gbinv2210.seq - Invertebrate sequence entries, part 2210.
3826. gbinv2211.seq - Invertebrate sequence entries, part 2211.
3827. gbinv2212.seq - Invertebrate sequence entries, part 2212.
3828. gbinv2213.seq - Invertebrate sequence entries, part 2213.
3829. gbinv2214.seq - Invertebrate sequence entries, part 2214.
3830. gbinv2215.seq - Invertebrate sequence entries, part 2215.
3831. gbinv2216.seq - Invertebrate sequence entries, part 2216.
3832. gbinv2217.seq - Invertebrate sequence entries, part 2217.
3833. gbinv2218.seq - Invertebrate sequence entries, part 2218.
3834. gbinv2219.seq - Invertebrate sequence entries, part 2219.
3835. gbinv222.seq - Invertebrate sequence entries, part 222.
3836. gbinv2220.seq - Invertebrate sequence entries, part 2220.
3837. gbinv2221.seq - Invertebrate sequence entries, part 2221.
3838. gbinv2222.seq - Invertebrate sequence entries, part 2222.
3839. gbinv2223.seq - Invertebrate sequence entries, part 2223.
3840. gbinv2224.seq - Invertebrate sequence entries, part 2224.
3841. gbinv2225.seq - Invertebrate sequence entries, part 2225.
3842. gbinv2226.seq - Invertebrate sequence entries, part 2226.
3843. gbinv2227.seq - Invertebrate sequence entries, part 2227.
3844. gbinv2228.seq - Invertebrate sequence entries, part 2228.
3845. gbinv2229.seq - Invertebrate sequence entries, part 2229.
3846. gbinv223.seq - Invertebrate sequence entries, part 223.
3847. gbinv2230.seq - Invertebrate sequence entries, part 2230.
3848. gbinv2231.seq - Invertebrate sequence entries, part 2231.
3849. gbinv2232.seq - Invertebrate sequence entries, part 2232.
3850. gbinv2233.seq - Invertebrate sequence entries, part 2233.
3851. gbinv2234.seq - Invertebrate sequence entries, part 2234.
3852. gbinv2235.seq - Invertebrate sequence entries, part 2235.
3853. gbinv2236.seq - Invertebrate sequence entries, part 2236.
3854. gbinv2237.seq - Invertebrate sequence entries, part 2237.
3855. gbinv2238.seq - Invertebrate sequence entries, part 2238.
3856. gbinv2239.seq - Invertebrate sequence entries, part 2239.
3857. gbinv224.seq - Invertebrate sequence entries, part 224.
3858. gbinv2240.seq - Invertebrate sequence entries, part 2240.
3859. gbinv2241.seq - Invertebrate sequence entries, part 2241.
3860. gbinv2242.seq - Invertebrate sequence entries, part 2242.
3861. gbinv2243.seq - Invertebrate sequence entries, part 2243.
3862. gbinv2244.seq - Invertebrate sequence entries, part 2244.
3863. gbinv2245.seq - Invertebrate sequence entries, part 2245.
3864. gbinv2246.seq - Invertebrate sequence entries, part 2246.
3865. gbinv2247.seq - Invertebrate sequence entries, part 2247.
3866. gbinv2248.seq - Invertebrate sequence entries, part 2248.
3867. gbinv2249.seq - Invertebrate sequence entries, part 2249.
3868. gbinv225.seq - Invertebrate sequence entries, part 225.
3869. gbinv2250.seq - Invertebrate sequence entries, part 2250.
3870. gbinv2251.seq - Invertebrate sequence entries, part 2251.
3871. gbinv2252.seq - Invertebrate sequence entries, part 2252.
3872. gbinv2253.seq - Invertebrate sequence entries, part 2253.
3873. gbinv2254.seq - Invertebrate sequence entries, part 2254.
3874. gbinv2255.seq - Invertebrate sequence entries, part 2255.
3875. gbinv2256.seq - Invertebrate sequence entries, part 2256.
3876. gbinv2257.seq - Invertebrate sequence entries, part 2257.
3877. gbinv2258.seq - Invertebrate sequence entries, part 2258.
3878. gbinv2259.seq - Invertebrate sequence entries, part 2259.
3879. gbinv226.seq - Invertebrate sequence entries, part 226.
3880. gbinv2260.seq - Invertebrate sequence entries, part 2260.
3881. gbinv2261.seq - Invertebrate sequence entries, part 2261.
3882. gbinv2262.seq - Invertebrate sequence entries, part 2262.
3883. gbinv2263.seq - Invertebrate sequence entries, part 2263.
3884. gbinv2264.seq - Invertebrate sequence entries, part 2264.
3885. gbinv2265.seq - Invertebrate sequence entries, part 2265.
3886. gbinv2266.seq - Invertebrate sequence entries, part 2266.
3887. gbinv2267.seq - Invertebrate sequence entries, part 2267.
3888. gbinv2268.seq - Invertebrate sequence entries, part 2268.
3889. gbinv2269.seq - Invertebrate sequence entries, part 2269.
3890. gbinv227.seq - Invertebrate sequence entries, part 227.
3891. gbinv2270.seq - Invertebrate sequence entries, part 2270.
3892. gbinv2271.seq - Invertebrate sequence entries, part 2271.
3893. gbinv2272.seq - Invertebrate sequence entries, part 2272.
3894. gbinv2273.seq - Invertebrate sequence entries, part 2273.
3895. gbinv2274.seq - Invertebrate sequence entries, part 2274.
3896. gbinv2275.seq - Invertebrate sequence entries, part 2275.
3897. gbinv2276.seq - Invertebrate sequence entries, part 2276.
3898. gbinv2277.seq - Invertebrate sequence entries, part 2277.
3899. gbinv2278.seq - Invertebrate sequence entries, part 2278.
3900. gbinv2279.seq - Invertebrate sequence entries, part 2279.
3901. gbinv228.seq - Invertebrate sequence entries, part 228.
3902. gbinv2280.seq - Invertebrate sequence entries, part 2280.
3903. gbinv2281.seq - Invertebrate sequence entries, part 2281.
3904. gbinv2282.seq - Invertebrate sequence entries, part 2282.
3905. gbinv2283.seq - Invertebrate sequence entries, part 2283.
3906. gbinv2284.seq - Invertebrate sequence entries, part 2284.
3907. gbinv2285.seq - Invertebrate sequence entries, part 2285.
3908. gbinv2286.seq - Invertebrate sequence entries, part 2286.
3909. gbinv2287.seq - Invertebrate sequence entries, part 2287.
3910. gbinv2288.seq - Invertebrate sequence entries, part 2288.
3911. gbinv2289.seq - Invertebrate sequence entries, part 2289.
3912. gbinv229.seq - Invertebrate sequence entries, part 229.
3913. gbinv2290.seq - Invertebrate sequence entries, part 2290.
3914. gbinv2291.seq - Invertebrate sequence entries, part 2291.
3915. gbinv2292.seq - Invertebrate sequence entries, part 2292.
3916. gbinv2293.seq - Invertebrate sequence entries, part 2293.
3917. gbinv2294.seq - Invertebrate sequence entries, part 2294.
3918. gbinv2295.seq - Invertebrate sequence entries, part 2295.
3919. gbinv2296.seq - Invertebrate sequence entries, part 2296.
3920. gbinv2297.seq - Invertebrate sequence entries, part 2297.
3921. gbinv2298.seq - Invertebrate sequence entries, part 2298.
3922. gbinv2299.seq - Invertebrate sequence entries, part 2299.
3923. gbinv23.seq - Invertebrate sequence entries, part 23.
3924. gbinv230.seq - Invertebrate sequence entries, part 230.
3925. gbinv2300.seq - Invertebrate sequence entries, part 2300.
3926. gbinv2301.seq - Invertebrate sequence entries, part 2301.
3927. gbinv2302.seq - Invertebrate sequence entries, part 2302.
3928. gbinv2303.seq - Invertebrate sequence entries, part 2303.
3929. gbinv2304.seq - Invertebrate sequence entries, part 2304.
3930. gbinv2305.seq - Invertebrate sequence entries, part 2305.
3931. gbinv2306.seq - Invertebrate sequence entries, part 2306.
3932. gbinv2307.seq - Invertebrate sequence entries, part 2307.
3933. gbinv2308.seq - Invertebrate sequence entries, part 2308.
3934. gbinv2309.seq - Invertebrate sequence entries, part 2309.
3935. gbinv231.seq - Invertebrate sequence entries, part 231.
3936. gbinv2310.seq - Invertebrate sequence entries, part 2310.
3937. gbinv2311.seq - Invertebrate sequence entries, part 2311.
3938. gbinv2312.seq - Invertebrate sequence entries, part 2312.
3939. gbinv2313.seq - Invertebrate sequence entries, part 2313.
3940. gbinv2314.seq - Invertebrate sequence entries, part 2314.
3941. gbinv2315.seq - Invertebrate sequence entries, part 2315.
3942. gbinv2316.seq - Invertebrate sequence entries, part 2316.
3943. gbinv2317.seq - Invertebrate sequence entries, part 2317.
3944. gbinv2318.seq - Invertebrate sequence entries, part 2318.
3945. gbinv2319.seq - Invertebrate sequence entries, part 2319.
3946. gbinv232.seq - Invertebrate sequence entries, part 232.
3947. gbinv2320.seq - Invertebrate sequence entries, part 2320.
3948. gbinv2321.seq - Invertebrate sequence entries, part 2321.
3949. gbinv2322.seq - Invertebrate sequence entries, part 2322.
3950. gbinv2323.seq - Invertebrate sequence entries, part 2323.
3951. gbinv2324.seq - Invertebrate sequence entries, part 2324.
3952. gbinv2325.seq - Invertebrate sequence entries, part 2325.
3953. gbinv2326.seq - Invertebrate sequence entries, part 2326.
3954. gbinv2327.seq - Invertebrate sequence entries, part 2327.
3955. gbinv2328.seq - Invertebrate sequence entries, part 2328.
3956. gbinv2329.seq - Invertebrate sequence entries, part 2329.
3957. gbinv233.seq - Invertebrate sequence entries, part 233.
3958. gbinv2330.seq - Invertebrate sequence entries, part 2330.
3959. gbinv2331.seq - Invertebrate sequence entries, part 2331.
3960. gbinv2332.seq - Invertebrate sequence entries, part 2332.
3961. gbinv2333.seq - Invertebrate sequence entries, part 2333.
3962. gbinv2334.seq - Invertebrate sequence entries, part 2334.
3963. gbinv2335.seq - Invertebrate sequence entries, part 2335.
3964. gbinv2336.seq - Invertebrate sequence entries, part 2336.
3965. gbinv2337.seq - Invertebrate sequence entries, part 2337.
3966. gbinv2338.seq - Invertebrate sequence entries, part 2338.
3967. gbinv2339.seq - Invertebrate sequence entries, part 2339.
3968. gbinv234.seq - Invertebrate sequence entries, part 234.
3969. gbinv2340.seq - Invertebrate sequence entries, part 2340.
3970. gbinv2341.seq - Invertebrate sequence entries, part 2341.
3971. gbinv2342.seq - Invertebrate sequence entries, part 2342.
3972. gbinv2343.seq - Invertebrate sequence entries, part 2343.
3973. gbinv2344.seq - Invertebrate sequence entries, part 2344.
3974. gbinv2345.seq - Invertebrate sequence entries, part 2345.
3975. gbinv2346.seq - Invertebrate sequence entries, part 2346.
3976. gbinv2347.seq - Invertebrate sequence entries, part 2347.
3977. gbinv2348.seq - Invertebrate sequence entries, part 2348.
3978. gbinv2349.seq - Invertebrate sequence entries, part 2349.
3979. gbinv235.seq - Invertebrate sequence entries, part 235.
3980. gbinv2350.seq - Invertebrate sequence entries, part 2350.
3981. gbinv2351.seq - Invertebrate sequence entries, part 2351.
3982. gbinv2352.seq - Invertebrate sequence entries, part 2352.
3983. gbinv2353.seq - Invertebrate sequence entries, part 2353.
3984. gbinv2354.seq - Invertebrate sequence entries, part 2354.
3985. gbinv2355.seq - Invertebrate sequence entries, part 2355.
3986. gbinv2356.seq - Invertebrate sequence entries, part 2356.
3987. gbinv2357.seq - Invertebrate sequence entries, part 2357.
3988. gbinv2358.seq - Invertebrate sequence entries, part 2358.
3989. gbinv2359.seq - Invertebrate sequence entries, part 2359.
3990. gbinv236.seq - Invertebrate sequence entries, part 236.
3991. gbinv2360.seq - Invertebrate sequence entries, part 2360.
3992. gbinv2361.seq - Invertebrate sequence entries, part 2361.
3993. gbinv2362.seq - Invertebrate sequence entries, part 2362.
3994. gbinv2363.seq - Invertebrate sequence entries, part 2363.
3995. gbinv2364.seq - Invertebrate sequence entries, part 2364.
3996. gbinv2365.seq - Invertebrate sequence entries, part 2365.
3997. gbinv2366.seq - Invertebrate sequence entries, part 2366.
3998. gbinv2367.seq - Invertebrate sequence entries, part 2367.
3999. gbinv2368.seq - Invertebrate sequence entries, part 2368.
4000. gbinv2369.seq - Invertebrate sequence entries, part 2369.
4001. gbinv237.seq - Invertebrate sequence entries, part 237.
4002. gbinv2370.seq - Invertebrate sequence entries, part 2370.
4003. gbinv2371.seq - Invertebrate sequence entries, part 2371.
4004. gbinv2372.seq - Invertebrate sequence entries, part 2372.
4005. gbinv2373.seq - Invertebrate sequence entries, part 2373.
4006. gbinv2374.seq - Invertebrate sequence entries, part 2374.
4007. gbinv2375.seq - Invertebrate sequence entries, part 2375.
4008. gbinv2376.seq - Invertebrate sequence entries, part 2376.
4009. gbinv2377.seq - Invertebrate sequence entries, part 2377.
4010. gbinv2378.seq - Invertebrate sequence entries, part 2378.
4011. gbinv2379.seq - Invertebrate sequence entries, part 2379.
4012. gbinv238.seq - Invertebrate sequence entries, part 238.
4013. gbinv2380.seq - Invertebrate sequence entries, part 2380.
4014. gbinv2381.seq - Invertebrate sequence entries, part 2381.
4015. gbinv2382.seq - Invertebrate sequence entries, part 2382.
4016. gbinv2383.seq - Invertebrate sequence entries, part 2383.
4017. gbinv2384.seq - Invertebrate sequence entries, part 2384.
4018. gbinv2385.seq - Invertebrate sequence entries, part 2385.
4019. gbinv2386.seq - Invertebrate sequence entries, part 2386.
4020. gbinv2387.seq - Invertebrate sequence entries, part 2387.
4021. gbinv2388.seq - Invertebrate sequence entries, part 2388.
4022. gbinv2389.seq - Invertebrate sequence entries, part 2389.
4023. gbinv239.seq - Invertebrate sequence entries, part 239.
4024. gbinv2390.seq - Invertebrate sequence entries, part 2390.
4025. gbinv2391.seq - Invertebrate sequence entries, part 2391.
4026. gbinv2392.seq - Invertebrate sequence entries, part 2392.
4027. gbinv2393.seq - Invertebrate sequence entries, part 2393.
4028. gbinv2394.seq - Invertebrate sequence entries, part 2394.
4029. gbinv2395.seq - Invertebrate sequence entries, part 2395.
4030. gbinv2396.seq - Invertebrate sequence entries, part 2396.
4031. gbinv2397.seq - Invertebrate sequence entries, part 2397.
4032. gbinv2398.seq - Invertebrate sequence entries, part 2398.
4033. gbinv2399.seq - Invertebrate sequence entries, part 2399.
4034. gbinv24.seq - Invertebrate sequence entries, part 24.
4035. gbinv240.seq - Invertebrate sequence entries, part 240.
4036. gbinv2400.seq - Invertebrate sequence entries, part 2400.
4037. gbinv2401.seq - Invertebrate sequence entries, part 2401.
4038. gbinv2402.seq - Invertebrate sequence entries, part 2402.
4039. gbinv2403.seq - Invertebrate sequence entries, part 2403.
4040. gbinv2404.seq - Invertebrate sequence entries, part 2404.
4041. gbinv2405.seq - Invertebrate sequence entries, part 2405.
4042. gbinv2406.seq - Invertebrate sequence entries, part 2406.
4043. gbinv2407.seq - Invertebrate sequence entries, part 2407.
4044. gbinv2408.seq - Invertebrate sequence entries, part 2408.
4045. gbinv2409.seq - Invertebrate sequence entries, part 2409.
4046. gbinv241.seq - Invertebrate sequence entries, part 241.
4047. gbinv2410.seq - Invertebrate sequence entries, part 2410.
4048. gbinv2411.seq - Invertebrate sequence entries, part 2411.
4049. gbinv2412.seq - Invertebrate sequence entries, part 2412.
4050. gbinv2413.seq - Invertebrate sequence entries, part 2413.
4051. gbinv2414.seq - Invertebrate sequence entries, part 2414.
4052. gbinv2415.seq - Invertebrate sequence entries, part 2415.
4053. gbinv2416.seq - Invertebrate sequence entries, part 2416.
4054. gbinv2417.seq - Invertebrate sequence entries, part 2417.
4055. gbinv2418.seq - Invertebrate sequence entries, part 2418.
4056. gbinv2419.seq - Invertebrate sequence entries, part 2419.
4057. gbinv242.seq - Invertebrate sequence entries, part 242.
4058. gbinv2420.seq - Invertebrate sequence entries, part 2420.
4059. gbinv2421.seq - Invertebrate sequence entries, part 2421.
4060. gbinv2422.seq - Invertebrate sequence entries, part 2422.
4061. gbinv2423.seq - Invertebrate sequence entries, part 2423.
4062. gbinv2424.seq - Invertebrate sequence entries, part 2424.
4063. gbinv2425.seq - Invertebrate sequence entries, part 2425.
4064. gbinv2426.seq - Invertebrate sequence entries, part 2426.
4065. gbinv2427.seq - Invertebrate sequence entries, part 2427.
4066. gbinv2428.seq - Invertebrate sequence entries, part 2428.
4067. gbinv2429.seq - Invertebrate sequence entries, part 2429.
4068. gbinv243.seq - Invertebrate sequence entries, part 243.
4069. gbinv2430.seq - Invertebrate sequence entries, part 2430.
4070. gbinv2431.seq - Invertebrate sequence entries, part 2431.
4071. gbinv2432.seq - Invertebrate sequence entries, part 2432.
4072. gbinv2433.seq - Invertebrate sequence entries, part 2433.
4073. gbinv2434.seq - Invertebrate sequence entries, part 2434.
4074. gbinv2435.seq - Invertebrate sequence entries, part 2435.
4075. gbinv2436.seq - Invertebrate sequence entries, part 2436.
4076. gbinv2437.seq - Invertebrate sequence entries, part 2437.
4077. gbinv2438.seq - Invertebrate sequence entries, part 2438.
4078. gbinv2439.seq - Invertebrate sequence entries, part 2439.
4079. gbinv244.seq - Invertebrate sequence entries, part 244.
4080. gbinv2440.seq - Invertebrate sequence entries, part 2440.
4081. gbinv2441.seq - Invertebrate sequence entries, part 2441.
4082. gbinv2442.seq - Invertebrate sequence entries, part 2442.
4083. gbinv2443.seq - Invertebrate sequence entries, part 2443.
4084. gbinv2444.seq - Invertebrate sequence entries, part 2444.
4085. gbinv2445.seq - Invertebrate sequence entries, part 2445.
4086. gbinv2446.seq - Invertebrate sequence entries, part 2446.
4087. gbinv2447.seq - Invertebrate sequence entries, part 2447.
4088. gbinv2448.seq - Invertebrate sequence entries, part 2448.
4089. gbinv2449.seq - Invertebrate sequence entries, part 2449.
4090. gbinv245.seq - Invertebrate sequence entries, part 245.
4091. gbinv2450.seq - Invertebrate sequence entries, part 2450.
4092. gbinv2451.seq - Invertebrate sequence entries, part 2451.
4093. gbinv2452.seq - Invertebrate sequence entries, part 2452.
4094. gbinv2453.seq - Invertebrate sequence entries, part 2453.
4095. gbinv2454.seq - Invertebrate sequence entries, part 2454.
4096. gbinv2455.seq - Invertebrate sequence entries, part 2455.
4097. gbinv2456.seq - Invertebrate sequence entries, part 2456.
4098. gbinv2457.seq - Invertebrate sequence entries, part 2457.
4099. gbinv2458.seq - Invertebrate sequence entries, part 2458.
4100. gbinv2459.seq - Invertebrate sequence entries, part 2459.
4101. gbinv246.seq - Invertebrate sequence entries, part 246.
4102. gbinv2460.seq - Invertebrate sequence entries, part 2460.
4103. gbinv2461.seq - Invertebrate sequence entries, part 2461.
4104. gbinv2462.seq - Invertebrate sequence entries, part 2462.
4105. gbinv2463.seq - Invertebrate sequence entries, part 2463.
4106. gbinv2464.seq - Invertebrate sequence entries, part 2464.
4107. gbinv2465.seq - Invertebrate sequence entries, part 2465.
4108. gbinv2466.seq - Invertebrate sequence entries, part 2466.
4109. gbinv2467.seq - Invertebrate sequence entries, part 2467.
4110. gbinv2468.seq - Invertebrate sequence entries, part 2468.
4111. gbinv2469.seq - Invertebrate sequence entries, part 2469.
4112. gbinv247.seq - Invertebrate sequence entries, part 247.
4113. gbinv2470.seq - Invertebrate sequence entries, part 2470.
4114. gbinv2471.seq - Invertebrate sequence entries, part 2471.
4115. gbinv2472.seq - Invertebrate sequence entries, part 2472.
4116. gbinv2473.seq - Invertebrate sequence entries, part 2473.
4117. gbinv2474.seq - Invertebrate sequence entries, part 2474.
4118. gbinv2475.seq - Invertebrate sequence entries, part 2475.
4119. gbinv2476.seq - Invertebrate sequence entries, part 2476.
4120. gbinv2477.seq - Invertebrate sequence entries, part 2477.
4121. gbinv2478.seq - Invertebrate sequence entries, part 2478.
4122. gbinv2479.seq - Invertebrate sequence entries, part 2479.
4123. gbinv248.seq - Invertebrate sequence entries, part 248.
4124. gbinv2480.seq - Invertebrate sequence entries, part 2480.
4125. gbinv2481.seq - Invertebrate sequence entries, part 2481.
4126. gbinv2482.seq - Invertebrate sequence entries, part 2482.
4127. gbinv2483.seq - Invertebrate sequence entries, part 2483.
4128. gbinv2484.seq - Invertebrate sequence entries, part 2484.
4129. gbinv2485.seq - Invertebrate sequence entries, part 2485.
4130. gbinv2486.seq - Invertebrate sequence entries, part 2486.
4131. gbinv2487.seq - Invertebrate sequence entries, part 2487.
4132. gbinv2488.seq - Invertebrate sequence entries, part 2488.
4133. gbinv2489.seq - Invertebrate sequence entries, part 2489.
4134. gbinv249.seq - Invertebrate sequence entries, part 249.
4135. gbinv2490.seq - Invertebrate sequence entries, part 2490.
4136. gbinv2491.seq - Invertebrate sequence entries, part 2491.
4137. gbinv2492.seq - Invertebrate sequence entries, part 2492.
4138. gbinv2493.seq - Invertebrate sequence entries, part 2493.
4139. gbinv2494.seq - Invertebrate sequence entries, part 2494.
4140. gbinv2495.seq - Invertebrate sequence entries, part 2495.
4141. gbinv2496.seq - Invertebrate sequence entries, part 2496.
4142. gbinv2497.seq - Invertebrate sequence entries, part 2497.
4143. gbinv2498.seq - Invertebrate sequence entries, part 2498.
4144. gbinv2499.seq - Invertebrate sequence entries, part 2499.
4145. gbinv25.seq - Invertebrate sequence entries, part 25.
4146. gbinv250.seq - Invertebrate sequence entries, part 250.
4147. gbinv2500.seq - Invertebrate sequence entries, part 2500.
4148. gbinv2501.seq - Invertebrate sequence entries, part 2501.
4149. gbinv2502.seq - Invertebrate sequence entries, part 2502.
4150. gbinv2503.seq - Invertebrate sequence entries, part 2503.
4151. gbinv2504.seq - Invertebrate sequence entries, part 2504.
4152. gbinv2505.seq - Invertebrate sequence entries, part 2505.
4153. gbinv2506.seq - Invertebrate sequence entries, part 2506.
4154. gbinv2507.seq - Invertebrate sequence entries, part 2507.
4155. gbinv2508.seq - Invertebrate sequence entries, part 2508.
4156. gbinv2509.seq - Invertebrate sequence entries, part 2509.
4157. gbinv251.seq - Invertebrate sequence entries, part 251.
4158. gbinv2510.seq - Invertebrate sequence entries, part 2510.
4159. gbinv2511.seq - Invertebrate sequence entries, part 2511.
4160. gbinv2512.seq - Invertebrate sequence entries, part 2512.
4161. gbinv2513.seq - Invertebrate sequence entries, part 2513.
4162. gbinv2514.seq - Invertebrate sequence entries, part 2514.
4163. gbinv2515.seq - Invertebrate sequence entries, part 2515.
4164. gbinv2516.seq - Invertebrate sequence entries, part 2516.
4165. gbinv2517.seq - Invertebrate sequence entries, part 2517.
4166. gbinv2518.seq - Invertebrate sequence entries, part 2518.
4167. gbinv2519.seq - Invertebrate sequence entries, part 2519.
4168. gbinv252.seq - Invertebrate sequence entries, part 252.
4169. gbinv2520.seq - Invertebrate sequence entries, part 2520.
4170. gbinv2521.seq - Invertebrate sequence entries, part 2521.
4171. gbinv2522.seq - Invertebrate sequence entries, part 2522.
4172. gbinv2523.seq - Invertebrate sequence entries, part 2523.
4173. gbinv2524.seq - Invertebrate sequence entries, part 2524.
4174. gbinv2525.seq - Invertebrate sequence entries, part 2525.
4175. gbinv2526.seq - Invertebrate sequence entries, part 2526.
4176. gbinv2527.seq - Invertebrate sequence entries, part 2527.
4177. gbinv2528.seq - Invertebrate sequence entries, part 2528.
4178. gbinv2529.seq - Invertebrate sequence entries, part 2529.
4179. gbinv253.seq - Invertebrate sequence entries, part 253.
4180. gbinv2530.seq - Invertebrate sequence entries, part 2530.
4181. gbinv2531.seq - Invertebrate sequence entries, part 2531.
4182. gbinv2532.seq - Invertebrate sequence entries, part 2532.
4183. gbinv2533.seq - Invertebrate sequence entries, part 2533.
4184. gbinv2534.seq - Invertebrate sequence entries, part 2534.
4185. gbinv2535.seq - Invertebrate sequence entries, part 2535.
4186. gbinv2536.seq - Invertebrate sequence entries, part 2536.
4187. gbinv2537.seq - Invertebrate sequence entries, part 2537.
4188. gbinv2538.seq - Invertebrate sequence entries, part 2538.
4189. gbinv2539.seq - Invertebrate sequence entries, part 2539.
4190. gbinv254.seq - Invertebrate sequence entries, part 254.
4191. gbinv2540.seq - Invertebrate sequence entries, part 2540.
4192. gbinv2541.seq - Invertebrate sequence entries, part 2541.
4193. gbinv2542.seq - Invertebrate sequence entries, part 2542.
4194. gbinv2543.seq - Invertebrate sequence entries, part 2543.
4195. gbinv2544.seq - Invertebrate sequence entries, part 2544.
4196. gbinv2545.seq - Invertebrate sequence entries, part 2545.
4197. gbinv2546.seq - Invertebrate sequence entries, part 2546.
4198. gbinv2547.seq - Invertebrate sequence entries, part 2547.
4199. gbinv2548.seq - Invertebrate sequence entries, part 2548.
4200. gbinv2549.seq - Invertebrate sequence entries, part 2549.
4201. gbinv255.seq - Invertebrate sequence entries, part 255.
4202. gbinv2550.seq - Invertebrate sequence entries, part 2550.
4203. gbinv2551.seq - Invertebrate sequence entries, part 2551.
4204. gbinv2552.seq - Invertebrate sequence entries, part 2552.
4205. gbinv2553.seq - Invertebrate sequence entries, part 2553.
4206. gbinv2554.seq - Invertebrate sequence entries, part 2554.
4207. gbinv2555.seq - Invertebrate sequence entries, part 2555.
4208. gbinv2556.seq - Invertebrate sequence entries, part 2556.
4209. gbinv2557.seq - Invertebrate sequence entries, part 2557.
4210. gbinv2558.seq - Invertebrate sequence entries, part 2558.
4211. gbinv2559.seq - Invertebrate sequence entries, part 2559.
4212. gbinv256.seq - Invertebrate sequence entries, part 256.
4213. gbinv2560.seq - Invertebrate sequence entries, part 2560.
4214. gbinv2561.seq - Invertebrate sequence entries, part 2561.
4215. gbinv257.seq - Invertebrate sequence entries, part 257.
4216. gbinv258.seq - Invertebrate sequence entries, part 258.
4217. gbinv259.seq - Invertebrate sequence entries, part 259.
4218. gbinv26.seq - Invertebrate sequence entries, part 26.
4219. gbinv260.seq - Invertebrate sequence entries, part 260.
4220. gbinv261.seq - Invertebrate sequence entries, part 261.
4221. gbinv262.seq - Invertebrate sequence entries, part 262.
4222. gbinv263.seq - Invertebrate sequence entries, part 263.
4223. gbinv264.seq - Invertebrate sequence entries, part 264.
4224. gbinv265.seq - Invertebrate sequence entries, part 265.
4225. gbinv266.seq - Invertebrate sequence entries, part 266.
4226. gbinv267.seq - Invertebrate sequence entries, part 267.
4227. gbinv268.seq - Invertebrate sequence entries, part 268.
4228. gbinv269.seq - Invertebrate sequence entries, part 269.
4229. gbinv27.seq - Invertebrate sequence entries, part 27.
4230. gbinv270.seq - Invertebrate sequence entries, part 270.
4231. gbinv271.seq - Invertebrate sequence entries, part 271.
4232. gbinv272.seq - Invertebrate sequence entries, part 272.
4233. gbinv273.seq - Invertebrate sequence entries, part 273.
4234. gbinv274.seq - Invertebrate sequence entries, part 274.
4235. gbinv275.seq - Invertebrate sequence entries, part 275.
4236. gbinv276.seq - Invertebrate sequence entries, part 276.
4237. gbinv277.seq - Invertebrate sequence entries, part 277.
4238. gbinv278.seq - Invertebrate sequence entries, part 278.
4239. gbinv279.seq - Invertebrate sequence entries, part 279.
4240. gbinv28.seq - Invertebrate sequence entries, part 28.
4241. gbinv280.seq - Invertebrate sequence entries, part 280.
4242. gbinv281.seq - Invertebrate sequence entries, part 281.
4243. gbinv282.seq - Invertebrate sequence entries, part 282.
4244. gbinv283.seq - Invertebrate sequence entries, part 283.
4245. gbinv284.seq - Invertebrate sequence entries, part 284.
4246. gbinv285.seq - Invertebrate sequence entries, part 285.
4247. gbinv286.seq - Invertebrate sequence entries, part 286.
4248. gbinv287.seq - Invertebrate sequence entries, part 287.
4249. gbinv288.seq - Invertebrate sequence entries, part 288.
4250. gbinv289.seq - Invertebrate sequence entries, part 289.
4251. gbinv29.seq - Invertebrate sequence entries, part 29.
4252. gbinv290.seq - Invertebrate sequence entries, part 290.
4253. gbinv291.seq - Invertebrate sequence entries, part 291.
4254. gbinv292.seq - Invertebrate sequence entries, part 292.
4255. gbinv293.seq - Invertebrate sequence entries, part 293.
4256. gbinv294.seq - Invertebrate sequence entries, part 294.
4257. gbinv295.seq - Invertebrate sequence entries, part 295.
4258. gbinv296.seq - Invertebrate sequence entries, part 296.
4259. gbinv297.seq - Invertebrate sequence entries, part 297.
4260. gbinv298.seq - Invertebrate sequence entries, part 298.
4261. gbinv299.seq - Invertebrate sequence entries, part 299.
4262. gbinv3.seq - Invertebrate sequence entries, part 3.
4263. gbinv30.seq - Invertebrate sequence entries, part 30.
4264. gbinv300.seq - Invertebrate sequence entries, part 300.
4265. gbinv301.seq - Invertebrate sequence entries, part 301.
4266. gbinv302.seq - Invertebrate sequence entries, part 302.
4267. gbinv303.seq - Invertebrate sequence entries, part 303.
4268. gbinv304.seq - Invertebrate sequence entries, part 304.
4269. gbinv305.seq - Invertebrate sequence entries, part 305.
4270. gbinv306.seq - Invertebrate sequence entries, part 306.
4271. gbinv307.seq - Invertebrate sequence entries, part 307.
4272. gbinv308.seq - Invertebrate sequence entries, part 308.
4273. gbinv309.seq - Invertebrate sequence entries, part 309.
4274. gbinv31.seq - Invertebrate sequence entries, part 31.
4275. gbinv310.seq - Invertebrate sequence entries, part 310.
4276. gbinv311.seq - Invertebrate sequence entries, part 311.
4277. gbinv312.seq - Invertebrate sequence entries, part 312.
4278. gbinv313.seq - Invertebrate sequence entries, part 313.
4279. gbinv314.seq - Invertebrate sequence entries, part 314.
4280. gbinv315.seq - Invertebrate sequence entries, part 315.
4281. gbinv316.seq - Invertebrate sequence entries, part 316.
4282. gbinv317.seq - Invertebrate sequence entries, part 317.
4283. gbinv318.seq - Invertebrate sequence entries, part 318.
4284. gbinv319.seq - Invertebrate sequence entries, part 319.
4285. gbinv32.seq - Invertebrate sequence entries, part 32.
4286. gbinv320.seq - Invertebrate sequence entries, part 320.
4287. gbinv321.seq - Invertebrate sequence entries, part 321.
4288. gbinv322.seq - Invertebrate sequence entries, part 322.
4289. gbinv323.seq - Invertebrate sequence entries, part 323.
4290. gbinv324.seq - Invertebrate sequence entries, part 324.
4291. gbinv325.seq - Invertebrate sequence entries, part 325.
4292. gbinv326.seq - Invertebrate sequence entries, part 326.
4293. gbinv327.seq - Invertebrate sequence entries, part 327.
4294. gbinv328.seq - Invertebrate sequence entries, part 328.
4295. gbinv329.seq - Invertebrate sequence entries, part 329.
4296. gbinv33.seq - Invertebrate sequence entries, part 33.
4297. gbinv330.seq - Invertebrate sequence entries, part 330.
4298. gbinv331.seq - Invertebrate sequence entries, part 331.
4299. gbinv332.seq - Invertebrate sequence entries, part 332.
4300. gbinv333.seq - Invertebrate sequence entries, part 333.
4301. gbinv334.seq - Invertebrate sequence entries, part 334.
4302. gbinv335.seq - Invertebrate sequence entries, part 335.
4303. gbinv336.seq - Invertebrate sequence entries, part 336.
4304. gbinv337.seq - Invertebrate sequence entries, part 337.
4305. gbinv338.seq - Invertebrate sequence entries, part 338.
4306. gbinv339.seq - Invertebrate sequence entries, part 339.
4307. gbinv34.seq - Invertebrate sequence entries, part 34.
4308. gbinv340.seq - Invertebrate sequence entries, part 340.
4309. gbinv341.seq - Invertebrate sequence entries, part 341.
4310. gbinv342.seq - Invertebrate sequence entries, part 342.
4311. gbinv343.seq - Invertebrate sequence entries, part 343.
4312. gbinv344.seq - Invertebrate sequence entries, part 344.
4313. gbinv345.seq - Invertebrate sequence entries, part 345.
4314. gbinv346.seq - Invertebrate sequence entries, part 346.
4315. gbinv347.seq - Invertebrate sequence entries, part 347.
4316. gbinv348.seq - Invertebrate sequence entries, part 348.
4317. gbinv349.seq - Invertebrate sequence entries, part 349.
4318. gbinv35.seq - Invertebrate sequence entries, part 35.
4319. gbinv350.seq - Invertebrate sequence entries, part 350.
4320. gbinv351.seq - Invertebrate sequence entries, part 351.
4321. gbinv352.seq - Invertebrate sequence entries, part 352.
4322. gbinv353.seq - Invertebrate sequence entries, part 353.
4323. gbinv354.seq - Invertebrate sequence entries, part 354.
4324. gbinv355.seq - Invertebrate sequence entries, part 355.
4325. gbinv356.seq - Invertebrate sequence entries, part 356.
4326. gbinv357.seq - Invertebrate sequence entries, part 357.
4327. gbinv358.seq - Invertebrate sequence entries, part 358.
4328. gbinv359.seq - Invertebrate sequence entries, part 359.
4329. gbinv36.seq - Invertebrate sequence entries, part 36.
4330. gbinv360.seq - Invertebrate sequence entries, part 360.
4331. gbinv361.seq - Invertebrate sequence entries, part 361.
4332. gbinv362.seq - Invertebrate sequence entries, part 362.
4333. gbinv363.seq - Invertebrate sequence entries, part 363.
4334. gbinv364.seq - Invertebrate sequence entries, part 364.
4335. gbinv365.seq - Invertebrate sequence entries, part 365.
4336. gbinv366.seq - Invertebrate sequence entries, part 366.
4337. gbinv367.seq - Invertebrate sequence entries, part 367.
4338. gbinv368.seq - Invertebrate sequence entries, part 368.
4339. gbinv369.seq - Invertebrate sequence entries, part 369.
4340. gbinv37.seq - Invertebrate sequence entries, part 37.
4341. gbinv370.seq - Invertebrate sequence entries, part 370.
4342. gbinv371.seq - Invertebrate sequence entries, part 371.
4343. gbinv372.seq - Invertebrate sequence entries, part 372.
4344. gbinv373.seq - Invertebrate sequence entries, part 373.
4345. gbinv374.seq - Invertebrate sequence entries, part 374.
4346. gbinv375.seq - Invertebrate sequence entries, part 375.
4347. gbinv376.seq - Invertebrate sequence entries, part 376.
4348. gbinv377.seq - Invertebrate sequence entries, part 377.
4349. gbinv378.seq - Invertebrate sequence entries, part 378.
4350. gbinv379.seq - Invertebrate sequence entries, part 379.
4351. gbinv38.seq - Invertebrate sequence entries, part 38.
4352. gbinv380.seq - Invertebrate sequence entries, part 380.
4353. gbinv381.seq - Invertebrate sequence entries, part 381.
4354. gbinv382.seq - Invertebrate sequence entries, part 382.
4355. gbinv383.seq - Invertebrate sequence entries, part 383.
4356. gbinv384.seq - Invertebrate sequence entries, part 384.
4357. gbinv385.seq - Invertebrate sequence entries, part 385.
4358. gbinv386.seq - Invertebrate sequence entries, part 386.
4359. gbinv387.seq - Invertebrate sequence entries, part 387.
4360. gbinv388.seq - Invertebrate sequence entries, part 388.
4361. gbinv389.seq - Invertebrate sequence entries, part 389.
4362. gbinv39.seq - Invertebrate sequence entries, part 39.
4363. gbinv390.seq - Invertebrate sequence entries, part 390.
4364. gbinv391.seq - Invertebrate sequence entries, part 391.
4365. gbinv392.seq - Invertebrate sequence entries, part 392.
4366. gbinv393.seq - Invertebrate sequence entries, part 393.
4367. gbinv394.seq - Invertebrate sequence entries, part 394.
4368. gbinv395.seq - Invertebrate sequence entries, part 395.
4369. gbinv396.seq - Invertebrate sequence entries, part 396.
4370. gbinv397.seq - Invertebrate sequence entries, part 397.
4371. gbinv398.seq - Invertebrate sequence entries, part 398.
4372. gbinv399.seq - Invertebrate sequence entries, part 399.
4373. gbinv4.seq - Invertebrate sequence entries, part 4.
4374. gbinv40.seq - Invertebrate sequence entries, part 40.
4375. gbinv400.seq - Invertebrate sequence entries, part 400.
4376. gbinv401.seq - Invertebrate sequence entries, part 401.
4377. gbinv402.seq - Invertebrate sequence entries, part 402.
4378. gbinv403.seq - Invertebrate sequence entries, part 403.
4379. gbinv404.seq - Invertebrate sequence entries, part 404.
4380. gbinv405.seq - Invertebrate sequence entries, part 405.
4381. gbinv406.seq - Invertebrate sequence entries, part 406.
4382. gbinv407.seq - Invertebrate sequence entries, part 407.
4383. gbinv408.seq - Invertebrate sequence entries, part 408.
4384. gbinv409.seq - Invertebrate sequence entries, part 409.
4385. gbinv41.seq - Invertebrate sequence entries, part 41.
4386. gbinv410.seq - Invertebrate sequence entries, part 410.
4387. gbinv411.seq - Invertebrate sequence entries, part 411.
4388. gbinv412.seq - Invertebrate sequence entries, part 412.
4389. gbinv413.seq - Invertebrate sequence entries, part 413.
4390. gbinv414.seq - Invertebrate sequence entries, part 414.
4391. gbinv415.seq - Invertebrate sequence entries, part 415.
4392. gbinv416.seq - Invertebrate sequence entries, part 416.
4393. gbinv417.seq - Invertebrate sequence entries, part 417.
4394. gbinv418.seq - Invertebrate sequence entries, part 418.
4395. gbinv419.seq - Invertebrate sequence entries, part 419.
4396. gbinv42.seq - Invertebrate sequence entries, part 42.
4397. gbinv420.seq - Invertebrate sequence entries, part 420.
4398. gbinv421.seq - Invertebrate sequence entries, part 421.
4399. gbinv422.seq - Invertebrate sequence entries, part 422.
4400. gbinv423.seq - Invertebrate sequence entries, part 423.
4401. gbinv424.seq - Invertebrate sequence entries, part 424.
4402. gbinv425.seq - Invertebrate sequence entries, part 425.
4403. gbinv426.seq - Invertebrate sequence entries, part 426.
4404. gbinv427.seq - Invertebrate sequence entries, part 427.
4405. gbinv428.seq - Invertebrate sequence entries, part 428.
4406. gbinv429.seq - Invertebrate sequence entries, part 429.
4407. gbinv43.seq - Invertebrate sequence entries, part 43.
4408. gbinv430.seq - Invertebrate sequence entries, part 430.
4409. gbinv431.seq - Invertebrate sequence entries, part 431.
4410. gbinv432.seq - Invertebrate sequence entries, part 432.
4411. gbinv433.seq - Invertebrate sequence entries, part 433.
4412. gbinv434.seq - Invertebrate sequence entries, part 434.
4413. gbinv435.seq - Invertebrate sequence entries, part 435.
4414. gbinv436.seq - Invertebrate sequence entries, part 436.
4415. gbinv437.seq - Invertebrate sequence entries, part 437.
4416. gbinv438.seq - Invertebrate sequence entries, part 438.
4417. gbinv439.seq - Invertebrate sequence entries, part 439.
4418. gbinv44.seq - Invertebrate sequence entries, part 44.
4419. gbinv440.seq - Invertebrate sequence entries, part 440.
4420. gbinv441.seq - Invertebrate sequence entries, part 441.
4421. gbinv442.seq - Invertebrate sequence entries, part 442.
4422. gbinv443.seq - Invertebrate sequence entries, part 443.
4423. gbinv444.seq - Invertebrate sequence entries, part 444.
4424. gbinv445.seq - Invertebrate sequence entries, part 445.
4425. gbinv446.seq - Invertebrate sequence entries, part 446.
4426. gbinv447.seq - Invertebrate sequence entries, part 447.
4427. gbinv448.seq - Invertebrate sequence entries, part 448.
4428. gbinv449.seq - Invertebrate sequence entries, part 449.
4429. gbinv45.seq - Invertebrate sequence entries, part 45.
4430. gbinv450.seq - Invertebrate sequence entries, part 450.
4431. gbinv451.seq - Invertebrate sequence entries, part 451.
4432. gbinv452.seq - Invertebrate sequence entries, part 452.
4433. gbinv453.seq - Invertebrate sequence entries, part 453.
4434. gbinv454.seq - Invertebrate sequence entries, part 454.
4435. gbinv455.seq - Invertebrate sequence entries, part 455.
4436. gbinv456.seq - Invertebrate sequence entries, part 456.
4437. gbinv457.seq - Invertebrate sequence entries, part 457.
4438. gbinv458.seq - Invertebrate sequence entries, part 458.
4439. gbinv459.seq - Invertebrate sequence entries, part 459.
4440. gbinv46.seq - Invertebrate sequence entries, part 46.
4441. gbinv460.seq - Invertebrate sequence entries, part 460.
4442. gbinv461.seq - Invertebrate sequence entries, part 461.
4443. gbinv462.seq - Invertebrate sequence entries, part 462.
4444. gbinv463.seq - Invertebrate sequence entries, part 463.
4445. gbinv464.seq - Invertebrate sequence entries, part 464.
4446. gbinv465.seq - Invertebrate sequence entries, part 465.
4447. gbinv466.seq - Invertebrate sequence entries, part 466.
4448. gbinv467.seq - Invertebrate sequence entries, part 467.
4449. gbinv468.seq - Invertebrate sequence entries, part 468.
4450. gbinv469.seq - Invertebrate sequence entries, part 469.
4451. gbinv47.seq - Invertebrate sequence entries, part 47.
4452. gbinv470.seq - Invertebrate sequence entries, part 470.
4453. gbinv471.seq - Invertebrate sequence entries, part 471.
4454. gbinv472.seq - Invertebrate sequence entries, part 472.
4455. gbinv473.seq - Invertebrate sequence entries, part 473.
4456. gbinv474.seq - Invertebrate sequence entries, part 474.
4457. gbinv475.seq - Invertebrate sequence entries, part 475.
4458. gbinv476.seq - Invertebrate sequence entries, part 476.
4459. gbinv477.seq - Invertebrate sequence entries, part 477.
4460. gbinv478.seq - Invertebrate sequence entries, part 478.
4461. gbinv479.seq - Invertebrate sequence entries, part 479.
4462. gbinv48.seq - Invertebrate sequence entries, part 48.
4463. gbinv480.seq - Invertebrate sequence entries, part 480.
4464. gbinv481.seq - Invertebrate sequence entries, part 481.
4465. gbinv482.seq - Invertebrate sequence entries, part 482.
4466. gbinv483.seq - Invertebrate sequence entries, part 483.
4467. gbinv484.seq - Invertebrate sequence entries, part 484.
4468. gbinv485.seq - Invertebrate sequence entries, part 485.
4469. gbinv486.seq - Invertebrate sequence entries, part 486.
4470. gbinv487.seq - Invertebrate sequence entries, part 487.
4471. gbinv488.seq - Invertebrate sequence entries, part 488.
4472. gbinv489.seq - Invertebrate sequence entries, part 489.
4473. gbinv49.seq - Invertebrate sequence entries, part 49.
4474. gbinv490.seq - Invertebrate sequence entries, part 490.
4475. gbinv491.seq - Invertebrate sequence entries, part 491.
4476. gbinv492.seq - Invertebrate sequence entries, part 492.
4477. gbinv493.seq - Invertebrate sequence entries, part 493.
4478. gbinv494.seq - Invertebrate sequence entries, part 494.
4479. gbinv495.seq - Invertebrate sequence entries, part 495.
4480. gbinv496.seq - Invertebrate sequence entries, part 496.
4481. gbinv497.seq - Invertebrate sequence entries, part 497.
4482. gbinv498.seq - Invertebrate sequence entries, part 498.
4483. gbinv499.seq - Invertebrate sequence entries, part 499.
4484. gbinv5.seq - Invertebrate sequence entries, part 5.
4485. gbinv50.seq - Invertebrate sequence entries, part 50.
4486. gbinv500.seq - Invertebrate sequence entries, part 500.
4487. gbinv501.seq - Invertebrate sequence entries, part 501.
4488. gbinv502.seq - Invertebrate sequence entries, part 502.
4489. gbinv503.seq - Invertebrate sequence entries, part 503.
4490. gbinv504.seq - Invertebrate sequence entries, part 504.
4491. gbinv505.seq - Invertebrate sequence entries, part 505.
4492. gbinv506.seq - Invertebrate sequence entries, part 506.
4493. gbinv507.seq - Invertebrate sequence entries, part 507.
4494. gbinv508.seq - Invertebrate sequence entries, part 508.
4495. gbinv509.seq - Invertebrate sequence entries, part 509.
4496. gbinv51.seq - Invertebrate sequence entries, part 51.
4497. gbinv510.seq - Invertebrate sequence entries, part 510.
4498. gbinv511.seq - Invertebrate sequence entries, part 511.
4499. gbinv512.seq - Invertebrate sequence entries, part 512.
4500. gbinv513.seq - Invertebrate sequence entries, part 513.
4501. gbinv514.seq - Invertebrate sequence entries, part 514.
4502. gbinv515.seq - Invertebrate sequence entries, part 515.
4503. gbinv516.seq - Invertebrate sequence entries, part 516.
4504. gbinv517.seq - Invertebrate sequence entries, part 517.
4505. gbinv518.seq - Invertebrate sequence entries, part 518.
4506. gbinv519.seq - Invertebrate sequence entries, part 519.
4507. gbinv52.seq - Invertebrate sequence entries, part 52.
4508. gbinv520.seq - Invertebrate sequence entries, part 520.
4509. gbinv521.seq - Invertebrate sequence entries, part 521.
4510. gbinv522.seq - Invertebrate sequence entries, part 522.
4511. gbinv523.seq - Invertebrate sequence entries, part 523.
4512. gbinv524.seq - Invertebrate sequence entries, part 524.
4513. gbinv525.seq - Invertebrate sequence entries, part 525.
4514. gbinv526.seq - Invertebrate sequence entries, part 526.
4515. gbinv527.seq - Invertebrate sequence entries, part 527.
4516. gbinv528.seq - Invertebrate sequence entries, part 528.
4517. gbinv529.seq - Invertebrate sequence entries, part 529.
4518. gbinv53.seq - Invertebrate sequence entries, part 53.
4519. gbinv530.seq - Invertebrate sequence entries, part 530.
4520. gbinv531.seq - Invertebrate sequence entries, part 531.
4521. gbinv532.seq - Invertebrate sequence entries, part 532.
4522. gbinv533.seq - Invertebrate sequence entries, part 533.
4523. gbinv534.seq - Invertebrate sequence entries, part 534.
4524. gbinv535.seq - Invertebrate sequence entries, part 535.
4525. gbinv536.seq - Invertebrate sequence entries, part 536.
4526. gbinv537.seq - Invertebrate sequence entries, part 537.
4527. gbinv538.seq - Invertebrate sequence entries, part 538.
4528. gbinv539.seq - Invertebrate sequence entries, part 539.
4529. gbinv54.seq - Invertebrate sequence entries, part 54.
4530. gbinv540.seq - Invertebrate sequence entries, part 540.
4531. gbinv541.seq - Invertebrate sequence entries, part 541.
4532. gbinv542.seq - Invertebrate sequence entries, part 542.
4533. gbinv543.seq - Invertebrate sequence entries, part 543.
4534. gbinv544.seq - Invertebrate sequence entries, part 544.
4535. gbinv545.seq - Invertebrate sequence entries, part 545.
4536. gbinv546.seq - Invertebrate sequence entries, part 546.
4537. gbinv547.seq - Invertebrate sequence entries, part 547.
4538. gbinv548.seq - Invertebrate sequence entries, part 548.
4539. gbinv549.seq - Invertebrate sequence entries, part 549.
4540. gbinv55.seq - Invertebrate sequence entries, part 55.
4541. gbinv550.seq - Invertebrate sequence entries, part 550.
4542. gbinv551.seq - Invertebrate sequence entries, part 551.
4543. gbinv552.seq - Invertebrate sequence entries, part 552.
4544. gbinv553.seq - Invertebrate sequence entries, part 553.
4545. gbinv554.seq - Invertebrate sequence entries, part 554.
4546. gbinv555.seq - Invertebrate sequence entries, part 555.
4547. gbinv556.seq - Invertebrate sequence entries, part 556.
4548. gbinv557.seq - Invertebrate sequence entries, part 557.
4549. gbinv558.seq - Invertebrate sequence entries, part 558.
4550. gbinv559.seq - Invertebrate sequence entries, part 559.
4551. gbinv56.seq - Invertebrate sequence entries, part 56.
4552. gbinv560.seq - Invertebrate sequence entries, part 560.
4553. gbinv561.seq - Invertebrate sequence entries, part 561.
4554. gbinv562.seq - Invertebrate sequence entries, part 562.
4555. gbinv563.seq - Invertebrate sequence entries, part 563.
4556. gbinv564.seq - Invertebrate sequence entries, part 564.
4557. gbinv565.seq - Invertebrate sequence entries, part 565.
4558. gbinv566.seq - Invertebrate sequence entries, part 566.
4559. gbinv567.seq - Invertebrate sequence entries, part 567.
4560. gbinv568.seq - Invertebrate sequence entries, part 568.
4561. gbinv569.seq - Invertebrate sequence entries, part 569.
4562. gbinv57.seq - Invertebrate sequence entries, part 57.
4563. gbinv570.seq - Invertebrate sequence entries, part 570.
4564. gbinv571.seq - Invertebrate sequence entries, part 571.
4565. gbinv572.seq - Invertebrate sequence entries, part 572.
4566. gbinv573.seq - Invertebrate sequence entries, part 573.
4567. gbinv574.seq - Invertebrate sequence entries, part 574.
4568. gbinv575.seq - Invertebrate sequence entries, part 575.
4569. gbinv576.seq - Invertebrate sequence entries, part 576.
4570. gbinv577.seq - Invertebrate sequence entries, part 577.
4571. gbinv578.seq - Invertebrate sequence entries, part 578.
4572. gbinv579.seq - Invertebrate sequence entries, part 579.
4573. gbinv58.seq - Invertebrate sequence entries, part 58.
4574. gbinv580.seq - Invertebrate sequence entries, part 580.
4575. gbinv581.seq - Invertebrate sequence entries, part 581.
4576. gbinv582.seq - Invertebrate sequence entries, part 582.
4577. gbinv583.seq - Invertebrate sequence entries, part 583.
4578. gbinv584.seq - Invertebrate sequence entries, part 584.
4579. gbinv585.seq - Invertebrate sequence entries, part 585.
4580. gbinv586.seq - Invertebrate sequence entries, part 586.
4581. gbinv587.seq - Invertebrate sequence entries, part 587.
4582. gbinv588.seq - Invertebrate sequence entries, part 588.
4583. gbinv589.seq - Invertebrate sequence entries, part 589.
4584. gbinv59.seq - Invertebrate sequence entries, part 59.
4585. gbinv590.seq - Invertebrate sequence entries, part 590.
4586. gbinv591.seq - Invertebrate sequence entries, part 591.
4587. gbinv592.seq - Invertebrate sequence entries, part 592.
4588. gbinv593.seq - Invertebrate sequence entries, part 593.
4589. gbinv594.seq - Invertebrate sequence entries, part 594.
4590. gbinv595.seq - Invertebrate sequence entries, part 595.
4591. gbinv596.seq - Invertebrate sequence entries, part 596.
4592. gbinv597.seq - Invertebrate sequence entries, part 597.
4593. gbinv598.seq - Invertebrate sequence entries, part 598.
4594. gbinv599.seq - Invertebrate sequence entries, part 599.
4595. gbinv6.seq - Invertebrate sequence entries, part 6.
4596. gbinv60.seq - Invertebrate sequence entries, part 60.
4597. gbinv600.seq - Invertebrate sequence entries, part 600.
4598. gbinv601.seq - Invertebrate sequence entries, part 601.
4599. gbinv602.seq - Invertebrate sequence entries, part 602.
4600. gbinv603.seq - Invertebrate sequence entries, part 603.
4601. gbinv604.seq - Invertebrate sequence entries, part 604.
4602. gbinv605.seq - Invertebrate sequence entries, part 605.
4603. gbinv606.seq - Invertebrate sequence entries, part 606.
4604. gbinv607.seq - Invertebrate sequence entries, part 607.
4605. gbinv608.seq - Invertebrate sequence entries, part 608.
4606. gbinv609.seq - Invertebrate sequence entries, part 609.
4607. gbinv61.seq - Invertebrate sequence entries, part 61.
4608. gbinv610.seq - Invertebrate sequence entries, part 610.
4609. gbinv611.seq - Invertebrate sequence entries, part 611.
4610. gbinv612.seq - Invertebrate sequence entries, part 612.
4611. gbinv613.seq - Invertebrate sequence entries, part 613.
4612. gbinv614.seq - Invertebrate sequence entries, part 614.
4613. gbinv615.seq - Invertebrate sequence entries, part 615.
4614. gbinv616.seq - Invertebrate sequence entries, part 616.
4615. gbinv617.seq - Invertebrate sequence entries, part 617.
4616. gbinv618.seq - Invertebrate sequence entries, part 618.
4617. gbinv619.seq - Invertebrate sequence entries, part 619.
4618. gbinv62.seq - Invertebrate sequence entries, part 62.
4619. gbinv620.seq - Invertebrate sequence entries, part 620.
4620. gbinv621.seq - Invertebrate sequence entries, part 621.
4621. gbinv622.seq - Invertebrate sequence entries, part 622.
4622. gbinv623.seq - Invertebrate sequence entries, part 623.
4623. gbinv624.seq - Invertebrate sequence entries, part 624.
4624. gbinv625.seq - Invertebrate sequence entries, part 625.
4625. gbinv626.seq - Invertebrate sequence entries, part 626.
4626. gbinv627.seq - Invertebrate sequence entries, part 627.
4627. gbinv628.seq - Invertebrate sequence entries, part 628.
4628. gbinv629.seq - Invertebrate sequence entries, part 629.
4629. gbinv63.seq - Invertebrate sequence entries, part 63.
4630. gbinv630.seq - Invertebrate sequence entries, part 630.
4631. gbinv631.seq - Invertebrate sequence entries, part 631.
4632. gbinv632.seq - Invertebrate sequence entries, part 632.
4633. gbinv633.seq - Invertebrate sequence entries, part 633.
4634. gbinv634.seq - Invertebrate sequence entries, part 634.
4635. gbinv635.seq - Invertebrate sequence entries, part 635.
4636. gbinv636.seq - Invertebrate sequence entries, part 636.
4637. gbinv637.seq - Invertebrate sequence entries, part 637.
4638. gbinv638.seq - Invertebrate sequence entries, part 638.
4639. gbinv639.seq - Invertebrate sequence entries, part 639.
4640. gbinv64.seq - Invertebrate sequence entries, part 64.
4641. gbinv640.seq - Invertebrate sequence entries, part 640.
4642. gbinv641.seq - Invertebrate sequence entries, part 641.
4643. gbinv642.seq - Invertebrate sequence entries, part 642.
4644. gbinv643.seq - Invertebrate sequence entries, part 643.
4645. gbinv644.seq - Invertebrate sequence entries, part 644.
4646. gbinv645.seq - Invertebrate sequence entries, part 645.
4647. gbinv646.seq - Invertebrate sequence entries, part 646.
4648. gbinv647.seq - Invertebrate sequence entries, part 647.
4649. gbinv648.seq - Invertebrate sequence entries, part 648.
4650. gbinv649.seq - Invertebrate sequence entries, part 649.
4651. gbinv65.seq - Invertebrate sequence entries, part 65.
4652. gbinv650.seq - Invertebrate sequence entries, part 650.
4653. gbinv651.seq - Invertebrate sequence entries, part 651.
4654. gbinv652.seq - Invertebrate sequence entries, part 652.
4655. gbinv653.seq - Invertebrate sequence entries, part 653.
4656. gbinv654.seq - Invertebrate sequence entries, part 654.
4657. gbinv655.seq - Invertebrate sequence entries, part 655.
4658. gbinv656.seq - Invertebrate sequence entries, part 656.
4659. gbinv657.seq - Invertebrate sequence entries, part 657.
4660. gbinv658.seq - Invertebrate sequence entries, part 658.
4661. gbinv659.seq - Invertebrate sequence entries, part 659.
4662. gbinv66.seq - Invertebrate sequence entries, part 66.
4663. gbinv660.seq - Invertebrate sequence entries, part 660.
4664. gbinv661.seq - Invertebrate sequence entries, part 661.
4665. gbinv662.seq - Invertebrate sequence entries, part 662.
4666. gbinv663.seq - Invertebrate sequence entries, part 663.
4667. gbinv664.seq - Invertebrate sequence entries, part 664.
4668. gbinv665.seq - Invertebrate sequence entries, part 665.
4669. gbinv666.seq - Invertebrate sequence entries, part 666.
4670. gbinv667.seq - Invertebrate sequence entries, part 667.
4671. gbinv668.seq - Invertebrate sequence entries, part 668.
4672. gbinv669.seq - Invertebrate sequence entries, part 669.
4673. gbinv67.seq - Invertebrate sequence entries, part 67.
4674. gbinv670.seq - Invertebrate sequence entries, part 670.
4675. gbinv671.seq - Invertebrate sequence entries, part 671.
4676. gbinv672.seq - Invertebrate sequence entries, part 672.
4677. gbinv673.seq - Invertebrate sequence entries, part 673.
4678. gbinv674.seq - Invertebrate sequence entries, part 674.
4679. gbinv675.seq - Invertebrate sequence entries, part 675.
4680. gbinv676.seq - Invertebrate sequence entries, part 676.
4681. gbinv677.seq - Invertebrate sequence entries, part 677.
4682. gbinv678.seq - Invertebrate sequence entries, part 678.
4683. gbinv679.seq - Invertebrate sequence entries, part 679.
4684. gbinv68.seq - Invertebrate sequence entries, part 68.
4685. gbinv680.seq - Invertebrate sequence entries, part 680.
4686. gbinv681.seq - Invertebrate sequence entries, part 681.
4687. gbinv682.seq - Invertebrate sequence entries, part 682.
4688. gbinv683.seq - Invertebrate sequence entries, part 683.
4689. gbinv684.seq - Invertebrate sequence entries, part 684.
4690. gbinv685.seq - Invertebrate sequence entries, part 685.
4691. gbinv686.seq - Invertebrate sequence entries, part 686.
4692. gbinv687.seq - Invertebrate sequence entries, part 687.
4693. gbinv688.seq - Invertebrate sequence entries, part 688.
4694. gbinv689.seq - Invertebrate sequence entries, part 689.
4695. gbinv69.seq - Invertebrate sequence entries, part 69.
4696. gbinv690.seq - Invertebrate sequence entries, part 690.
4697. gbinv691.seq - Invertebrate sequence entries, part 691.
4698. gbinv692.seq - Invertebrate sequence entries, part 692.
4699. gbinv693.seq - Invertebrate sequence entries, part 693.
4700. gbinv694.seq - Invertebrate sequence entries, part 694.
4701. gbinv695.seq - Invertebrate sequence entries, part 695.
4702. gbinv696.seq - Invertebrate sequence entries, part 696.
4703. gbinv697.seq - Invertebrate sequence entries, part 697.
4704. gbinv698.seq - Invertebrate sequence entries, part 698.
4705. gbinv699.seq - Invertebrate sequence entries, part 699.
4706. gbinv7.seq - Invertebrate sequence entries, part 7.
4707. gbinv70.seq - Invertebrate sequence entries, part 70.
4708. gbinv700.seq - Invertebrate sequence entries, part 700.
4709. gbinv701.seq - Invertebrate sequence entries, part 701.
4710. gbinv702.seq - Invertebrate sequence entries, part 702.
4711. gbinv703.seq - Invertebrate sequence entries, part 703.
4712. gbinv704.seq - Invertebrate sequence entries, part 704.
4713. gbinv705.seq - Invertebrate sequence entries, part 705.
4714. gbinv706.seq - Invertebrate sequence entries, part 706.
4715. gbinv707.seq - Invertebrate sequence entries, part 707.
4716. gbinv708.seq - Invertebrate sequence entries, part 708.
4717. gbinv709.seq - Invertebrate sequence entries, part 709.
4718. gbinv71.seq - Invertebrate sequence entries, part 71.
4719. gbinv710.seq - Invertebrate sequence entries, part 710.
4720. gbinv711.seq - Invertebrate sequence entries, part 711.
4721. gbinv712.seq - Invertebrate sequence entries, part 712.
4722. gbinv713.seq - Invertebrate sequence entries, part 713.
4723. gbinv714.seq - Invertebrate sequence entries, part 714.
4724. gbinv715.seq - Invertebrate sequence entries, part 715.
4725. gbinv716.seq - Invertebrate sequence entries, part 716.
4726. gbinv717.seq - Invertebrate sequence entries, part 717.
4727. gbinv718.seq - Invertebrate sequence entries, part 718.
4728. gbinv719.seq - Invertebrate sequence entries, part 719.
4729. gbinv72.seq - Invertebrate sequence entries, part 72.
4730. gbinv720.seq - Invertebrate sequence entries, part 720.
4731. gbinv721.seq - Invertebrate sequence entries, part 721.
4732. gbinv722.seq - Invertebrate sequence entries, part 722.
4733. gbinv723.seq - Invertebrate sequence entries, part 723.
4734. gbinv724.seq - Invertebrate sequence entries, part 724.
4735. gbinv725.seq - Invertebrate sequence entries, part 725.
4736. gbinv726.seq - Invertebrate sequence entries, part 726.
4737. gbinv727.seq - Invertebrate sequence entries, part 727.
4738. gbinv728.seq - Invertebrate sequence entries, part 728.
4739. gbinv729.seq - Invertebrate sequence entries, part 729.
4740. gbinv73.seq - Invertebrate sequence entries, part 73.
4741. gbinv730.seq - Invertebrate sequence entries, part 730.
4742. gbinv731.seq - Invertebrate sequence entries, part 731.
4743. gbinv732.seq - Invertebrate sequence entries, part 732.
4744. gbinv733.seq - Invertebrate sequence entries, part 733.
4745. gbinv734.seq - Invertebrate sequence entries, part 734.
4746. gbinv735.seq - Invertebrate sequence entries, part 735.
4747. gbinv736.seq - Invertebrate sequence entries, part 736.
4748. gbinv737.seq - Invertebrate sequence entries, part 737.
4749. gbinv738.seq - Invertebrate sequence entries, part 738.
4750. gbinv739.seq - Invertebrate sequence entries, part 739.
4751. gbinv74.seq - Invertebrate sequence entries, part 74.
4752. gbinv740.seq - Invertebrate sequence entries, part 740.
4753. gbinv741.seq - Invertebrate sequence entries, part 741.
4754. gbinv742.seq - Invertebrate sequence entries, part 742.
4755. gbinv743.seq - Invertebrate sequence entries, part 743.
4756. gbinv744.seq - Invertebrate sequence entries, part 744.
4757. gbinv745.seq - Invertebrate sequence entries, part 745.
4758. gbinv746.seq - Invertebrate sequence entries, part 746.
4759. gbinv747.seq - Invertebrate sequence entries, part 747.
4760. gbinv748.seq - Invertebrate sequence entries, part 748.
4761. gbinv749.seq - Invertebrate sequence entries, part 749.
4762. gbinv75.seq - Invertebrate sequence entries, part 75.
4763. gbinv750.seq - Invertebrate sequence entries, part 750.
4764. gbinv751.seq - Invertebrate sequence entries, part 751.
4765. gbinv752.seq - Invertebrate sequence entries, part 752.
4766. gbinv753.seq - Invertebrate sequence entries, part 753.
4767. gbinv754.seq - Invertebrate sequence entries, part 754.
4768. gbinv755.seq - Invertebrate sequence entries, part 755.
4769. gbinv756.seq - Invertebrate sequence entries, part 756.
4770. gbinv757.seq - Invertebrate sequence entries, part 757.
4771. gbinv758.seq - Invertebrate sequence entries, part 758.
4772. gbinv759.seq - Invertebrate sequence entries, part 759.
4773. gbinv76.seq - Invertebrate sequence entries, part 76.
4774. gbinv760.seq - Invertebrate sequence entries, part 760.
4775. gbinv761.seq - Invertebrate sequence entries, part 761.
4776. gbinv762.seq - Invertebrate sequence entries, part 762.
4777. gbinv763.seq - Invertebrate sequence entries, part 763.
4778. gbinv764.seq - Invertebrate sequence entries, part 764.
4779. gbinv765.seq - Invertebrate sequence entries, part 765.
4780. gbinv766.seq - Invertebrate sequence entries, part 766.
4781. gbinv767.seq - Invertebrate sequence entries, part 767.
4782. gbinv768.seq - Invertebrate sequence entries, part 768.
4783. gbinv769.seq - Invertebrate sequence entries, part 769.
4784. gbinv77.seq - Invertebrate sequence entries, part 77.
4785. gbinv770.seq - Invertebrate sequence entries, part 770.
4786. gbinv771.seq - Invertebrate sequence entries, part 771.
4787. gbinv772.seq - Invertebrate sequence entries, part 772.
4788. gbinv773.seq - Invertebrate sequence entries, part 773.
4789. gbinv774.seq - Invertebrate sequence entries, part 774.
4790. gbinv775.seq - Invertebrate sequence entries, part 775.
4791. gbinv776.seq - Invertebrate sequence entries, part 776.
4792. gbinv777.seq - Invertebrate sequence entries, part 777.
4793. gbinv778.seq - Invertebrate sequence entries, part 778.
4794. gbinv779.seq - Invertebrate sequence entries, part 779.
4795. gbinv78.seq - Invertebrate sequence entries, part 78.
4796. gbinv780.seq - Invertebrate sequence entries, part 780.
4797. gbinv781.seq - Invertebrate sequence entries, part 781.
4798. gbinv782.seq - Invertebrate sequence entries, part 782.
4799. gbinv783.seq - Invertebrate sequence entries, part 783.
4800. gbinv784.seq - Invertebrate sequence entries, part 784.
4801. gbinv785.seq - Invertebrate sequence entries, part 785.
4802. gbinv786.seq - Invertebrate sequence entries, part 786.
4803. gbinv787.seq - Invertebrate sequence entries, part 787.
4804. gbinv788.seq - Invertebrate sequence entries, part 788.
4805. gbinv789.seq - Invertebrate sequence entries, part 789.
4806. gbinv79.seq - Invertebrate sequence entries, part 79.
4807. gbinv790.seq - Invertebrate sequence entries, part 790.
4808. gbinv791.seq - Invertebrate sequence entries, part 791.
4809. gbinv792.seq - Invertebrate sequence entries, part 792.
4810. gbinv793.seq - Invertebrate sequence entries, part 793.
4811. gbinv794.seq - Invertebrate sequence entries, part 794.
4812. gbinv795.seq - Invertebrate sequence entries, part 795.
4813. gbinv796.seq - Invertebrate sequence entries, part 796.
4814. gbinv797.seq - Invertebrate sequence entries, part 797.
4815. gbinv798.seq - Invertebrate sequence entries, part 798.
4816. gbinv799.seq - Invertebrate sequence entries, part 799.
4817. gbinv8.seq - Invertebrate sequence entries, part 8.
4818. gbinv80.seq - Invertebrate sequence entries, part 80.
4819. gbinv800.seq - Invertebrate sequence entries, part 800.
4820. gbinv801.seq - Invertebrate sequence entries, part 801.
4821. gbinv802.seq - Invertebrate sequence entries, part 802.
4822. gbinv803.seq - Invertebrate sequence entries, part 803.
4823. gbinv804.seq - Invertebrate sequence entries, part 804.
4824. gbinv805.seq - Invertebrate sequence entries, part 805.
4825. gbinv806.seq - Invertebrate sequence entries, part 806.
4826. gbinv807.seq - Invertebrate sequence entries, part 807.
4827. gbinv808.seq - Invertebrate sequence entries, part 808.
4828. gbinv809.seq - Invertebrate sequence entries, part 809.
4829. gbinv81.seq - Invertebrate sequence entries, part 81.
4830. gbinv810.seq - Invertebrate sequence entries, part 810.
4831. gbinv811.seq - Invertebrate sequence entries, part 811.
4832. gbinv812.seq - Invertebrate sequence entries, part 812.
4833. gbinv813.seq - Invertebrate sequence entries, part 813.
4834. gbinv814.seq - Invertebrate sequence entries, part 814.
4835. gbinv815.seq - Invertebrate sequence entries, part 815.
4836. gbinv816.seq - Invertebrate sequence entries, part 816.
4837. gbinv817.seq - Invertebrate sequence entries, part 817.
4838. gbinv818.seq - Invertebrate sequence entries, part 818.
4839. gbinv819.seq - Invertebrate sequence entries, part 819.
4840. gbinv82.seq - Invertebrate sequence entries, part 82.
4841. gbinv820.seq - Invertebrate sequence entries, part 820.
4842. gbinv821.seq - Invertebrate sequence entries, part 821.
4843. gbinv822.seq - Invertebrate sequence entries, part 822.
4844. gbinv823.seq - Invertebrate sequence entries, part 823.
4845. gbinv824.seq - Invertebrate sequence entries, part 824.
4846. gbinv825.seq - Invertebrate sequence entries, part 825.
4847. gbinv826.seq - Invertebrate sequence entries, part 826.
4848. gbinv827.seq - Invertebrate sequence entries, part 827.
4849. gbinv828.seq - Invertebrate sequence entries, part 828.
4850. gbinv829.seq - Invertebrate sequence entries, part 829.
4851. gbinv83.seq - Invertebrate sequence entries, part 83.
4852. gbinv830.seq - Invertebrate sequence entries, part 830.
4853. gbinv831.seq - Invertebrate sequence entries, part 831.
4854. gbinv832.seq - Invertebrate sequence entries, part 832.
4855. gbinv833.seq - Invertebrate sequence entries, part 833.
4856. gbinv834.seq - Invertebrate sequence entries, part 834.
4857. gbinv835.seq - Invertebrate sequence entries, part 835.
4858. gbinv836.seq - Invertebrate sequence entries, part 836.
4859. gbinv837.seq - Invertebrate sequence entries, part 837.
4860. gbinv838.seq - Invertebrate sequence entries, part 838.
4861. gbinv839.seq - Invertebrate sequence entries, part 839.
4862. gbinv84.seq - Invertebrate sequence entries, part 84.
4863. gbinv840.seq - Invertebrate sequence entries, part 840.
4864. gbinv841.seq - Invertebrate sequence entries, part 841.
4865. gbinv842.seq - Invertebrate sequence entries, part 842.
4866. gbinv843.seq - Invertebrate sequence entries, part 843.
4867. gbinv844.seq - Invertebrate sequence entries, part 844.
4868. gbinv845.seq - Invertebrate sequence entries, part 845.
4869. gbinv846.seq - Invertebrate sequence entries, part 846.
4870. gbinv847.seq - Invertebrate sequence entries, part 847.
4871. gbinv848.seq - Invertebrate sequence entries, part 848.
4872. gbinv849.seq - Invertebrate sequence entries, part 849.
4873. gbinv85.seq - Invertebrate sequence entries, part 85.
4874. gbinv850.seq - Invertebrate sequence entries, part 850.
4875. gbinv851.seq - Invertebrate sequence entries, part 851.
4876. gbinv852.seq - Invertebrate sequence entries, part 852.
4877. gbinv853.seq - Invertebrate sequence entries, part 853.
4878. gbinv854.seq - Invertebrate sequence entries, part 854.
4879. gbinv855.seq - Invertebrate sequence entries, part 855.
4880. gbinv856.seq - Invertebrate sequence entries, part 856.
4881. gbinv857.seq - Invertebrate sequence entries, part 857.
4882. gbinv858.seq - Invertebrate sequence entries, part 858.
4883. gbinv859.seq - Invertebrate sequence entries, part 859.
4884. gbinv86.seq - Invertebrate sequence entries, part 86.
4885. gbinv860.seq - Invertebrate sequence entries, part 860.
4886. gbinv861.seq - Invertebrate sequence entries, part 861.
4887. gbinv862.seq - Invertebrate sequence entries, part 862.
4888. gbinv863.seq - Invertebrate sequence entries, part 863.
4889. gbinv864.seq - Invertebrate sequence entries, part 864.
4890. gbinv865.seq - Invertebrate sequence entries, part 865.
4891. gbinv866.seq - Invertebrate sequence entries, part 866.
4892. gbinv867.seq - Invertebrate sequence entries, part 867.
4893. gbinv868.seq - Invertebrate sequence entries, part 868.
4894. gbinv869.seq - Invertebrate sequence entries, part 869.
4895. gbinv87.seq - Invertebrate sequence entries, part 87.
4896. gbinv870.seq - Invertebrate sequence entries, part 870.
4897. gbinv871.seq - Invertebrate sequence entries, part 871.
4898. gbinv872.seq - Invertebrate sequence entries, part 872.
4899. gbinv873.seq - Invertebrate sequence entries, part 873.
4900. gbinv874.seq - Invertebrate sequence entries, part 874.
4901. gbinv875.seq - Invertebrate sequence entries, part 875.
4902. gbinv876.seq - Invertebrate sequence entries, part 876.
4903. gbinv877.seq - Invertebrate sequence entries, part 877.
4904. gbinv878.seq - Invertebrate sequence entries, part 878.
4905. gbinv879.seq - Invertebrate sequence entries, part 879.
4906. gbinv88.seq - Invertebrate sequence entries, part 88.
4907. gbinv880.seq - Invertebrate sequence entries, part 880.
4908. gbinv881.seq - Invertebrate sequence entries, part 881.
4909. gbinv882.seq - Invertebrate sequence entries, part 882.
4910. gbinv883.seq - Invertebrate sequence entries, part 883.
4911. gbinv884.seq - Invertebrate sequence entries, part 884.
4912. gbinv885.seq - Invertebrate sequence entries, part 885.
4913. gbinv886.seq - Invertebrate sequence entries, part 886.
4914. gbinv887.seq - Invertebrate sequence entries, part 887.
4915. gbinv888.seq - Invertebrate sequence entries, part 888.
4916. gbinv889.seq - Invertebrate sequence entries, part 889.
4917. gbinv89.seq - Invertebrate sequence entries, part 89.
4918. gbinv890.seq - Invertebrate sequence entries, part 890.
4919. gbinv891.seq - Invertebrate sequence entries, part 891.
4920. gbinv892.seq - Invertebrate sequence entries, part 892.
4921. gbinv893.seq - Invertebrate sequence entries, part 893.
4922. gbinv894.seq - Invertebrate sequence entries, part 894.
4923. gbinv895.seq - Invertebrate sequence entries, part 895.
4924. gbinv896.seq - Invertebrate sequence entries, part 896.
4925. gbinv897.seq - Invertebrate sequence entries, part 897.
4926. gbinv898.seq - Invertebrate sequence entries, part 898.
4927. gbinv899.seq - Invertebrate sequence entries, part 899.
4928. gbinv9.seq - Invertebrate sequence entries, part 9.
4929. gbinv90.seq - Invertebrate sequence entries, part 90.
4930. gbinv900.seq - Invertebrate sequence entries, part 900.
4931. gbinv901.seq - Invertebrate sequence entries, part 901.
4932. gbinv902.seq - Invertebrate sequence entries, part 902.
4933. gbinv903.seq - Invertebrate sequence entries, part 903.
4934. gbinv904.seq - Invertebrate sequence entries, part 904.
4935. gbinv905.seq - Invertebrate sequence entries, part 905.
4936. gbinv906.seq - Invertebrate sequence entries, part 906.
4937. gbinv907.seq - Invertebrate sequence entries, part 907.
4938. gbinv908.seq - Invertebrate sequence entries, part 908.
4939. gbinv909.seq - Invertebrate sequence entries, part 909.
4940. gbinv91.seq - Invertebrate sequence entries, part 91.
4941. gbinv910.seq - Invertebrate sequence entries, part 910.
4942. gbinv911.seq - Invertebrate sequence entries, part 911.
4943. gbinv912.seq - Invertebrate sequence entries, part 912.
4944. gbinv913.seq - Invertebrate sequence entries, part 913.
4945. gbinv914.seq - Invertebrate sequence entries, part 914.
4946. gbinv915.seq - Invertebrate sequence entries, part 915.
4947. gbinv916.seq - Invertebrate sequence entries, part 916.
4948. gbinv917.seq - Invertebrate sequence entries, part 917.
4949. gbinv918.seq - Invertebrate sequence entries, part 918.
4950. gbinv919.seq - Invertebrate sequence entries, part 919.
4951. gbinv92.seq - Invertebrate sequence entries, part 92.
4952. gbinv920.seq - Invertebrate sequence entries, part 920.
4953. gbinv921.seq - Invertebrate sequence entries, part 921.
4954. gbinv922.seq - Invertebrate sequence entries, part 922.
4955. gbinv923.seq - Invertebrate sequence entries, part 923.
4956. gbinv924.seq - Invertebrate sequence entries, part 924.
4957. gbinv925.seq - Invertebrate sequence entries, part 925.
4958. gbinv926.seq - Invertebrate sequence entries, part 926.
4959. gbinv927.seq - Invertebrate sequence entries, part 927.
4960. gbinv928.seq - Invertebrate sequence entries, part 928.
4961. gbinv929.seq - Invertebrate sequence entries, part 929.
4962. gbinv93.seq - Invertebrate sequence entries, part 93.
4963. gbinv930.seq - Invertebrate sequence entries, part 930.
4964. gbinv931.seq - Invertebrate sequence entries, part 931.
4965. gbinv932.seq - Invertebrate sequence entries, part 932.
4966. gbinv933.seq - Invertebrate sequence entries, part 933.
4967. gbinv934.seq - Invertebrate sequence entries, part 934.
4968. gbinv935.seq - Invertebrate sequence entries, part 935.
4969. gbinv936.seq - Invertebrate sequence entries, part 936.
4970. gbinv937.seq - Invertebrate sequence entries, part 937.
4971. gbinv938.seq - Invertebrate sequence entries, part 938.
4972. gbinv939.seq - Invertebrate sequence entries, part 939.
4973. gbinv94.seq - Invertebrate sequence entries, part 94.
4974. gbinv940.seq - Invertebrate sequence entries, part 940.
4975. gbinv941.seq - Invertebrate sequence entries, part 941.
4976. gbinv942.seq - Invertebrate sequence entries, part 942.
4977. gbinv943.seq - Invertebrate sequence entries, part 943.
4978. gbinv944.seq - Invertebrate sequence entries, part 944.
4979. gbinv945.seq - Invertebrate sequence entries, part 945.
4980. gbinv946.seq - Invertebrate sequence entries, part 946.
4981. gbinv947.seq - Invertebrate sequence entries, part 947.
4982. gbinv948.seq - Invertebrate sequence entries, part 948.
4983. gbinv949.seq - Invertebrate sequence entries, part 949.
4984. gbinv95.seq - Invertebrate sequence entries, part 95.
4985. gbinv950.seq - Invertebrate sequence entries, part 950.
4986. gbinv951.seq - Invertebrate sequence entries, part 951.
4987. gbinv952.seq - Invertebrate sequence entries, part 952.
4988. gbinv953.seq - Invertebrate sequence entries, part 953.
4989. gbinv954.seq - Invertebrate sequence entries, part 954.
4990. gbinv955.seq - Invertebrate sequence entries, part 955.
4991. gbinv956.seq - Invertebrate sequence entries, part 956.
4992. gbinv957.seq - Invertebrate sequence entries, part 957.
4993. gbinv958.seq - Invertebrate sequence entries, part 958.
4994. gbinv959.seq - Invertebrate sequence entries, part 959.
4995. gbinv96.seq - Invertebrate sequence entries, part 96.
4996. gbinv960.seq - Invertebrate sequence entries, part 960.
4997. gbinv961.seq - Invertebrate sequence entries, part 961.
4998. gbinv962.seq - Invertebrate sequence entries, part 962.
4999. gbinv963.seq - Invertebrate sequence entries, part 963.
5000. gbinv964.seq - Invertebrate sequence entries, part 964.
5001. gbinv965.seq - Invertebrate sequence entries, part 965.
5002. gbinv966.seq - Invertebrate sequence entries, part 966.
5003. gbinv967.seq - Invertebrate sequence entries, part 967.
5004. gbinv968.seq - Invertebrate sequence entries, part 968.
5005. gbinv969.seq - Invertebrate sequence entries, part 969.
5006. gbinv97.seq - Invertebrate sequence entries, part 97.
5007. gbinv970.seq - Invertebrate sequence entries, part 970.
5008. gbinv971.seq - Invertebrate sequence entries, part 971.
5009. gbinv972.seq - Invertebrate sequence entries, part 972.
5010. gbinv973.seq - Invertebrate sequence entries, part 973.
5011. gbinv974.seq - Invertebrate sequence entries, part 974.
5012. gbinv975.seq - Invertebrate sequence entries, part 975.
5013. gbinv976.seq - Invertebrate sequence entries, part 976.
5014. gbinv977.seq - Invertebrate sequence entries, part 977.
5015. gbinv978.seq - Invertebrate sequence entries, part 978.
5016. gbinv979.seq - Invertebrate sequence entries, part 979.
5017. gbinv98.seq - Invertebrate sequence entries, part 98.
5018. gbinv980.seq - Invertebrate sequence entries, part 980.
5019. gbinv981.seq - Invertebrate sequence entries, part 981.
5020. gbinv982.seq - Invertebrate sequence entries, part 982.
5021. gbinv983.seq - Invertebrate sequence entries, part 983.
5022. gbinv984.seq - Invertebrate sequence entries, part 984.
5023. gbinv985.seq - Invertebrate sequence entries, part 985.
5024. gbinv986.seq - Invertebrate sequence entries, part 986.
5025. gbinv987.seq - Invertebrate sequence entries, part 987.
5026. gbinv988.seq - Invertebrate sequence entries, part 988.
5027. gbinv989.seq - Invertebrate sequence entries, part 989.
5028. gbinv99.seq - Invertebrate sequence entries, part 99.
5029. gbinv990.seq - Invertebrate sequence entries, part 990.
5030. gbinv991.seq - Invertebrate sequence entries, part 991.
5031. gbinv992.seq - Invertebrate sequence entries, part 992.
5032. gbinv993.seq - Invertebrate sequence entries, part 993.
5033. gbinv994.seq - Invertebrate sequence entries, part 994.
5034. gbinv995.seq - Invertebrate sequence entries, part 995.
5035. gbinv996.seq - Invertebrate sequence entries, part 996.
5036. gbinv997.seq - Invertebrate sequence entries, part 997.
5037. gbinv998.seq - Invertebrate sequence entries, part 998.
5038. gbinv999.seq - Invertebrate sequence entries, part 999.
5039. gbmam1.seq - Other mammalian sequence entries, part 1.
5040. gbmam10.seq - Other mammalian sequence entries, part 10.
5041. gbmam100.seq - Other mammalian sequence entries, part 100.
5042. gbmam101.seq - Other mammalian sequence entries, part 101.
5043. gbmam102.seq - Other mammalian sequence entries, part 102.
5044. gbmam103.seq - Other mammalian sequence entries, part 103.
5045. gbmam104.seq - Other mammalian sequence entries, part 104.
5046. gbmam105.seq - Other mammalian sequence entries, part 105.
5047. gbmam106.seq - Other mammalian sequence entries, part 106.
5048. gbmam107.seq - Other mammalian sequence entries, part 107.
5049. gbmam108.seq - Other mammalian sequence entries, part 108.
5050. gbmam109.seq - Other mammalian sequence entries, part 109.
5051. gbmam11.seq - Other mammalian sequence entries, part 11.
5052. gbmam110.seq - Other mammalian sequence entries, part 110.
5053. gbmam111.seq - Other mammalian sequence entries, part 111.
5054. gbmam112.seq - Other mammalian sequence entries, part 112.
5055. gbmam113.seq - Other mammalian sequence entries, part 113.
5056. gbmam114.seq - Other mammalian sequence entries, part 114.
5057. gbmam115.seq - Other mammalian sequence entries, part 115.
5058. gbmam116.seq - Other mammalian sequence entries, part 116.
5059. gbmam117.seq - Other mammalian sequence entries, part 117.
5060. gbmam118.seq - Other mammalian sequence entries, part 118.
5061. gbmam119.seq - Other mammalian sequence entries, part 119.
5062. gbmam12.seq - Other mammalian sequence entries, part 12.
5063. gbmam120.seq - Other mammalian sequence entries, part 120.
5064. gbmam121.seq - Other mammalian sequence entries, part 121.
5065. gbmam122.seq - Other mammalian sequence entries, part 122.
5066. gbmam123.seq - Other mammalian sequence entries, part 123.
5067. gbmam124.seq - Other mammalian sequence entries, part 124.
5068. gbmam125.seq - Other mammalian sequence entries, part 125.
5069. gbmam126.seq - Other mammalian sequence entries, part 126.
5070. gbmam127.seq - Other mammalian sequence entries, part 127.
5071. gbmam128.seq - Other mammalian sequence entries, part 128.
5072. gbmam129.seq - Other mammalian sequence entries, part 129.
5073. gbmam13.seq - Other mammalian sequence entries, part 13.
5074. gbmam130.seq - Other mammalian sequence entries, part 130.
5075. gbmam131.seq - Other mammalian sequence entries, part 131.
5076. gbmam132.seq - Other mammalian sequence entries, part 132.
5077. gbmam133.seq - Other mammalian sequence entries, part 133.
5078. gbmam134.seq - Other mammalian sequence entries, part 134.
5079. gbmam135.seq - Other mammalian sequence entries, part 135.
5080. gbmam136.seq - Other mammalian sequence entries, part 136.
5081. gbmam137.seq - Other mammalian sequence entries, part 137.
5082. gbmam138.seq - Other mammalian sequence entries, part 138.
5083. gbmam139.seq - Other mammalian sequence entries, part 139.
5084. gbmam14.seq - Other mammalian sequence entries, part 14.
5085. gbmam140.seq - Other mammalian sequence entries, part 140.
5086. gbmam141.seq - Other mammalian sequence entries, part 141.
5087. gbmam142.seq - Other mammalian sequence entries, part 142.
5088. gbmam143.seq - Other mammalian sequence entries, part 143.
5089. gbmam144.seq - Other mammalian sequence entries, part 144.
5090. gbmam145.seq - Other mammalian sequence entries, part 145.
5091. gbmam146.seq - Other mammalian sequence entries, part 146.
5092. gbmam147.seq - Other mammalian sequence entries, part 147.
5093. gbmam148.seq - Other mammalian sequence entries, part 148.
5094. gbmam149.seq - Other mammalian sequence entries, part 149.
5095. gbmam15.seq - Other mammalian sequence entries, part 15.
5096. gbmam150.seq - Other mammalian sequence entries, part 150.
5097. gbmam151.seq - Other mammalian sequence entries, part 151.
5098. gbmam152.seq - Other mammalian sequence entries, part 152.
5099. gbmam153.seq - Other mammalian sequence entries, part 153.
5100. gbmam154.seq - Other mammalian sequence entries, part 154.
5101. gbmam155.seq - Other mammalian sequence entries, part 155.
5102. gbmam156.seq - Other mammalian sequence entries, part 156.
5103. gbmam157.seq - Other mammalian sequence entries, part 157.
5104. gbmam158.seq - Other mammalian sequence entries, part 158.
5105. gbmam159.seq - Other mammalian sequence entries, part 159.
5106. gbmam16.seq - Other mammalian sequence entries, part 16.
5107. gbmam160.seq - Other mammalian sequence entries, part 160.
5108. gbmam161.seq - Other mammalian sequence entries, part 161.
5109. gbmam162.seq - Other mammalian sequence entries, part 162.
5110. gbmam163.seq - Other mammalian sequence entries, part 163.
5111. gbmam164.seq - Other mammalian sequence entries, part 164.
5112. gbmam165.seq - Other mammalian sequence entries, part 165.
5113. gbmam166.seq - Other mammalian sequence entries, part 166.
5114. gbmam167.seq - Other mammalian sequence entries, part 167.
5115. gbmam168.seq - Other mammalian sequence entries, part 168.
5116. gbmam169.seq - Other mammalian sequence entries, part 169.
5117. gbmam17.seq - Other mammalian sequence entries, part 17.
5118. gbmam170.seq - Other mammalian sequence entries, part 170.
5119. gbmam171.seq - Other mammalian sequence entries, part 171.
5120. gbmam172.seq - Other mammalian sequence entries, part 172.
5121. gbmam173.seq - Other mammalian sequence entries, part 173.
5122. gbmam174.seq - Other mammalian sequence entries, part 174.
5123. gbmam175.seq - Other mammalian sequence entries, part 175.
5124. gbmam176.seq - Other mammalian sequence entries, part 176.
5125. gbmam177.seq - Other mammalian sequence entries, part 177.
5126. gbmam178.seq - Other mammalian sequence entries, part 178.
5127. gbmam179.seq - Other mammalian sequence entries, part 179.
5128. gbmam18.seq - Other mammalian sequence entries, part 18.
5129. gbmam180.seq - Other mammalian sequence entries, part 180.
5130. gbmam181.seq - Other mammalian sequence entries, part 181.
5131. gbmam182.seq - Other mammalian sequence entries, part 182.
5132. gbmam183.seq - Other mammalian sequence entries, part 183.
5133. gbmam184.seq - Other mammalian sequence entries, part 184.
5134. gbmam185.seq - Other mammalian sequence entries, part 185.
5135. gbmam186.seq - Other mammalian sequence entries, part 186.
5136. gbmam187.seq - Other mammalian sequence entries, part 187.
5137. gbmam188.seq - Other mammalian sequence entries, part 188.
5138. gbmam189.seq - Other mammalian sequence entries, part 189.
5139. gbmam19.seq - Other mammalian sequence entries, part 19.
5140. gbmam190.seq - Other mammalian sequence entries, part 190.
5141. gbmam191.seq - Other mammalian sequence entries, part 191.
5142. gbmam192.seq - Other mammalian sequence entries, part 192.
5143. gbmam193.seq - Other mammalian sequence entries, part 193.
5144. gbmam194.seq - Other mammalian sequence entries, part 194.
5145. gbmam195.seq - Other mammalian sequence entries, part 195.
5146. gbmam196.seq - Other mammalian sequence entries, part 196.
5147. gbmam197.seq - Other mammalian sequence entries, part 197.
5148. gbmam198.seq - Other mammalian sequence entries, part 198.
5149. gbmam199.seq - Other mammalian sequence entries, part 199.
5150. gbmam2.seq - Other mammalian sequence entries, part 2.
5151. gbmam20.seq - Other mammalian sequence entries, part 20.
5152. gbmam200.seq - Other mammalian sequence entries, part 200.
5153. gbmam201.seq - Other mammalian sequence entries, part 201.
5154. gbmam202.seq - Other mammalian sequence entries, part 202.
5155. gbmam203.seq - Other mammalian sequence entries, part 203.
5156. gbmam204.seq - Other mammalian sequence entries, part 204.
5157. gbmam205.seq - Other mammalian sequence entries, part 205.
5158. gbmam206.seq - Other mammalian sequence entries, part 206.
5159. gbmam207.seq - Other mammalian sequence entries, part 207.
5160. gbmam208.seq - Other mammalian sequence entries, part 208.
5161. gbmam209.seq - Other mammalian sequence entries, part 209.
5162. gbmam21.seq - Other mammalian sequence entries, part 21.
5163. gbmam210.seq - Other mammalian sequence entries, part 210.
5164. gbmam211.seq - Other mammalian sequence entries, part 211.
5165. gbmam212.seq - Other mammalian sequence entries, part 212.
5166. gbmam213.seq - Other mammalian sequence entries, part 213.
5167. gbmam214.seq - Other mammalian sequence entries, part 214.
5168. gbmam215.seq - Other mammalian sequence entries, part 215.
5169. gbmam216.seq - Other mammalian sequence entries, part 216.
5170. gbmam217.seq - Other mammalian sequence entries, part 217.
5171. gbmam218.seq - Other mammalian sequence entries, part 218.
5172. gbmam219.seq - Other mammalian sequence entries, part 219.
5173. gbmam22.seq - Other mammalian sequence entries, part 22.
5174. gbmam220.seq - Other mammalian sequence entries, part 220.
5175. gbmam221.seq - Other mammalian sequence entries, part 221.
5176. gbmam222.seq - Other mammalian sequence entries, part 222.
5177. gbmam223.seq - Other mammalian sequence entries, part 223.
5178. gbmam224.seq - Other mammalian sequence entries, part 224.
5179. gbmam225.seq - Other mammalian sequence entries, part 225.
5180. gbmam226.seq - Other mammalian sequence entries, part 226.
5181. gbmam227.seq - Other mammalian sequence entries, part 227.
5182. gbmam228.seq - Other mammalian sequence entries, part 228.
5183. gbmam229.seq - Other mammalian sequence entries, part 229.
5184. gbmam23.seq - Other mammalian sequence entries, part 23.
5185. gbmam230.seq - Other mammalian sequence entries, part 230.
5186. gbmam231.seq - Other mammalian sequence entries, part 231.
5187. gbmam232.seq - Other mammalian sequence entries, part 232.
5188. gbmam233.seq - Other mammalian sequence entries, part 233.
5189. gbmam234.seq - Other mammalian sequence entries, part 234.
5190. gbmam235.seq - Other mammalian sequence entries, part 235.
5191. gbmam236.seq - Other mammalian sequence entries, part 236.
5192. gbmam237.seq - Other mammalian sequence entries, part 237.
5193. gbmam238.seq - Other mammalian sequence entries, part 238.
5194. gbmam239.seq - Other mammalian sequence entries, part 239.
5195. gbmam24.seq - Other mammalian sequence entries, part 24.
5196. gbmam240.seq - Other mammalian sequence entries, part 240.
5197. gbmam241.seq - Other mammalian sequence entries, part 241.
5198. gbmam242.seq - Other mammalian sequence entries, part 242.
5199. gbmam243.seq - Other mammalian sequence entries, part 243.
5200. gbmam244.seq - Other mammalian sequence entries, part 244.
5201. gbmam245.seq - Other mammalian sequence entries, part 245.
5202. gbmam246.seq - Other mammalian sequence entries, part 246.
5203. gbmam247.seq - Other mammalian sequence entries, part 247.
5204. gbmam248.seq - Other mammalian sequence entries, part 248.
5205. gbmam249.seq - Other mammalian sequence entries, part 249.
5206. gbmam25.seq - Other mammalian sequence entries, part 25.
5207. gbmam250.seq - Other mammalian sequence entries, part 250.
5208. gbmam251.seq - Other mammalian sequence entries, part 251.
5209. gbmam252.seq - Other mammalian sequence entries, part 252.
5210. gbmam253.seq - Other mammalian sequence entries, part 253.
5211. gbmam254.seq - Other mammalian sequence entries, part 254.
5212. gbmam255.seq - Other mammalian sequence entries, part 255.
5213. gbmam256.seq - Other mammalian sequence entries, part 256.
5214. gbmam257.seq - Other mammalian sequence entries, part 257.
5215. gbmam258.seq - Other mammalian sequence entries, part 258.
5216. gbmam259.seq - Other mammalian sequence entries, part 259.
5217. gbmam26.seq - Other mammalian sequence entries, part 26.
5218. gbmam260.seq - Other mammalian sequence entries, part 260.
5219. gbmam261.seq - Other mammalian sequence entries, part 261.
5220. gbmam262.seq - Other mammalian sequence entries, part 262.
5221. gbmam263.seq - Other mammalian sequence entries, part 263.
5222. gbmam264.seq - Other mammalian sequence entries, part 264.
5223. gbmam265.seq - Other mammalian sequence entries, part 265.
5224. gbmam266.seq - Other mammalian sequence entries, part 266.
5225. gbmam267.seq - Other mammalian sequence entries, part 267.
5226. gbmam268.seq - Other mammalian sequence entries, part 268.
5227. gbmam269.seq - Other mammalian sequence entries, part 269.
5228. gbmam27.seq - Other mammalian sequence entries, part 27.
5229. gbmam270.seq - Other mammalian sequence entries, part 270.
5230. gbmam271.seq - Other mammalian sequence entries, part 271.
5231. gbmam272.seq - Other mammalian sequence entries, part 272.
5232. gbmam273.seq - Other mammalian sequence entries, part 273.
5233. gbmam274.seq - Other mammalian sequence entries, part 274.
5234. gbmam275.seq - Other mammalian sequence entries, part 275.
5235. gbmam276.seq - Other mammalian sequence entries, part 276.
5236. gbmam277.seq - Other mammalian sequence entries, part 277.
5237. gbmam278.seq - Other mammalian sequence entries, part 278.
5238. gbmam279.seq - Other mammalian sequence entries, part 279.
5239. gbmam28.seq - Other mammalian sequence entries, part 28.
5240. gbmam280.seq - Other mammalian sequence entries, part 280.
5241. gbmam281.seq - Other mammalian sequence entries, part 281.
5242. gbmam282.seq - Other mammalian sequence entries, part 282.
5243. gbmam283.seq - Other mammalian sequence entries, part 283.
5244. gbmam284.seq - Other mammalian sequence entries, part 284.
5245. gbmam285.seq - Other mammalian sequence entries, part 285.
5246. gbmam286.seq - Other mammalian sequence entries, part 286.
5247. gbmam287.seq - Other mammalian sequence entries, part 287.
5248. gbmam288.seq - Other mammalian sequence entries, part 288.
5249. gbmam289.seq - Other mammalian sequence entries, part 289.
5250. gbmam29.seq - Other mammalian sequence entries, part 29.
5251. gbmam290.seq - Other mammalian sequence entries, part 290.
5252. gbmam291.seq - Other mammalian sequence entries, part 291.
5253. gbmam292.seq - Other mammalian sequence entries, part 292.
5254. gbmam293.seq - Other mammalian sequence entries, part 293.
5255. gbmam294.seq - Other mammalian sequence entries, part 294.
5256. gbmam295.seq - Other mammalian sequence entries, part 295.
5257. gbmam296.seq - Other mammalian sequence entries, part 296.
5258. gbmam297.seq - Other mammalian sequence entries, part 297.
5259. gbmam298.seq - Other mammalian sequence entries, part 298.
5260. gbmam299.seq - Other mammalian sequence entries, part 299.
5261. gbmam3.seq - Other mammalian sequence entries, part 3.
5262. gbmam30.seq - Other mammalian sequence entries, part 30.
5263. gbmam300.seq - Other mammalian sequence entries, part 300.
5264. gbmam301.seq - Other mammalian sequence entries, part 301.
5265. gbmam302.seq - Other mammalian sequence entries, part 302.
5266. gbmam303.seq - Other mammalian sequence entries, part 303.
5267. gbmam304.seq - Other mammalian sequence entries, part 304.
5268. gbmam305.seq - Other mammalian sequence entries, part 305.
5269. gbmam306.seq - Other mammalian sequence entries, part 306.
5270. gbmam307.seq - Other mammalian sequence entries, part 307.
5271. gbmam308.seq - Other mammalian sequence entries, part 308.
5272. gbmam309.seq - Other mammalian sequence entries, part 309.
5273. gbmam31.seq - Other mammalian sequence entries, part 31.
5274. gbmam310.seq - Other mammalian sequence entries, part 310.
5275. gbmam311.seq - Other mammalian sequence entries, part 311.
5276. gbmam312.seq - Other mammalian sequence entries, part 312.
5277. gbmam313.seq - Other mammalian sequence entries, part 313.
5278. gbmam314.seq - Other mammalian sequence entries, part 314.
5279. gbmam315.seq - Other mammalian sequence entries, part 315.
5280. gbmam316.seq - Other mammalian sequence entries, part 316.
5281. gbmam317.seq - Other mammalian sequence entries, part 317.
5282. gbmam318.seq - Other mammalian sequence entries, part 318.
5283. gbmam319.seq - Other mammalian sequence entries, part 319.
5284. gbmam32.seq - Other mammalian sequence entries, part 32.
5285. gbmam320.seq - Other mammalian sequence entries, part 320.
5286. gbmam321.seq - Other mammalian sequence entries, part 321.
5287. gbmam322.seq - Other mammalian sequence entries, part 322.
5288. gbmam323.seq - Other mammalian sequence entries, part 323.
5289. gbmam324.seq - Other mammalian sequence entries, part 324.
5290. gbmam325.seq - Other mammalian sequence entries, part 325.
5291. gbmam326.seq - Other mammalian sequence entries, part 326.
5292. gbmam327.seq - Other mammalian sequence entries, part 327.
5293. gbmam328.seq - Other mammalian sequence entries, part 328.
5294. gbmam329.seq - Other mammalian sequence entries, part 329.
5295. gbmam33.seq - Other mammalian sequence entries, part 33.
5296. gbmam330.seq - Other mammalian sequence entries, part 330.
5297. gbmam331.seq - Other mammalian sequence entries, part 331.
5298. gbmam332.seq - Other mammalian sequence entries, part 332.
5299. gbmam333.seq - Other mammalian sequence entries, part 333.
5300. gbmam334.seq - Other mammalian sequence entries, part 334.
5301. gbmam335.seq - Other mammalian sequence entries, part 335.
5302. gbmam336.seq - Other mammalian sequence entries, part 336.
5303. gbmam337.seq - Other mammalian sequence entries, part 337.
5304. gbmam338.seq - Other mammalian sequence entries, part 338.
5305. gbmam339.seq - Other mammalian sequence entries, part 339.
5306. gbmam34.seq - Other mammalian sequence entries, part 34.
5307. gbmam340.seq - Other mammalian sequence entries, part 340.
5308. gbmam341.seq - Other mammalian sequence entries, part 341.
5309. gbmam342.seq - Other mammalian sequence entries, part 342.
5310. gbmam343.seq - Other mammalian sequence entries, part 343.
5311. gbmam344.seq - Other mammalian sequence entries, part 344.
5312. gbmam345.seq - Other mammalian sequence entries, part 345.
5313. gbmam346.seq - Other mammalian sequence entries, part 346.
5314. gbmam347.seq - Other mammalian sequence entries, part 347.
5315. gbmam348.seq - Other mammalian sequence entries, part 348.
5316. gbmam349.seq - Other mammalian sequence entries, part 349.
5317. gbmam35.seq - Other mammalian sequence entries, part 35.
5318. gbmam36.seq - Other mammalian sequence entries, part 36.
5319. gbmam37.seq - Other mammalian sequence entries, part 37.
5320. gbmam38.seq - Other mammalian sequence entries, part 38.
5321. gbmam39.seq - Other mammalian sequence entries, part 39.
5322. gbmam4.seq - Other mammalian sequence entries, part 4.
5323. gbmam40.seq - Other mammalian sequence entries, part 40.
5324. gbmam41.seq - Other mammalian sequence entries, part 41.
5325. gbmam42.seq - Other mammalian sequence entries, part 42.
5326. gbmam43.seq - Other mammalian sequence entries, part 43.
5327. gbmam44.seq - Other mammalian sequence entries, part 44.
5328. gbmam45.seq - Other mammalian sequence entries, part 45.
5329. gbmam46.seq - Other mammalian sequence entries, part 46.
5330. gbmam47.seq - Other mammalian sequence entries, part 47.
5331. gbmam48.seq - Other mammalian sequence entries, part 48.
5332. gbmam49.seq - Other mammalian sequence entries, part 49.
5333. gbmam5.seq - Other mammalian sequence entries, part 5.
5334. gbmam50.seq - Other mammalian sequence entries, part 50.
5335. gbmam51.seq - Other mammalian sequence entries, part 51.
5336. gbmam52.seq - Other mammalian sequence entries, part 52.
5337. gbmam53.seq - Other mammalian sequence entries, part 53.
5338. gbmam54.seq - Other mammalian sequence entries, part 54.
5339. gbmam55.seq - Other mammalian sequence entries, part 55.
5340. gbmam56.seq - Other mammalian sequence entries, part 56.
5341. gbmam57.seq - Other mammalian sequence entries, part 57.
5342. gbmam58.seq - Other mammalian sequence entries, part 58.
5343. gbmam59.seq - Other mammalian sequence entries, part 59.
5344. gbmam6.seq - Other mammalian sequence entries, part 6.
5345. gbmam60.seq - Other mammalian sequence entries, part 60.
5346. gbmam61.seq - Other mammalian sequence entries, part 61.
5347. gbmam62.seq - Other mammalian sequence entries, part 62.
5348. gbmam63.seq - Other mammalian sequence entries, part 63.
5349. gbmam64.seq - Other mammalian sequence entries, part 64.
5350. gbmam65.seq - Other mammalian sequence entries, part 65.
5351. gbmam66.seq - Other mammalian sequence entries, part 66.
5352. gbmam67.seq - Other mammalian sequence entries, part 67.
5353. gbmam68.seq - Other mammalian sequence entries, part 68.
5354. gbmam69.seq - Other mammalian sequence entries, part 69.
5355. gbmam7.seq - Other mammalian sequence entries, part 7.
5356. gbmam70.seq - Other mammalian sequence entries, part 70.
5357. gbmam71.seq - Other mammalian sequence entries, part 71.
5358. gbmam72.seq - Other mammalian sequence entries, part 72.
5359. gbmam73.seq - Other mammalian sequence entries, part 73.
5360. gbmam74.seq - Other mammalian sequence entries, part 74.
5361. gbmam75.seq - Other mammalian sequence entries, part 75.
5362. gbmam76.seq - Other mammalian sequence entries, part 76.
5363. gbmam77.seq - Other mammalian sequence entries, part 77.
5364. gbmam78.seq - Other mammalian sequence entries, part 78.
5365. gbmam79.seq - Other mammalian sequence entries, part 79.
5366. gbmam8.seq - Other mammalian sequence entries, part 8.
5367. gbmam80.seq - Other mammalian sequence entries, part 80.
5368. gbmam81.seq - Other mammalian sequence entries, part 81.
5369. gbmam82.seq - Other mammalian sequence entries, part 82.
5370. gbmam83.seq - Other mammalian sequence entries, part 83.
5371. gbmam84.seq - Other mammalian sequence entries, part 84.
5372. gbmam85.seq - Other mammalian sequence entries, part 85.
5373. gbmam86.seq - Other mammalian sequence entries, part 86.
5374. gbmam87.seq - Other mammalian sequence entries, part 87.
5375. gbmam88.seq - Other mammalian sequence entries, part 88.
5376. gbmam89.seq - Other mammalian sequence entries, part 89.
5377. gbmam9.seq - Other mammalian sequence entries, part 9.
5378. gbmam90.seq - Other mammalian sequence entries, part 90.
5379. gbmam91.seq - Other mammalian sequence entries, part 91.
5380. gbmam92.seq - Other mammalian sequence entries, part 92.
5381. gbmam93.seq - Other mammalian sequence entries, part 93.
5382. gbmam94.seq - Other mammalian sequence entries, part 94.
5383. gbmam95.seq - Other mammalian sequence entries, part 95.
5384. gbmam96.seq - Other mammalian sequence entries, part 96.
5385. gbmam97.seq - Other mammalian sequence entries, part 97.
5386. gbmam98.seq - Other mammalian sequence entries, part 98.
5387. gbmam99.seq - Other mammalian sequence entries, part 99.
5388. gbnew.txt - Accession numbers of entries new since the previous release.
5389. gbpat1.seq - Patent sequence entries, part 1.
5390. gbpat10.seq - Patent sequence entries, part 10.
5391. gbpat100.seq - Patent sequence entries, part 100.
5392. gbpat101.seq - Patent sequence entries, part 101.
5393. gbpat102.seq - Patent sequence entries, part 102.
5394. gbpat103.seq - Patent sequence entries, part 103.
5395. gbpat104.seq - Patent sequence entries, part 104.
5396. gbpat105.seq - Patent sequence entries, part 105.
5397. gbpat106.seq - Patent sequence entries, part 106.
5398. gbpat107.seq - Patent sequence entries, part 107.
5399. gbpat108.seq - Patent sequence entries, part 108.
5400. gbpat109.seq - Patent sequence entries, part 109.
5401. gbpat11.seq - Patent sequence entries, part 11.
5402. gbpat110.seq - Patent sequence entries, part 110.
5403. gbpat111.seq - Patent sequence entries, part 111.
5404. gbpat112.seq - Patent sequence entries, part 112.
5405. gbpat113.seq - Patent sequence entries, part 113.
5406. gbpat114.seq - Patent sequence entries, part 114.
5407. gbpat115.seq - Patent sequence entries, part 115.
5408. gbpat116.seq - Patent sequence entries, part 116.
5409. gbpat117.seq - Patent sequence entries, part 117.
5410. gbpat118.seq - Patent sequence entries, part 118.
5411. gbpat119.seq - Patent sequence entries, part 119.
5412. gbpat12.seq - Patent sequence entries, part 12.
5413. gbpat120.seq - Patent sequence entries, part 120.
5414. gbpat121.seq - Patent sequence entries, part 121.
5415. gbpat122.seq - Patent sequence entries, part 122.
5416. gbpat123.seq - Patent sequence entries, part 123.
5417. gbpat124.seq - Patent sequence entries, part 124.
5418. gbpat125.seq - Patent sequence entries, part 125.
5419. gbpat126.seq - Patent sequence entries, part 126.
5420. gbpat127.seq - Patent sequence entries, part 127.
5421. gbpat128.seq - Patent sequence entries, part 128.
5422. gbpat129.seq - Patent sequence entries, part 129.
5423. gbpat13.seq - Patent sequence entries, part 13.
5424. gbpat130.seq - Patent sequence entries, part 130.
5425. gbpat131.seq - Patent sequence entries, part 131.
5426. gbpat132.seq - Patent sequence entries, part 132.
5427. gbpat133.seq - Patent sequence entries, part 133.
5428. gbpat134.seq - Patent sequence entries, part 134.
5429. gbpat135.seq - Patent sequence entries, part 135.
5430. gbpat136.seq - Patent sequence entries, part 136.
5431. gbpat137.seq - Patent sequence entries, part 137.
5432. gbpat138.seq - Patent sequence entries, part 138.
5433. gbpat139.seq - Patent sequence entries, part 139.
5434. gbpat14.seq - Patent sequence entries, part 14.
5435. gbpat140.seq - Patent sequence entries, part 140.
5436. gbpat141.seq - Patent sequence entries, part 141.
5437. gbpat142.seq - Patent sequence entries, part 142.
5438. gbpat143.seq - Patent sequence entries, part 143.
5439. gbpat144.seq - Patent sequence entries, part 144.
5440. gbpat145.seq - Patent sequence entries, part 145.
5441. gbpat146.seq - Patent sequence entries, part 146.
5442. gbpat147.seq - Patent sequence entries, part 147.
5443. gbpat148.seq - Patent sequence entries, part 148.
5444. gbpat149.seq - Patent sequence entries, part 149.
5445. gbpat15.seq - Patent sequence entries, part 15.
5446. gbpat150.seq - Patent sequence entries, part 150.
5447. gbpat151.seq - Patent sequence entries, part 151.
5448. gbpat152.seq - Patent sequence entries, part 152.
5449. gbpat153.seq - Patent sequence entries, part 153.
5450. gbpat154.seq - Patent sequence entries, part 154.
5451. gbpat155.seq - Patent sequence entries, part 155.
5452. gbpat156.seq - Patent sequence entries, part 156.
5453. gbpat157.seq - Patent sequence entries, part 157.
5454. gbpat158.seq - Patent sequence entries, part 158.
5455. gbpat159.seq - Patent sequence entries, part 159.
5456. gbpat16.seq - Patent sequence entries, part 16.
5457. gbpat160.seq - Patent sequence entries, part 160.
5458. gbpat161.seq - Patent sequence entries, part 161.
5459. gbpat162.seq - Patent sequence entries, part 162.
5460. gbpat163.seq - Patent sequence entries, part 163.
5461. gbpat164.seq - Patent sequence entries, part 164.
5462. gbpat165.seq - Patent sequence entries, part 165.
5463. gbpat166.seq - Patent sequence entries, part 166.
5464. gbpat167.seq - Patent sequence entries, part 167.
5465. gbpat168.seq - Patent sequence entries, part 168.
5466. gbpat169.seq - Patent sequence entries, part 169.
5467. gbpat17.seq - Patent sequence entries, part 17.
5468. gbpat170.seq - Patent sequence entries, part 170.
5469. gbpat171.seq - Patent sequence entries, part 171.
5470. gbpat172.seq - Patent sequence entries, part 172.
5471. gbpat173.seq - Patent sequence entries, part 173.
5472. gbpat174.seq - Patent sequence entries, part 174.
5473. gbpat175.seq - Patent sequence entries, part 175.
5474. gbpat176.seq - Patent sequence entries, part 176.
5475. gbpat177.seq - Patent sequence entries, part 177.
5476. gbpat178.seq - Patent sequence entries, part 178.
5477. gbpat179.seq - Patent sequence entries, part 179.
5478. gbpat18.seq - Patent sequence entries, part 18.
5479. gbpat180.seq - Patent sequence entries, part 180.
5480. gbpat181.seq - Patent sequence entries, part 181.
5481. gbpat182.seq - Patent sequence entries, part 182.
5482. gbpat183.seq - Patent sequence entries, part 183.
5483. gbpat184.seq - Patent sequence entries, part 184.
5484. gbpat185.seq - Patent sequence entries, part 185.
5485. gbpat186.seq - Patent sequence entries, part 186.
5486. gbpat187.seq - Patent sequence entries, part 187.
5487. gbpat188.seq - Patent sequence entries, part 188.
5488. gbpat189.seq - Patent sequence entries, part 189.
5489. gbpat19.seq - Patent sequence entries, part 19.
5490. gbpat190.seq - Patent sequence entries, part 190.
5491. gbpat191.seq - Patent sequence entries, part 191.
5492. gbpat192.seq - Patent sequence entries, part 192.
5493. gbpat193.seq - Patent sequence entries, part 193.
5494. gbpat194.seq - Patent sequence entries, part 194.
5495. gbpat195.seq - Patent sequence entries, part 195.
5496. gbpat196.seq - Patent sequence entries, part 196.
5497. gbpat197.seq - Patent sequence entries, part 197.
5498. gbpat198.seq - Patent sequence entries, part 198.
5499. gbpat199.seq - Patent sequence entries, part 199.
5500. gbpat2.seq - Patent sequence entries, part 2.
5501. gbpat20.seq - Patent sequence entries, part 20.
5502. gbpat200.seq - Patent sequence entries, part 200.
5503. gbpat201.seq - Patent sequence entries, part 201.
5504. gbpat202.seq - Patent sequence entries, part 202.
5505. gbpat203.seq - Patent sequence entries, part 203.
5506. gbpat204.seq - Patent sequence entries, part 204.
5507. gbpat205.seq - Patent sequence entries, part 205.
5508. gbpat206.seq - Patent sequence entries, part 206.
5509. gbpat207.seq - Patent sequence entries, part 207.
5510. gbpat208.seq - Patent sequence entries, part 208.
5511. gbpat209.seq - Patent sequence entries, part 209.
5512. gbpat21.seq - Patent sequence entries, part 21.
5513. gbpat210.seq - Patent sequence entries, part 210.
5514. gbpat211.seq - Patent sequence entries, part 211.
5515. gbpat212.seq - Patent sequence entries, part 212.
5516. gbpat213.seq - Patent sequence entries, part 213.
5517. gbpat214.seq - Patent sequence entries, part 214.
5518. gbpat215.seq - Patent sequence entries, part 215.
5519. gbpat216.seq - Patent sequence entries, part 216.
5520. gbpat217.seq - Patent sequence entries, part 217.
5521. gbpat218.seq - Patent sequence entries, part 218.
5522. gbpat219.seq - Patent sequence entries, part 219.
5523. gbpat22.seq - Patent sequence entries, part 22.
5524. gbpat220.seq - Patent sequence entries, part 220.
5525. gbpat221.seq - Patent sequence entries, part 221.
5526. gbpat222.seq - Patent sequence entries, part 222.
5527. gbpat223.seq - Patent sequence entries, part 223.
5528. gbpat224.seq - Patent sequence entries, part 224.
5529. gbpat225.seq - Patent sequence entries, part 225.
5530. gbpat226.seq - Patent sequence entries, part 226.
5531. gbpat227.seq - Patent sequence entries, part 227.
5532. gbpat228.seq - Patent sequence entries, part 228.
5533. gbpat229.seq - Patent sequence entries, part 229.
5534. gbpat23.seq - Patent sequence entries, part 23.
5535. gbpat230.seq - Patent sequence entries, part 230.
5536. gbpat231.seq - Patent sequence entries, part 231.
5537. gbpat232.seq - Patent sequence entries, part 232.
5538. gbpat233.seq - Patent sequence entries, part 233.
5539. gbpat234.seq - Patent sequence entries, part 234.
5540. gbpat235.seq - Patent sequence entries, part 235.
5541. gbpat236.seq - Patent sequence entries, part 236.
5542. gbpat237.seq - Patent sequence entries, part 237.
5543. gbpat238.seq - Patent sequence entries, part 238.
5544. gbpat239.seq - Patent sequence entries, part 239.
5545. gbpat24.seq - Patent sequence entries, part 24.
5546. gbpat240.seq - Patent sequence entries, part 240.
5547. gbpat241.seq - Patent sequence entries, part 241.
5548. gbpat242.seq - Patent sequence entries, part 242.
5549. gbpat243.seq - Patent sequence entries, part 243.
5550. gbpat244.seq - Patent sequence entries, part 244.
5551. gbpat245.seq - Patent sequence entries, part 245.
5552. gbpat246.seq - Patent sequence entries, part 246.
5553. gbpat247.seq - Patent sequence entries, part 247.
5554. gbpat248.seq - Patent sequence entries, part 248.
5555. gbpat249.seq - Patent sequence entries, part 249.
5556. gbpat25.seq - Patent sequence entries, part 25.
5557. gbpat250.seq - Patent sequence entries, part 250.
5558. gbpat251.seq - Patent sequence entries, part 251.
5559. gbpat252.seq - Patent sequence entries, part 252.
5560. gbpat253.seq - Patent sequence entries, part 253.
5561. gbpat254.seq - Patent sequence entries, part 254.
5562. gbpat255.seq - Patent sequence entries, part 255.
5563. gbpat256.seq - Patent sequence entries, part 256.
5564. gbpat257.seq - Patent sequence entries, part 257.
5565. gbpat258.seq - Patent sequence entries, part 258.
5566. gbpat259.seq - Patent sequence entries, part 259.
5567. gbpat26.seq - Patent sequence entries, part 26.
5568. gbpat260.seq - Patent sequence entries, part 260.
5569. gbpat261.seq - Patent sequence entries, part 261.
5570. gbpat262.seq - Patent sequence entries, part 262.
5571. gbpat263.seq - Patent sequence entries, part 263.
5572. gbpat264.seq - Patent sequence entries, part 264.
5573. gbpat265.seq - Patent sequence entries, part 265.
5574. gbpat266.seq - Patent sequence entries, part 266.
5575. gbpat267.seq - Patent sequence entries, part 267.
5576. gbpat268.seq - Patent sequence entries, part 268.
5577. gbpat269.seq - Patent sequence entries, part 269.
5578. gbpat27.seq - Patent sequence entries, part 27.
5579. gbpat28.seq - Patent sequence entries, part 28.
5580. gbpat29.seq - Patent sequence entries, part 29.
5581. gbpat3.seq - Patent sequence entries, part 3.
5582. gbpat30.seq - Patent sequence entries, part 30.
5583. gbpat31.seq - Patent sequence entries, part 31.
5584. gbpat32.seq - Patent sequence entries, part 32.
5585. gbpat33.seq - Patent sequence entries, part 33.
5586. gbpat34.seq - Patent sequence entries, part 34.
5587. gbpat35.seq - Patent sequence entries, part 35.
5588. gbpat36.seq - Patent sequence entries, part 36.
5589. gbpat37.seq - Patent sequence entries, part 37.
5590. gbpat38.seq - Patent sequence entries, part 38.
5591. gbpat39.seq - Patent sequence entries, part 39.
5592. gbpat4.seq - Patent sequence entries, part 4.
5593. gbpat40.seq - Patent sequence entries, part 40.
5594. gbpat41.seq - Patent sequence entries, part 41.
5595. gbpat42.seq - Patent sequence entries, part 42.
5596. gbpat43.seq - Patent sequence entries, part 43.
5597. gbpat44.seq - Patent sequence entries, part 44.
5598. gbpat45.seq - Patent sequence entries, part 45.
5599. gbpat46.seq - Patent sequence entries, part 46.
5600. gbpat47.seq - Patent sequence entries, part 47.
5601. gbpat48.seq - Patent sequence entries, part 48.
5602. gbpat49.seq - Patent sequence entries, part 49.
5603. gbpat5.seq - Patent sequence entries, part 5.
5604. gbpat50.seq - Patent sequence entries, part 50.
5605. gbpat51.seq - Patent sequence entries, part 51.
5606. gbpat52.seq - Patent sequence entries, part 52.
5607. gbpat53.seq - Patent sequence entries, part 53.
5608. gbpat54.seq - Patent sequence entries, part 54.
5609. gbpat55.seq - Patent sequence entries, part 55.
5610. gbpat56.seq - Patent sequence entries, part 56.
5611. gbpat57.seq - Patent sequence entries, part 57.
5612. gbpat58.seq - Patent sequence entries, part 58.
5613. gbpat59.seq - Patent sequence entries, part 59.
5614. gbpat6.seq - Patent sequence entries, part 6.
5615. gbpat60.seq - Patent sequence entries, part 60.
5616. gbpat61.seq - Patent sequence entries, part 61.
5617. gbpat62.seq - Patent sequence entries, part 62.
5618. gbpat63.seq - Patent sequence entries, part 63.
5619. gbpat64.seq - Patent sequence entries, part 64.
5620. gbpat65.seq - Patent sequence entries, part 65.
5621. gbpat66.seq - Patent sequence entries, part 66.
5622. gbpat67.seq - Patent sequence entries, part 67.
5623. gbpat68.seq - Patent sequence entries, part 68.
5624. gbpat69.seq - Patent sequence entries, part 69.
5625. gbpat7.seq - Patent sequence entries, part 7.
5626. gbpat70.seq - Patent sequence entries, part 70.
5627. gbpat71.seq - Patent sequence entries, part 71.
5628. gbpat72.seq - Patent sequence entries, part 72.
5629. gbpat73.seq - Patent sequence entries, part 73.
5630. gbpat74.seq - Patent sequence entries, part 74.
5631. gbpat75.seq - Patent sequence entries, part 75.
5632. gbpat76.seq - Patent sequence entries, part 76.
5633. gbpat77.seq - Patent sequence entries, part 77.
5634. gbpat78.seq - Patent sequence entries, part 78.
5635. gbpat79.seq - Patent sequence entries, part 79.
5636. gbpat8.seq - Patent sequence entries, part 8.
5637. gbpat80.seq - Patent sequence entries, part 80.
5638. gbpat81.seq - Patent sequence entries, part 81.
5639. gbpat82.seq - Patent sequence entries, part 82.
5640. gbpat83.seq - Patent sequence entries, part 83.
5641. gbpat84.seq - Patent sequence entries, part 84.
5642. gbpat85.seq - Patent sequence entries, part 85.
5643. gbpat86.seq - Patent sequence entries, part 86.
5644. gbpat87.seq - Patent sequence entries, part 87.
5645. gbpat88.seq - Patent sequence entries, part 88.
5646. gbpat89.seq - Patent sequence entries, part 89.
5647. gbpat9.seq - Patent sequence entries, part 9.
5648. gbpat90.seq - Patent sequence entries, part 90.
5649. gbpat91.seq - Patent sequence entries, part 91.
5650. gbpat92.seq - Patent sequence entries, part 92.
5651. gbpat93.seq - Patent sequence entries, part 93.
5652. gbpat94.seq - Patent sequence entries, part 94.
5653. gbpat95.seq - Patent sequence entries, part 95.
5654. gbpat96.seq - Patent sequence entries, part 96.
5655. gbpat97.seq - Patent sequence entries, part 97.
5656. gbpat98.seq - Patent sequence entries, part 98.
5657. gbpat99.seq - Patent sequence entries, part 99.
5658. gbphg1.seq - Phage sequence entries, part 1.
5659. gbphg2.seq - Phage sequence entries, part 2.
5660. gbphg3.seq - Phage sequence entries, part 3.
5661. gbphg4.seq - Phage sequence entries, part 4.
5662. gbphg5.seq - Phage sequence entries, part 5.
5663. gbphg6.seq - Phage sequence entries, part 6.
5664. gbphg7.seq - Phage sequence entries, part 7.
5665. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
5666. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
5667. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
5668. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
5669. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
5670. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
5671. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
5672. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
5673. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
5674. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
5675. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
5676. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
5677. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
5678. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
5679. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
5680. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
5681. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
5682. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
5683. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
5684. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
5685. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
5686. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
5687. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
5688. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
5689. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
5690. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
5691. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
5692. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
5693. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
5694. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
5695. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
5696. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
5697. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
5698. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
5699. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
5700. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
5701. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
5702. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
5703. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
5704. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
5705. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
5706. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
5707. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
5708. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
5709. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
5710. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
5711. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
5712. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
5713. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
5714. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
5715. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
5716. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
5717. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
5718. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
5719. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
5720. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
5721. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
5722. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
5723. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
5724. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
5725. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
5726. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
5727. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
5728. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
5729. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
5730. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
5731. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
5732. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
5733. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
5734. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
5735. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
5736. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
5737. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
5738. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
5739. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
5740. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
5741. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
5742. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
5743. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
5744. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
5745. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
5746. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
5747. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
5748. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
5749. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
5750. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
5751. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
5752. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
5753. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
5754. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
5755. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
5756. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
5757. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
5758. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
5759. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
5760. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
5761. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
5762. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
5763. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
5764. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
5765. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
5766. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
5767. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
5768. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
5769. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
5770. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
5771. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
5772. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
5773. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
5774. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
5775. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
5776. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
5777. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
5778. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
5779. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
5780. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
5781. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
5782. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
5783. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
5784. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
5785. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
5786. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
5787. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
5788. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
5789. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
5790. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
5791. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
5792. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
5793. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
5794. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
5795. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
5796. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
5797. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
5798. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
5799. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
5800. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
5801. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
5802. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
5803. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
5804. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
5805. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
5806. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
5807. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
5808. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
5809. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
5810. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
5811. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
5812. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
5813. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
5814. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
5815. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
5816. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
5817. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
5818. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
5819. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
5820. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
5821. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
5822. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
5823. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
5824. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
5825. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
5826. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
5827. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
5828. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
5829. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
5830. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
5831. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
5832. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
5833. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
5834. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
5835. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
5836. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
5837. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
5838. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
5839. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
5840. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
5841. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
5842. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
5843. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
5844. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
5845. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
5846. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
5847. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
5848. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
5849. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
5850. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
5851. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
5852. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
5853. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
5854. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
5855. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
5856. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
5857. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
5858. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
5859. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
5860. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
5861. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
5862. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
5863. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
5864. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
5865. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
5866. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
5867. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
5868. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
5869. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
5870. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
5871. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
5872. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
5873. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
5874. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
5875. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
5876. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
5877. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
5878. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
5879. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
5880. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
5881. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
5882. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
5883. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
5884. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
5885. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
5886. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
5887. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
5888. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
5889. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
5890. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
5891. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
5892. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
5893. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
5894. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
5895. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
5896. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
5897. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
5898. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
5899. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
5900. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
5901. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
5902. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
5903. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
5904. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
5905. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
5906. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
5907. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
5908. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
5909. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
5910. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
5911. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
5912. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
5913. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
5914. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
5915. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
5916. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
5917. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
5918. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
5919. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
5920. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
5921. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
5922. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
5923. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
5924. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
5925. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
5926. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
5927. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
5928. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
5929. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
5930. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
5931. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
5932. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
5933. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
5934. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
5935. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
5936. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
5937. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
5938. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
5939. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
5940. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
5941. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
5942. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
5943. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
5944. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
5945. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
5946. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
5947. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
5948. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
5949. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
5950. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
5951. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
5952. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
5953. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
5954. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
5955. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
5956. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
5957. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
5958. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
5959. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
5960. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
5961. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
5962. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
5963. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
5964. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
5965. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
5966. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
5967. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
5968. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
5969. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
5970. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
5971. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
5972. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
5973. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
5974. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
5975. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
5976. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
5977. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
5978. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
5979. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
5980. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
5981. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
5982. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
5983. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
5984. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
5985. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
5986. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
5987. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
5988. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
5989. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
5990. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
5991. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
5992. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
5993. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
5994. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
5995. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
5996. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
5997. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
5998. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
5999. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
6000. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
6001. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
6002. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
6003. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
6004. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
6005. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
6006. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
6007. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
6008. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
6009. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
6010. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
6011. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
6012. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
6013. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
6014. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
6015. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
6016. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
6017. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
6018. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
6019. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
6020. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
6021. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
6022. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
6023. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
6024. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
6025. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
6026. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
6027. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
6028. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
6029. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
6030. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
6031. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
6032. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
6033. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
6034. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
6035. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
6036. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
6037. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
6038. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
6039. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
6040. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
6041. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
6042. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
6043. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
6044. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
6045. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
6046. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
6047. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
6048. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
6049. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
6050. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
6051. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
6052. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
6053. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
6054. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
6055. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
6056. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
6057. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
6058. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
6059. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
6060. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
6061. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
6062. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
6063. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
6064. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
6065. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
6066. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
6067. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
6068. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
6069. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
6070. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
6071. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
6072. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
6073. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
6074. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
6075. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
6076. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
6077. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
6078. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
6079. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
6080. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
6081. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
6082. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
6083. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
6084. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
6085. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
6086. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
6087. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
6088. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
6089. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
6090. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
6091. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
6092. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
6093. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
6094. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
6095. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
6096. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
6097. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
6098. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
6099. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
6100. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
6101. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
6102. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
6103. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
6104. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
6105. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
6106. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
6107. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
6108. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
6109. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
6110. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
6111. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
6112. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
6113. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
6114. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
6115. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
6116. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
6117. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
6118. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
6119. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
6120. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
6121. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
6122. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
6123. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
6124. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
6125. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
6126. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
6127. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
6128. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
6129. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
6130. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
6131. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
6132. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
6133. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
6134. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
6135. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
6136. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
6137. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
6138. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
6139. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
6140. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
6141. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
6142. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
6143. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
6144. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
6145. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
6146. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
6147. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
6148. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
6149. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
6150. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
6151. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
6152. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
6153. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
6154. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
6155. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
6156. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
6157. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
6158. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
6159. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
6160. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
6161. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
6162. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
6163. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
6164. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
6165. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
6166. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
6167. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
6168. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
6169. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
6170. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
6171. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
6172. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
6173. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
6174. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
6175. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
6176. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
6177. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
6178. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
6179. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
6180. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
6181. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
6182. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
6183. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
6184. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
6185. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
6186. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
6187. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
6188. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
6189. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
6190. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
6191. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
6192. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
6193. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
6194. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
6195. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
6196. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
6197. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
6198. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
6199. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
6200. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
6201. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
6202. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
6203. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
6204. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
6205. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
6206. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
6207. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
6208. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
6209. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
6210. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
6211. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
6212. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
6213. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
6214. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
6215. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
6216. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
6217. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
6218. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
6219. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
6220. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
6221. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
6222. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
6223. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
6224. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
6225. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
6226. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
6227. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
6228. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
6229. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
6230. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
6231. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
6232. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
6233. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
6234. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
6235. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
6236. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
6237. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
6238. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
6239. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
6240. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
6241. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
6242. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
6243. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
6244. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
6245. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
6246. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
6247. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
6248. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
6249. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
6250. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
6251. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
6252. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
6253. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
6254. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
6255. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
6256. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
6257. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
6258. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
6259. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
6260. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
6261. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
6262. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
6263. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
6264. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
6265. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
6266. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
6267. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
6268. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
6269. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
6270. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
6271. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
6272. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
6273. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
6274. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
6275. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
6276. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
6277. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
6278. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
6279. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
6280. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
6281. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
6282. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
6283. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
6284. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
6285. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
6286. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
6287. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
6288. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
6289. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
6290. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
6291. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
6292. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
6293. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
6294. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
6295. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
6296. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
6297. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
6298. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
6299. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
6300. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
6301. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
6302. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
6303. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
6304. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
6305. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
6306. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
6307. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
6308. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
6309. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
6310. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
6311. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
6312. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
6313. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
6314. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
6315. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
6316. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
6317. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
6318. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
6319. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
6320. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
6321. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
6322. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
6323. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
6324. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
6325. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
6326. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
6327. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
6328. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
6329. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
6330. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
6331. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
6332. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
6333. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
6334. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
6335. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
6336. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
6337. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
6338. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
6339. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
6340. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
6341. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
6342. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
6343. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
6344. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
6345. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
6346. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
6347. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
6348. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
6349. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
6350. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
6351. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
6352. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
6353. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
6354. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
6355. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
6356. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
6357. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
6358. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
6359. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
6360. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
6361. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
6362. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
6363. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
6364. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
6365. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
6366. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
6367. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
6368. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
6369. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
6370. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
6371. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
6372. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
6373. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
6374. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
6375. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
6376. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
6377. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
6378. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
6379. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
6380. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
6381. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
6382. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
6383. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
6384. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
6385. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
6386. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
6387. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
6388. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
6389. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
6390. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
6391. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
6392. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
6393. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
6394. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
6395. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
6396. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
6397. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
6398. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
6399. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
6400. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
6401. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
6402. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
6403. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
6404. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
6405. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
6406. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
6407. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
6408. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
6409. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
6410. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
6411. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
6412. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
6413. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
6414. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
6415. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
6416. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
6417. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
6418. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
6419. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
6420. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
6421. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
6422. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
6423. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
6424. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
6425. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
6426. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
6427. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
6428. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
6429. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
6430. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
6431. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
6432. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
6433. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
6434. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
6435. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
6436. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
6437. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
6438. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
6439. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
6440. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
6441. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
6442. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
6443. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
6444. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
6445. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
6446. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
6447. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
6448. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
6449. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
6450. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
6451. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
6452. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
6453. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
6454. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
6455. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
6456. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
6457. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
6458. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
6459. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
6460. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
6461. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
6462. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
6463. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
6464. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
6465. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
6466. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
6467. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
6468. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
6469. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
6470. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
6471. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
6472. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
6473. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
6474. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
6475. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
6476. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
6477. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
6478. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
6479. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
6480. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
6481. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
6482. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
6483. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
6484. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
6485. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
6486. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
6487. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
6488. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
6489. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
6490. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
6491. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
6492. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
6493. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
6494. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
6495. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
6496. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
6497. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
6498. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
6499. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
6500. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
6501. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
6502. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
6503. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
6504. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
6505. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
6506. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
6507. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
6508. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
6509. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
6510. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
6511. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
6512. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
6513. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
6514. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
6515. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
6516. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
6517. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
6518. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
6519. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
6520. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
6521. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
6522. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
6523. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
6524. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
6525. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
6526. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
6527. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
6528. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
6529. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
6530. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
6531. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
6532. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
6533. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
6534. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
6535. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
6536. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
6537. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
6538. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
6539. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
6540. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
6541. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
6542. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
6543. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
6544. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
6545. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
6546. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
6547. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
6548. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
6549. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
6550. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
6551. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
6552. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
6553. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
6554. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
6555. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
6556. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
6557. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
6558. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
6559. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
6560. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
6561. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
6562. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
6563. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
6564. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
6565. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
6566. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
6567. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
6568. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
6569. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
6570. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
6571. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
6572. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
6573. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
6574. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
6575. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
6576. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
6577. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
6578. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
6579. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
6580. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
6581. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
6582. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
6583. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
6584. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
6585. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
6586. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
6587. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
6588. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
6589. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
6590. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
6591. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
6592. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
6593. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
6594. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
6595. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
6596. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
6597. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
6598. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
6599. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
6600. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
6601. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
6602. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
6603. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
6604. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
6605. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
6606. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
6607. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
6608. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
6609. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
6610. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
6611. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
6612. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
6613. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
6614. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
6615. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
6616. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
6617. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
6618. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
6619. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
6620. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
6621. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
6622. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
6623. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
6624. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
6625. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
6626. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
6627. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
6628. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
6629. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
6630. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
6631. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
6632. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
6633. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
6634. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
6635. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
6636. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
6637. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
6638. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
6639. gbpln1876.seq - Plant sequence entries (including fungi and algae), part 1876.
6640. gbpln1877.seq - Plant sequence entries (including fungi and algae), part 1877.
6641. gbpln1878.seq - Plant sequence entries (including fungi and algae), part 1878.
6642. gbpln1879.seq - Plant sequence entries (including fungi and algae), part 1879.
6643. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
6644. gbpln1880.seq - Plant sequence entries (including fungi and algae), part 1880.
6645. gbpln1881.seq - Plant sequence entries (including fungi and algae), part 1881.
6646. gbpln1882.seq - Plant sequence entries (including fungi and algae), part 1882.
6647. gbpln1883.seq - Plant sequence entries (including fungi and algae), part 1883.
6648. gbpln1884.seq - Plant sequence entries (including fungi and algae), part 1884.
6649. gbpln1885.seq - Plant sequence entries (including fungi and algae), part 1885.
6650. gbpln1886.seq - Plant sequence entries (including fungi and algae), part 1886.
6651. gbpln1887.seq - Plant sequence entries (including fungi and algae), part 1887.
6652. gbpln1888.seq - Plant sequence entries (including fungi and algae), part 1888.
6653. gbpln1889.seq - Plant sequence entries (including fungi and algae), part 1889.
6654. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
6655. gbpln1890.seq - Plant sequence entries (including fungi and algae), part 1890.
6656. gbpln1891.seq - Plant sequence entries (including fungi and algae), part 1891.
6657. gbpln1892.seq - Plant sequence entries (including fungi and algae), part 1892.
6658. gbpln1893.seq - Plant sequence entries (including fungi and algae), part 1893.
6659. gbpln1894.seq - Plant sequence entries (including fungi and algae), part 1894.
6660. gbpln1895.seq - Plant sequence entries (including fungi and algae), part 1895.
6661. gbpln1896.seq - Plant sequence entries (including fungi and algae), part 1896.
6662. gbpln1897.seq - Plant sequence entries (including fungi and algae), part 1897.
6663. gbpln1898.seq - Plant sequence entries (including fungi and algae), part 1898.
6664. gbpln1899.seq - Plant sequence entries (including fungi and algae), part 1899.
6665. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
6666. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
6667. gbpln1900.seq - Plant sequence entries (including fungi and algae), part 1900.
6668. gbpln1901.seq - Plant sequence entries (including fungi and algae), part 1901.
6669. gbpln1902.seq - Plant sequence entries (including fungi and algae), part 1902.
6670. gbpln1903.seq - Plant sequence entries (including fungi and algae), part 1903.
6671. gbpln1904.seq - Plant sequence entries (including fungi and algae), part 1904.
6672. gbpln1905.seq - Plant sequence entries (including fungi and algae), part 1905.
6673. gbpln1906.seq - Plant sequence entries (including fungi and algae), part 1906.
6674. gbpln1907.seq - Plant sequence entries (including fungi and algae), part 1907.
6675. gbpln1908.seq - Plant sequence entries (including fungi and algae), part 1908.
6676. gbpln1909.seq - Plant sequence entries (including fungi and algae), part 1909.
6677. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
6678. gbpln1910.seq - Plant sequence entries (including fungi and algae), part 1910.
6679. gbpln1911.seq - Plant sequence entries (including fungi and algae), part 1911.
6680. gbpln1912.seq - Plant sequence entries (including fungi and algae), part 1912.
6681. gbpln1913.seq - Plant sequence entries (including fungi and algae), part 1913.
6682. gbpln1914.seq - Plant sequence entries (including fungi and algae), part 1914.
6683. gbpln1915.seq - Plant sequence entries (including fungi and algae), part 1915.
6684. gbpln1916.seq - Plant sequence entries (including fungi and algae), part 1916.
6685. gbpln1917.seq - Plant sequence entries (including fungi and algae), part 1917.
6686. gbpln1918.seq - Plant sequence entries (including fungi and algae), part 1918.
6687. gbpln1919.seq - Plant sequence entries (including fungi and algae), part 1919.
6688. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
6689. gbpln1920.seq - Plant sequence entries (including fungi and algae), part 1920.
6690. gbpln1921.seq - Plant sequence entries (including fungi and algae), part 1921.
6691. gbpln1922.seq - Plant sequence entries (including fungi and algae), part 1922.
6692. gbpln1923.seq - Plant sequence entries (including fungi and algae), part 1923.
6693. gbpln1924.seq - Plant sequence entries (including fungi and algae), part 1924.
6694. gbpln1925.seq - Plant sequence entries (including fungi and algae), part 1925.
6695. gbpln1926.seq - Plant sequence entries (including fungi and algae), part 1926.
6696. gbpln1927.seq - Plant sequence entries (including fungi and algae), part 1927.
6697. gbpln1928.seq - Plant sequence entries (including fungi and algae), part 1928.
6698. gbpln1929.seq - Plant sequence entries (including fungi and algae), part 1929.
6699. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
6700. gbpln1930.seq - Plant sequence entries (including fungi and algae), part 1930.
6701. gbpln1931.seq - Plant sequence entries (including fungi and algae), part 1931.
6702. gbpln1932.seq - Plant sequence entries (including fungi and algae), part 1932.
6703. gbpln1933.seq - Plant sequence entries (including fungi and algae), part 1933.
6704. gbpln1934.seq - Plant sequence entries (including fungi and algae), part 1934.
6705. gbpln1935.seq - Plant sequence entries (including fungi and algae), part 1935.
6706. gbpln1936.seq - Plant sequence entries (including fungi and algae), part 1936.
6707. gbpln1937.seq - Plant sequence entries (including fungi and algae), part 1937.
6708. gbpln1938.seq - Plant sequence entries (including fungi and algae), part 1938.
6709. gbpln1939.seq - Plant sequence entries (including fungi and algae), part 1939.
6710. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
6711. gbpln1940.seq - Plant sequence entries (including fungi and algae), part 1940.
6712. gbpln1941.seq - Plant sequence entries (including fungi and algae), part 1941.
6713. gbpln1942.seq - Plant sequence entries (including fungi and algae), part 1942.
6714. gbpln1943.seq - Plant sequence entries (including fungi and algae), part 1943.
6715. gbpln1944.seq - Plant sequence entries (including fungi and algae), part 1944.
6716. gbpln1945.seq - Plant sequence entries (including fungi and algae), part 1945.
6717. gbpln1946.seq - Plant sequence entries (including fungi and algae), part 1946.
6718. gbpln1947.seq - Plant sequence entries (including fungi and algae), part 1947.
6719. gbpln1948.seq - Plant sequence entries (including fungi and algae), part 1948.
6720. gbpln1949.seq - Plant sequence entries (including fungi and algae), part 1949.
6721. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
6722. gbpln1950.seq - Plant sequence entries (including fungi and algae), part 1950.
6723. gbpln1951.seq - Plant sequence entries (including fungi and algae), part 1951.
6724. gbpln1952.seq - Plant sequence entries (including fungi and algae), part 1952.
6725. gbpln1953.seq - Plant sequence entries (including fungi and algae), part 1953.
6726. gbpln1954.seq - Plant sequence entries (including fungi and algae), part 1954.
6727. gbpln1955.seq - Plant sequence entries (including fungi and algae), part 1955.
6728. gbpln1956.seq - Plant sequence entries (including fungi and algae), part 1956.
6729. gbpln1957.seq - Plant sequence entries (including fungi and algae), part 1957.
6730. gbpln1958.seq - Plant sequence entries (including fungi and algae), part 1958.
6731. gbpln1959.seq - Plant sequence entries (including fungi and algae), part 1959.
6732. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
6733. gbpln1960.seq - Plant sequence entries (including fungi and algae), part 1960.
6734. gbpln1961.seq - Plant sequence entries (including fungi and algae), part 1961.
6735. gbpln1962.seq - Plant sequence entries (including fungi and algae), part 1962.
6736. gbpln1963.seq - Plant sequence entries (including fungi and algae), part 1963.
6737. gbpln1964.seq - Plant sequence entries (including fungi and algae), part 1964.
6738. gbpln1965.seq - Plant sequence entries (including fungi and algae), part 1965.
6739. gbpln1966.seq - Plant sequence entries (including fungi and algae), part 1966.
6740. gbpln1967.seq - Plant sequence entries (including fungi and algae), part 1967.
6741. gbpln1968.seq - Plant sequence entries (including fungi and algae), part 1968.
6742. gbpln1969.seq - Plant sequence entries (including fungi and algae), part 1969.
6743. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
6744. gbpln1970.seq - Plant sequence entries (including fungi and algae), part 1970.
6745. gbpln1971.seq - Plant sequence entries (including fungi and algae), part 1971.
6746. gbpln1972.seq - Plant sequence entries (including fungi and algae), part 1972.
6747. gbpln1973.seq - Plant sequence entries (including fungi and algae), part 1973.
6748. gbpln1974.seq - Plant sequence entries (including fungi and algae), part 1974.
6749. gbpln1975.seq - Plant sequence entries (including fungi and algae), part 1975.
6750. gbpln1976.seq - Plant sequence entries (including fungi and algae), part 1976.
6751. gbpln1977.seq - Plant sequence entries (including fungi and algae), part 1977.
6752. gbpln1978.seq - Plant sequence entries (including fungi and algae), part 1978.
6753. gbpln1979.seq - Plant sequence entries (including fungi and algae), part 1979.
6754. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
6755. gbpln1980.seq - Plant sequence entries (including fungi and algae), part 1980.
6756. gbpln1981.seq - Plant sequence entries (including fungi and algae), part 1981.
6757. gbpln1982.seq - Plant sequence entries (including fungi and algae), part 1982.
6758. gbpln1983.seq - Plant sequence entries (including fungi and algae), part 1983.
6759. gbpln1984.seq - Plant sequence entries (including fungi and algae), part 1984.
6760. gbpln1985.seq - Plant sequence entries (including fungi and algae), part 1985.
6761. gbpln1986.seq - Plant sequence entries (including fungi and algae), part 1986.
6762. gbpln1987.seq - Plant sequence entries (including fungi and algae), part 1987.
6763. gbpln1988.seq - Plant sequence entries (including fungi and algae), part 1988.
6764. gbpln1989.seq - Plant sequence entries (including fungi and algae), part 1989.
6765. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
6766. gbpln1990.seq - Plant sequence entries (including fungi and algae), part 1990.
6767. gbpln1991.seq - Plant sequence entries (including fungi and algae), part 1991.
6768. gbpln1992.seq - Plant sequence entries (including fungi and algae), part 1992.
6769. gbpln1993.seq - Plant sequence entries (including fungi and algae), part 1993.
6770. gbpln1994.seq - Plant sequence entries (including fungi and algae), part 1994.
6771. gbpln1995.seq - Plant sequence entries (including fungi and algae), part 1995.
6772. gbpln1996.seq - Plant sequence entries (including fungi and algae), part 1996.
6773. gbpln1997.seq - Plant sequence entries (including fungi and algae), part 1997.
6774. gbpln1998.seq - Plant sequence entries (including fungi and algae), part 1998.
6775. gbpln1999.seq - Plant sequence entries (including fungi and algae), part 1999.
6776. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
6777. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
6778. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
6779. gbpln2000.seq - Plant sequence entries (including fungi and algae), part 2000.
6780. gbpln2001.seq - Plant sequence entries (including fungi and algae), part 2001.
6781. gbpln2002.seq - Plant sequence entries (including fungi and algae), part 2002.
6782. gbpln2003.seq - Plant sequence entries (including fungi and algae), part 2003.
6783. gbpln2004.seq - Plant sequence entries (including fungi and algae), part 2004.
6784. gbpln2005.seq - Plant sequence entries (including fungi and algae), part 2005.
6785. gbpln2006.seq - Plant sequence entries (including fungi and algae), part 2006.
6786. gbpln2007.seq - Plant sequence entries (including fungi and algae), part 2007.
6787. gbpln2008.seq - Plant sequence entries (including fungi and algae), part 2008.
6788. gbpln2009.seq - Plant sequence entries (including fungi and algae), part 2009.
6789. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
6790. gbpln2010.seq - Plant sequence entries (including fungi and algae), part 2010.
6791. gbpln2011.seq - Plant sequence entries (including fungi and algae), part 2011.
6792. gbpln2012.seq - Plant sequence entries (including fungi and algae), part 2012.
6793. gbpln2013.seq - Plant sequence entries (including fungi and algae), part 2013.
6794. gbpln2014.seq - Plant sequence entries (including fungi and algae), part 2014.
6795. gbpln2015.seq - Plant sequence entries (including fungi and algae), part 2015.
6796. gbpln2016.seq - Plant sequence entries (including fungi and algae), part 2016.
6797. gbpln2017.seq - Plant sequence entries (including fungi and algae), part 2017.
6798. gbpln2018.seq - Plant sequence entries (including fungi and algae), part 2018.
6799. gbpln2019.seq - Plant sequence entries (including fungi and algae), part 2019.
6800. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
6801. gbpln2020.seq - Plant sequence entries (including fungi and algae), part 2020.
6802. gbpln2021.seq - Plant sequence entries (including fungi and algae), part 2021.
6803. gbpln2022.seq - Plant sequence entries (including fungi and algae), part 2022.
6804. gbpln2023.seq - Plant sequence entries (including fungi and algae), part 2023.
6805. gbpln2024.seq - Plant sequence entries (including fungi and algae), part 2024.
6806. gbpln2025.seq - Plant sequence entries (including fungi and algae), part 2025.
6807. gbpln2026.seq - Plant sequence entries (including fungi and algae), part 2026.
6808. gbpln2027.seq - Plant sequence entries (including fungi and algae), part 2027.
6809. gbpln2028.seq - Plant sequence entries (including fungi and algae), part 2028.
6810. gbpln2029.seq - Plant sequence entries (including fungi and algae), part 2029.
6811. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
6812. gbpln2030.seq - Plant sequence entries (including fungi and algae), part 2030.
6813. gbpln2031.seq - Plant sequence entries (including fungi and algae), part 2031.
6814. gbpln2032.seq - Plant sequence entries (including fungi and algae), part 2032.
6815. gbpln2033.seq - Plant sequence entries (including fungi and algae), part 2033.
6816. gbpln2034.seq - Plant sequence entries (including fungi and algae), part 2034.
6817. gbpln2035.seq - Plant sequence entries (including fungi and algae), part 2035.
6818. gbpln2036.seq - Plant sequence entries (including fungi and algae), part 2036.
6819. gbpln2037.seq - Plant sequence entries (including fungi and algae), part 2037.
6820. gbpln2038.seq - Plant sequence entries (including fungi and algae), part 2038.
6821. gbpln2039.seq - Plant sequence entries (including fungi and algae), part 2039.
6822. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
6823. gbpln2040.seq - Plant sequence entries (including fungi and algae), part 2040.
6824. gbpln2041.seq - Plant sequence entries (including fungi and algae), part 2041.
6825. gbpln2042.seq - Plant sequence entries (including fungi and algae), part 2042.
6826. gbpln2043.seq - Plant sequence entries (including fungi and algae), part 2043.
6827. gbpln2044.seq - Plant sequence entries (including fungi and algae), part 2044.
6828. gbpln2045.seq - Plant sequence entries (including fungi and algae), part 2045.
6829. gbpln2046.seq - Plant sequence entries (including fungi and algae), part 2046.
6830. gbpln2047.seq - Plant sequence entries (including fungi and algae), part 2047.
6831. gbpln2048.seq - Plant sequence entries (including fungi and algae), part 2048.
6832. gbpln2049.seq - Plant sequence entries (including fungi and algae), part 2049.
6833. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
6834. gbpln2050.seq - Plant sequence entries (including fungi and algae), part 2050.
6835. gbpln2051.seq - Plant sequence entries (including fungi and algae), part 2051.
6836. gbpln2052.seq - Plant sequence entries (including fungi and algae), part 2052.
6837. gbpln2053.seq - Plant sequence entries (including fungi and algae), part 2053.
6838. gbpln2054.seq - Plant sequence entries (including fungi and algae), part 2054.
6839. gbpln2055.seq - Plant sequence entries (including fungi and algae), part 2055.
6840. gbpln2056.seq - Plant sequence entries (including fungi and algae), part 2056.
6841. gbpln2057.seq - Plant sequence entries (including fungi and algae), part 2057.
6842. gbpln2058.seq - Plant sequence entries (including fungi and algae), part 2058.
6843. gbpln2059.seq - Plant sequence entries (including fungi and algae), part 2059.
6844. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
6845. gbpln2060.seq - Plant sequence entries (including fungi and algae), part 2060.
6846. gbpln2061.seq - Plant sequence entries (including fungi and algae), part 2061.
6847. gbpln2062.seq - Plant sequence entries (including fungi and algae), part 2062.
6848. gbpln2063.seq - Plant sequence entries (including fungi and algae), part 2063.
6849. gbpln2064.seq - Plant sequence entries (including fungi and algae), part 2064.
6850. gbpln2065.seq - Plant sequence entries (including fungi and algae), part 2065.
6851. gbpln2066.seq - Plant sequence entries (including fungi and algae), part 2066.
6852. gbpln2067.seq - Plant sequence entries (including fungi and algae), part 2067.
6853. gbpln2068.seq - Plant sequence entries (including fungi and algae), part 2068.
6854. gbpln2069.seq - Plant sequence entries (including fungi and algae), part 2069.
6855. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
6856. gbpln2070.seq - Plant sequence entries (including fungi and algae), part 2070.
6857. gbpln2071.seq - Plant sequence entries (including fungi and algae), part 2071.
6858. gbpln2072.seq - Plant sequence entries (including fungi and algae), part 2072.
6859. gbpln2073.seq - Plant sequence entries (including fungi and algae), part 2073.
6860. gbpln2074.seq - Plant sequence entries (including fungi and algae), part 2074.
6861. gbpln2075.seq - Plant sequence entries (including fungi and algae), part 2075.
6862. gbpln2076.seq - Plant sequence entries (including fungi and algae), part 2076.
6863. gbpln2077.seq - Plant sequence entries (including fungi and algae), part 2077.
6864. gbpln2078.seq - Plant sequence entries (including fungi and algae), part 2078.
6865. gbpln2079.seq - Plant sequence entries (including fungi and algae), part 2079.
6866. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
6867. gbpln2080.seq - Plant sequence entries (including fungi and algae), part 2080.
6868. gbpln2081.seq - Plant sequence entries (including fungi and algae), part 2081.
6869. gbpln2082.seq - Plant sequence entries (including fungi and algae), part 2082.
6870. gbpln2083.seq - Plant sequence entries (including fungi and algae), part 2083.
6871. gbpln2084.seq - Plant sequence entries (including fungi and algae), part 2084.
6872. gbpln2085.seq - Plant sequence entries (including fungi and algae), part 2085.
6873. gbpln2086.seq - Plant sequence entries (including fungi and algae), part 2086.
6874. gbpln2087.seq - Plant sequence entries (including fungi and algae), part 2087.
6875. gbpln2088.seq - Plant sequence entries (including fungi and algae), part 2088.
6876. gbpln2089.seq - Plant sequence entries (including fungi and algae), part 2089.
6877. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
6878. gbpln2090.seq - Plant sequence entries (including fungi and algae), part 2090.
6879. gbpln2091.seq - Plant sequence entries (including fungi and algae), part 2091.
6880. gbpln2092.seq - Plant sequence entries (including fungi and algae), part 2092.
6881. gbpln2093.seq - Plant sequence entries (including fungi and algae), part 2093.
6882. gbpln2094.seq - Plant sequence entries (including fungi and algae), part 2094.
6883. gbpln2095.seq - Plant sequence entries (including fungi and algae), part 2095.
6884. gbpln2096.seq - Plant sequence entries (including fungi and algae), part 2096.
6885. gbpln2097.seq - Plant sequence entries (including fungi and algae), part 2097.
6886. gbpln2098.seq - Plant sequence entries (including fungi and algae), part 2098.
6887. gbpln2099.seq - Plant sequence entries (including fungi and algae), part 2099.
6888. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
6889. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
6890. gbpln2100.seq - Plant sequence entries (including fungi and algae), part 2100.
6891. gbpln2101.seq - Plant sequence entries (including fungi and algae), part 2101.
6892. gbpln2102.seq - Plant sequence entries (including fungi and algae), part 2102.
6893. gbpln2103.seq - Plant sequence entries (including fungi and algae), part 2103.
6894. gbpln2104.seq - Plant sequence entries (including fungi and algae), part 2104.
6895. gbpln2105.seq - Plant sequence entries (including fungi and algae), part 2105.
6896. gbpln2106.seq - Plant sequence entries (including fungi and algae), part 2106.
6897. gbpln2107.seq - Plant sequence entries (including fungi and algae), part 2107.
6898. gbpln2108.seq - Plant sequence entries (including fungi and algae), part 2108.
6899. gbpln2109.seq - Plant sequence entries (including fungi and algae), part 2109.
6900. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
6901. gbpln2110.seq - Plant sequence entries (including fungi and algae), part 2110.
6902. gbpln2111.seq - Plant sequence entries (including fungi and algae), part 2111.
6903. gbpln2112.seq - Plant sequence entries (including fungi and algae), part 2112.
6904. gbpln2113.seq - Plant sequence entries (including fungi and algae), part 2113.
6905. gbpln2114.seq - Plant sequence entries (including fungi and algae), part 2114.
6906. gbpln2115.seq - Plant sequence entries (including fungi and algae), part 2115.
6907. gbpln2116.seq - Plant sequence entries (including fungi and algae), part 2116.
6908. gbpln2117.seq - Plant sequence entries (including fungi and algae), part 2117.
6909. gbpln2118.seq - Plant sequence entries (including fungi and algae), part 2118.
6910. gbpln2119.seq - Plant sequence entries (including fungi and algae), part 2119.
6911. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
6912. gbpln2120.seq - Plant sequence entries (including fungi and algae), part 2120.
6913. gbpln2121.seq - Plant sequence entries (including fungi and algae), part 2121.
6914. gbpln2122.seq - Plant sequence entries (including fungi and algae), part 2122.
6915. gbpln2123.seq - Plant sequence entries (including fungi and algae), part 2123.
6916. gbpln2124.seq - Plant sequence entries (including fungi and algae), part 2124.
6917. gbpln2125.seq - Plant sequence entries (including fungi and algae), part 2125.
6918. gbpln2126.seq - Plant sequence entries (including fungi and algae), part 2126.
6919. gbpln2127.seq - Plant sequence entries (including fungi and algae), part 2127.
6920. gbpln2128.seq - Plant sequence entries (including fungi and algae), part 2128.
6921. gbpln2129.seq - Plant sequence entries (including fungi and algae), part 2129.
6922. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
6923. gbpln2130.seq - Plant sequence entries (including fungi and algae), part 2130.
6924. gbpln2131.seq - Plant sequence entries (including fungi and algae), part 2131.
6925. gbpln2132.seq - Plant sequence entries (including fungi and algae), part 2132.
6926. gbpln2133.seq - Plant sequence entries (including fungi and algae), part 2133.
6927. gbpln2134.seq - Plant sequence entries (including fungi and algae), part 2134.
6928. gbpln2135.seq - Plant sequence entries (including fungi and algae), part 2135.
6929. gbpln2136.seq - Plant sequence entries (including fungi and algae), part 2136.
6930. gbpln2137.seq - Plant sequence entries (including fungi and algae), part 2137.
6931. gbpln2138.seq - Plant sequence entries (including fungi and algae), part 2138.
6932. gbpln2139.seq - Plant sequence entries (including fungi and algae), part 2139.
6933. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
6934. gbpln2140.seq - Plant sequence entries (including fungi and algae), part 2140.
6935. gbpln2141.seq - Plant sequence entries (including fungi and algae), part 2141.
6936. gbpln2142.seq - Plant sequence entries (including fungi and algae), part 2142.
6937. gbpln2143.seq - Plant sequence entries (including fungi and algae), part 2143.
6938. gbpln2144.seq - Plant sequence entries (including fungi and algae), part 2144.
6939. gbpln2145.seq - Plant sequence entries (including fungi and algae), part 2145.
6940. gbpln2146.seq - Plant sequence entries (including fungi and algae), part 2146.
6941. gbpln2147.seq - Plant sequence entries (including fungi and algae), part 2147.
6942. gbpln2148.seq - Plant sequence entries (including fungi and algae), part 2148.
6943. gbpln2149.seq - Plant sequence entries (including fungi and algae), part 2149.
6944. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
6945. gbpln2150.seq - Plant sequence entries (including fungi and algae), part 2150.
6946. gbpln2151.seq - Plant sequence entries (including fungi and algae), part 2151.
6947. gbpln2152.seq - Plant sequence entries (including fungi and algae), part 2152.
6948. gbpln2153.seq - Plant sequence entries (including fungi and algae), part 2153.
6949. gbpln2154.seq - Plant sequence entries (including fungi and algae), part 2154.
6950. gbpln2155.seq - Plant sequence entries (including fungi and algae), part 2155.
6951. gbpln2156.seq - Plant sequence entries (including fungi and algae), part 2156.
6952. gbpln2157.seq - Plant sequence entries (including fungi and algae), part 2157.
6953. gbpln2158.seq - Plant sequence entries (including fungi and algae), part 2158.
6954. gbpln2159.seq - Plant sequence entries (including fungi and algae), part 2159.
6955. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
6956. gbpln2160.seq - Plant sequence entries (including fungi and algae), part 2160.
6957. gbpln2161.seq - Plant sequence entries (including fungi and algae), part 2161.
6958. gbpln2162.seq - Plant sequence entries (including fungi and algae), part 2162.
6959. gbpln2163.seq - Plant sequence entries (including fungi and algae), part 2163.
6960. gbpln2164.seq - Plant sequence entries (including fungi and algae), part 2164.
6961. gbpln2165.seq - Plant sequence entries (including fungi and algae), part 2165.
6962. gbpln2166.seq - Plant sequence entries (including fungi and algae), part 2166.
6963. gbpln2167.seq - Plant sequence entries (including fungi and algae), part 2167.
6964. gbpln2168.seq - Plant sequence entries (including fungi and algae), part 2168.
6965. gbpln2169.seq - Plant sequence entries (including fungi and algae), part 2169.
6966. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
6967. gbpln2170.seq - Plant sequence entries (including fungi and algae), part 2170.
6968. gbpln2171.seq - Plant sequence entries (including fungi and algae), part 2171.
6969. gbpln2172.seq - Plant sequence entries (including fungi and algae), part 2172.
6970. gbpln2173.seq - Plant sequence entries (including fungi and algae), part 2173.
6971. gbpln2174.seq - Plant sequence entries (including fungi and algae), part 2174.
6972. gbpln2175.seq - Plant sequence entries (including fungi and algae), part 2175.
6973. gbpln2176.seq - Plant sequence entries (including fungi and algae), part 2176.
6974. gbpln2177.seq - Plant sequence entries (including fungi and algae), part 2177.
6975. gbpln2178.seq - Plant sequence entries (including fungi and algae), part 2178.
6976. gbpln2179.seq - Plant sequence entries (including fungi and algae), part 2179.
6977. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
6978. gbpln2180.seq - Plant sequence entries (including fungi and algae), part 2180.
6979. gbpln2181.seq - Plant sequence entries (including fungi and algae), part 2181.
6980. gbpln2182.seq - Plant sequence entries (including fungi and algae), part 2182.
6981. gbpln2183.seq - Plant sequence entries (including fungi and algae), part 2183.
6982. gbpln2184.seq - Plant sequence entries (including fungi and algae), part 2184.
6983. gbpln2185.seq - Plant sequence entries (including fungi and algae), part 2185.
6984. gbpln2186.seq - Plant sequence entries (including fungi and algae), part 2186.
6985. gbpln2187.seq - Plant sequence entries (including fungi and algae), part 2187.
6986. gbpln2188.seq - Plant sequence entries (including fungi and algae), part 2188.
6987. gbpln2189.seq - Plant sequence entries (including fungi and algae), part 2189.
6988. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
6989. gbpln2190.seq - Plant sequence entries (including fungi and algae), part 2190.
6990. gbpln2191.seq - Plant sequence entries (including fungi and algae), part 2191.
6991. gbpln2192.seq - Plant sequence entries (including fungi and algae), part 2192.
6992. gbpln2193.seq - Plant sequence entries (including fungi and algae), part 2193.
6993. gbpln2194.seq - Plant sequence entries (including fungi and algae), part 2194.
6994. gbpln2195.seq - Plant sequence entries (including fungi and algae), part 2195.
6995. gbpln2196.seq - Plant sequence entries (including fungi and algae), part 2196.
6996. gbpln2197.seq - Plant sequence entries (including fungi and algae), part 2197.
6997. gbpln2198.seq - Plant sequence entries (including fungi and algae), part 2198.
6998. gbpln2199.seq - Plant sequence entries (including fungi and algae), part 2199.
6999. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
7000. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
7001. gbpln2200.seq - Plant sequence entries (including fungi and algae), part 2200.
7002. gbpln2201.seq - Plant sequence entries (including fungi and algae), part 2201.
7003. gbpln2202.seq - Plant sequence entries (including fungi and algae), part 2202.
7004. gbpln2203.seq - Plant sequence entries (including fungi and algae), part 2203.
7005. gbpln2204.seq - Plant sequence entries (including fungi and algae), part 2204.
7006. gbpln2205.seq - Plant sequence entries (including fungi and algae), part 2205.
7007. gbpln2206.seq - Plant sequence entries (including fungi and algae), part 2206.
7008. gbpln2207.seq - Plant sequence entries (including fungi and algae), part 2207.
7009. gbpln2208.seq - Plant sequence entries (including fungi and algae), part 2208.
7010. gbpln2209.seq - Plant sequence entries (including fungi and algae), part 2209.
7011. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
7012. gbpln2210.seq - Plant sequence entries (including fungi and algae), part 2210.
7013. gbpln2211.seq - Plant sequence entries (including fungi and algae), part 2211.
7014. gbpln2212.seq - Plant sequence entries (including fungi and algae), part 2212.
7015. gbpln2213.seq - Plant sequence entries (including fungi and algae), part 2213.
7016. gbpln2214.seq - Plant sequence entries (including fungi and algae), part 2214.
7017. gbpln2215.seq - Plant sequence entries (including fungi and algae), part 2215.
7018. gbpln2216.seq - Plant sequence entries (including fungi and algae), part 2216.
7019. gbpln2217.seq - Plant sequence entries (including fungi and algae), part 2217.
7020. gbpln2218.seq - Plant sequence entries (including fungi and algae), part 2218.
7021. gbpln2219.seq - Plant sequence entries (including fungi and algae), part 2219.
7022. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
7023. gbpln2220.seq - Plant sequence entries (including fungi and algae), part 2220.
7024. gbpln2221.seq - Plant sequence entries (including fungi and algae), part 2221.
7025. gbpln2222.seq - Plant sequence entries (including fungi and algae), part 2222.
7026. gbpln2223.seq - Plant sequence entries (including fungi and algae), part 2223.
7027. gbpln2224.seq - Plant sequence entries (including fungi and algae), part 2224.
7028. gbpln2225.seq - Plant sequence entries (including fungi and algae), part 2225.
7029. gbpln2226.seq - Plant sequence entries (including fungi and algae), part 2226.
7030. gbpln2227.seq - Plant sequence entries (including fungi and algae), part 2227.
7031. gbpln2228.seq - Plant sequence entries (including fungi and algae), part 2228.
7032. gbpln2229.seq - Plant sequence entries (including fungi and algae), part 2229.
7033. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
7034. gbpln2230.seq - Plant sequence entries (including fungi and algae), part 2230.
7035. gbpln2231.seq - Plant sequence entries (including fungi and algae), part 2231.
7036. gbpln2232.seq - Plant sequence entries (including fungi and algae), part 2232.
7037. gbpln2233.seq - Plant sequence entries (including fungi and algae), part 2233.
7038. gbpln2234.seq - Plant sequence entries (including fungi and algae), part 2234.
7039. gbpln2235.seq - Plant sequence entries (including fungi and algae), part 2235.
7040. gbpln2236.seq - Plant sequence entries (including fungi and algae), part 2236.
7041. gbpln2237.seq - Plant sequence entries (including fungi and algae), part 2237.
7042. gbpln2238.seq - Plant sequence entries (including fungi and algae), part 2238.
7043. gbpln2239.seq - Plant sequence entries (including fungi and algae), part 2239.
7044. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
7045. gbpln2240.seq - Plant sequence entries (including fungi and algae), part 2240.
7046. gbpln2241.seq - Plant sequence entries (including fungi and algae), part 2241.
7047. gbpln2242.seq - Plant sequence entries (including fungi and algae), part 2242.
7048. gbpln2243.seq - Plant sequence entries (including fungi and algae), part 2243.
7049. gbpln2244.seq - Plant sequence entries (including fungi and algae), part 2244.
7050. gbpln2245.seq - Plant sequence entries (including fungi and algae), part 2245.
7051. gbpln2246.seq - Plant sequence entries (including fungi and algae), part 2246.
7052. gbpln2247.seq - Plant sequence entries (including fungi and algae), part 2247.
7053. gbpln2248.seq - Plant sequence entries (including fungi and algae), part 2248.
7054. gbpln2249.seq - Plant sequence entries (including fungi and algae), part 2249.
7055. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
7056. gbpln2250.seq - Plant sequence entries (including fungi and algae), part 2250.
7057. gbpln2251.seq - Plant sequence entries (including fungi and algae), part 2251.
7058. gbpln2252.seq - Plant sequence entries (including fungi and algae), part 2252.
7059. gbpln2253.seq - Plant sequence entries (including fungi and algae), part 2253.
7060. gbpln2254.seq - Plant sequence entries (including fungi and algae), part 2254.
7061. gbpln2255.seq - Plant sequence entries (including fungi and algae), part 2255.
7062. gbpln2256.seq - Plant sequence entries (including fungi and algae), part 2256.
7063. gbpln2257.seq - Plant sequence entries (including fungi and algae), part 2257.
7064. gbpln2258.seq - Plant sequence entries (including fungi and algae), part 2258.
7065. gbpln2259.seq - Plant sequence entries (including fungi and algae), part 2259.
7066. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
7067. gbpln2260.seq - Plant sequence entries (including fungi and algae), part 2260.
7068. gbpln2261.seq - Plant sequence entries (including fungi and algae), part 2261.
7069. gbpln2262.seq - Plant sequence entries (including fungi and algae), part 2262.
7070. gbpln2263.seq - Plant sequence entries (including fungi and algae), part 2263.
7071. gbpln2264.seq - Plant sequence entries (including fungi and algae), part 2264.
7072. gbpln2265.seq - Plant sequence entries (including fungi and algae), part 2265.
7073. gbpln2266.seq - Plant sequence entries (including fungi and algae), part 2266.
7074. gbpln2267.seq - Plant sequence entries (including fungi and algae), part 2267.
7075. gbpln2268.seq - Plant sequence entries (including fungi and algae), part 2268.
7076. gbpln2269.seq - Plant sequence entries (including fungi and algae), part 2269.
7077. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
7078. gbpln2270.seq - Plant sequence entries (including fungi and algae), part 2270.
7079. gbpln2271.seq - Plant sequence entries (including fungi and algae), part 2271.
7080. gbpln2272.seq - Plant sequence entries (including fungi and algae), part 2272.
7081. gbpln2273.seq - Plant sequence entries (including fungi and algae), part 2273.
7082. gbpln2274.seq - Plant sequence entries (including fungi and algae), part 2274.
7083. gbpln2275.seq - Plant sequence entries (including fungi and algae), part 2275.
7084. gbpln2276.seq - Plant sequence entries (including fungi and algae), part 2276.
7085. gbpln2277.seq - Plant sequence entries (including fungi and algae), part 2277.
7086. gbpln2278.seq - Plant sequence entries (including fungi and algae), part 2278.
7087. gbpln2279.seq - Plant sequence entries (including fungi and algae), part 2279.
7088. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
7089. gbpln2280.seq - Plant sequence entries (including fungi and algae), part 2280.
7090. gbpln2281.seq - Plant sequence entries (including fungi and algae), part 2281.
7091. gbpln2282.seq - Plant sequence entries (including fungi and algae), part 2282.
7092. gbpln2283.seq - Plant sequence entries (including fungi and algae), part 2283.
7093. gbpln2284.seq - Plant sequence entries (including fungi and algae), part 2284.
7094. gbpln2285.seq - Plant sequence entries (including fungi and algae), part 2285.
7095. gbpln2286.seq - Plant sequence entries (including fungi and algae), part 2286.
7096. gbpln2287.seq - Plant sequence entries (including fungi and algae), part 2287.
7097. gbpln2288.seq - Plant sequence entries (including fungi and algae), part 2288.
7098. gbpln2289.seq - Plant sequence entries (including fungi and algae), part 2289.
7099. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
7100. gbpln2290.seq - Plant sequence entries (including fungi and algae), part 2290.
7101. gbpln2291.seq - Plant sequence entries (including fungi and algae), part 2291.
7102. gbpln2292.seq - Plant sequence entries (including fungi and algae), part 2292.
7103. gbpln2293.seq - Plant sequence entries (including fungi and algae), part 2293.
7104. gbpln2294.seq - Plant sequence entries (including fungi and algae), part 2294.
7105. gbpln2295.seq - Plant sequence entries (including fungi and algae), part 2295.
7106. gbpln2296.seq - Plant sequence entries (including fungi and algae), part 2296.
7107. gbpln2297.seq - Plant sequence entries (including fungi and algae), part 2297.
7108. gbpln2298.seq - Plant sequence entries (including fungi and algae), part 2298.
7109. gbpln2299.seq - Plant sequence entries (including fungi and algae), part 2299.
7110. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
7111. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
7112. gbpln2300.seq - Plant sequence entries (including fungi and algae), part 2300.
7113. gbpln2301.seq - Plant sequence entries (including fungi and algae), part 2301.
7114. gbpln2302.seq - Plant sequence entries (including fungi and algae), part 2302.
7115. gbpln2303.seq - Plant sequence entries (including fungi and algae), part 2303.
7116. gbpln2304.seq - Plant sequence entries (including fungi and algae), part 2304.
7117. gbpln2305.seq - Plant sequence entries (including fungi and algae), part 2305.
7118. gbpln2306.seq - Plant sequence entries (including fungi and algae), part 2306.
7119. gbpln2307.seq - Plant sequence entries (including fungi and algae), part 2307.
7120. gbpln2308.seq - Plant sequence entries (including fungi and algae), part 2308.
7121. gbpln2309.seq - Plant sequence entries (including fungi and algae), part 2309.
7122. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
7123. gbpln2310.seq - Plant sequence entries (including fungi and algae), part 2310.
7124. gbpln2311.seq - Plant sequence entries (including fungi and algae), part 2311.
7125. gbpln2312.seq - Plant sequence entries (including fungi and algae), part 2312.
7126. gbpln2313.seq - Plant sequence entries (including fungi and algae), part 2313.
7127. gbpln2314.seq - Plant sequence entries (including fungi and algae), part 2314.
7128. gbpln2315.seq - Plant sequence entries (including fungi and algae), part 2315.
7129. gbpln2316.seq - Plant sequence entries (including fungi and algae), part 2316.
7130. gbpln2317.seq - Plant sequence entries (including fungi and algae), part 2317.
7131. gbpln2318.seq - Plant sequence entries (including fungi and algae), part 2318.
7132. gbpln2319.seq - Plant sequence entries (including fungi and algae), part 2319.
7133. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
7134. gbpln2320.seq - Plant sequence entries (including fungi and algae), part 2320.
7135. gbpln2321.seq - Plant sequence entries (including fungi and algae), part 2321.
7136. gbpln2322.seq - Plant sequence entries (including fungi and algae), part 2322.
7137. gbpln2323.seq - Plant sequence entries (including fungi and algae), part 2323.
7138. gbpln2324.seq - Plant sequence entries (including fungi and algae), part 2324.
7139. gbpln2325.seq - Plant sequence entries (including fungi and algae), part 2325.
7140. gbpln2326.seq - Plant sequence entries (including fungi and algae), part 2326.
7141. gbpln2327.seq - Plant sequence entries (including fungi and algae), part 2327.
7142. gbpln2328.seq - Plant sequence entries (including fungi and algae), part 2328.
7143. gbpln2329.seq - Plant sequence entries (including fungi and algae), part 2329.
7144. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
7145. gbpln2330.seq - Plant sequence entries (including fungi and algae), part 2330.
7146. gbpln2331.seq - Plant sequence entries (including fungi and algae), part 2331.
7147. gbpln2332.seq - Plant sequence entries (including fungi and algae), part 2332.
7148. gbpln2333.seq - Plant sequence entries (including fungi and algae), part 2333.
7149. gbpln2334.seq - Plant sequence entries (including fungi and algae), part 2334.
7150. gbpln2335.seq - Plant sequence entries (including fungi and algae), part 2335.
7151. gbpln2336.seq - Plant sequence entries (including fungi and algae), part 2336.
7152. gbpln2337.seq - Plant sequence entries (including fungi and algae), part 2337.
7153. gbpln2338.seq - Plant sequence entries (including fungi and algae), part 2338.
7154. gbpln2339.seq - Plant sequence entries (including fungi and algae), part 2339.
7155. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
7156. gbpln2340.seq - Plant sequence entries (including fungi and algae), part 2340.
7157. gbpln2341.seq - Plant sequence entries (including fungi and algae), part 2341.
7158. gbpln2342.seq - Plant sequence entries (including fungi and algae), part 2342.
7159. gbpln2343.seq - Plant sequence entries (including fungi and algae), part 2343.
7160. gbpln2344.seq - Plant sequence entries (including fungi and algae), part 2344.
7161. gbpln2345.seq - Plant sequence entries (including fungi and algae), part 2345.
7162. gbpln2346.seq - Plant sequence entries (including fungi and algae), part 2346.
7163. gbpln2347.seq - Plant sequence entries (including fungi and algae), part 2347.
7164. gbpln2348.seq - Plant sequence entries (including fungi and algae), part 2348.
7165. gbpln2349.seq - Plant sequence entries (including fungi and algae), part 2349.
7166. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
7167. gbpln2350.seq - Plant sequence entries (including fungi and algae), part 2350.
7168. gbpln2351.seq - Plant sequence entries (including fungi and algae), part 2351.
7169. gbpln2352.seq - Plant sequence entries (including fungi and algae), part 2352.
7170. gbpln2353.seq - Plant sequence entries (including fungi and algae), part 2353.
7171. gbpln2354.seq - Plant sequence entries (including fungi and algae), part 2354.
7172. gbpln2355.seq - Plant sequence entries (including fungi and algae), part 2355.
7173. gbpln2356.seq - Plant sequence entries (including fungi and algae), part 2356.
7174. gbpln2357.seq - Plant sequence entries (including fungi and algae), part 2357.
7175. gbpln2358.seq - Plant sequence entries (including fungi and algae), part 2358.
7176. gbpln2359.seq - Plant sequence entries (including fungi and algae), part 2359.
7177. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
7178. gbpln2360.seq - Plant sequence entries (including fungi and algae), part 2360.
7179. gbpln2361.seq - Plant sequence entries (including fungi and algae), part 2361.
7180. gbpln2362.seq - Plant sequence entries (including fungi and algae), part 2362.
7181. gbpln2363.seq - Plant sequence entries (including fungi and algae), part 2363.
7182. gbpln2364.seq - Plant sequence entries (including fungi and algae), part 2364.
7183. gbpln2365.seq - Plant sequence entries (including fungi and algae), part 2365.
7184. gbpln2366.seq - Plant sequence entries (including fungi and algae), part 2366.
7185. gbpln2367.seq - Plant sequence entries (including fungi and algae), part 2367.
7186. gbpln2368.seq - Plant sequence entries (including fungi and algae), part 2368.
7187. gbpln2369.seq - Plant sequence entries (including fungi and algae), part 2369.
7188. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
7189. gbpln2370.seq - Plant sequence entries (including fungi and algae), part 2370.
7190. gbpln2371.seq - Plant sequence entries (including fungi and algae), part 2371.
7191. gbpln2372.seq - Plant sequence entries (including fungi and algae), part 2372.
7192. gbpln2373.seq - Plant sequence entries (including fungi and algae), part 2373.
7193. gbpln2374.seq - Plant sequence entries (including fungi and algae), part 2374.
7194. gbpln2375.seq - Plant sequence entries (including fungi and algae), part 2375.
7195. gbpln2376.seq - Plant sequence entries (including fungi and algae), part 2376.
7196. gbpln2377.seq - Plant sequence entries (including fungi and algae), part 2377.
7197. gbpln2378.seq - Plant sequence entries (including fungi and algae), part 2378.
7198. gbpln2379.seq - Plant sequence entries (including fungi and algae), part 2379.
7199. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
7200. gbpln2380.seq - Plant sequence entries (including fungi and algae), part 2380.
7201. gbpln2381.seq - Plant sequence entries (including fungi and algae), part 2381.
7202. gbpln2382.seq - Plant sequence entries (including fungi and algae), part 2382.
7203. gbpln2383.seq - Plant sequence entries (including fungi and algae), part 2383.
7204. gbpln2384.seq - Plant sequence entries (including fungi and algae), part 2384.
7205. gbpln2385.seq - Plant sequence entries (including fungi and algae), part 2385.
7206. gbpln2386.seq - Plant sequence entries (including fungi and algae), part 2386.
7207. gbpln2387.seq - Plant sequence entries (including fungi and algae), part 2387.
7208. gbpln2388.seq - Plant sequence entries (including fungi and algae), part 2388.
7209. gbpln2389.seq - Plant sequence entries (including fungi and algae), part 2389.
7210. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
7211. gbpln2390.seq - Plant sequence entries (including fungi and algae), part 2390.
7212. gbpln2391.seq - Plant sequence entries (including fungi and algae), part 2391.
7213. gbpln2392.seq - Plant sequence entries (including fungi and algae), part 2392.
7214. gbpln2393.seq - Plant sequence entries (including fungi and algae), part 2393.
7215. gbpln2394.seq - Plant sequence entries (including fungi and algae), part 2394.
7216. gbpln2395.seq - Plant sequence entries (including fungi and algae), part 2395.
7217. gbpln2396.seq - Plant sequence entries (including fungi and algae), part 2396.
7218. gbpln2397.seq - Plant sequence entries (including fungi and algae), part 2397.
7219. gbpln2398.seq - Plant sequence entries (including fungi and algae), part 2398.
7220. gbpln2399.seq - Plant sequence entries (including fungi and algae), part 2399.
7221. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
7222. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
7223. gbpln2400.seq - Plant sequence entries (including fungi and algae), part 2400.
7224. gbpln2401.seq - Plant sequence entries (including fungi and algae), part 2401.
7225. gbpln2402.seq - Plant sequence entries (including fungi and algae), part 2402.
7226. gbpln2403.seq - Plant sequence entries (including fungi and algae), part 2403.
7227. gbpln2404.seq - Plant sequence entries (including fungi and algae), part 2404.
7228. gbpln2405.seq - Plant sequence entries (including fungi and algae), part 2405.
7229. gbpln2406.seq - Plant sequence entries (including fungi and algae), part 2406.
7230. gbpln2407.seq - Plant sequence entries (including fungi and algae), part 2407.
7231. gbpln2408.seq - Plant sequence entries (including fungi and algae), part 2408.
7232. gbpln2409.seq - Plant sequence entries (including fungi and algae), part 2409.
7233. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
7234. gbpln2410.seq - Plant sequence entries (including fungi and algae), part 2410.
7235. gbpln2411.seq - Plant sequence entries (including fungi and algae), part 2411.
7236. gbpln2412.seq - Plant sequence entries (including fungi and algae), part 2412.
7237. gbpln2413.seq - Plant sequence entries (including fungi and algae), part 2413.
7238. gbpln2414.seq - Plant sequence entries (including fungi and algae), part 2414.
7239. gbpln2415.seq - Plant sequence entries (including fungi and algae), part 2415.
7240. gbpln2416.seq - Plant sequence entries (including fungi and algae), part 2416.
7241. gbpln2417.seq - Plant sequence entries (including fungi and algae), part 2417.
7242. gbpln2418.seq - Plant sequence entries (including fungi and algae), part 2418.
7243. gbpln2419.seq - Plant sequence entries (including fungi and algae), part 2419.
7244. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
7245. gbpln2420.seq - Plant sequence entries (including fungi and algae), part 2420.
7246. gbpln2421.seq - Plant sequence entries (including fungi and algae), part 2421.
7247. gbpln2422.seq - Plant sequence entries (including fungi and algae), part 2422.
7248. gbpln2423.seq - Plant sequence entries (including fungi and algae), part 2423.
7249. gbpln2424.seq - Plant sequence entries (including fungi and algae), part 2424.
7250. gbpln2425.seq - Plant sequence entries (including fungi and algae), part 2425.
7251. gbpln2426.seq - Plant sequence entries (including fungi and algae), part 2426.
7252. gbpln2427.seq - Plant sequence entries (including fungi and algae), part 2427.
7253. gbpln2428.seq - Plant sequence entries (including fungi and algae), part 2428.
7254. gbpln2429.seq - Plant sequence entries (including fungi and algae), part 2429.
7255. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
7256. gbpln2430.seq - Plant sequence entries (including fungi and algae), part 2430.
7257. gbpln2431.seq - Plant sequence entries (including fungi and algae), part 2431.
7258. gbpln2432.seq - Plant sequence entries (including fungi and algae), part 2432.
7259. gbpln2433.seq - Plant sequence entries (including fungi and algae), part 2433.
7260. gbpln2434.seq - Plant sequence entries (including fungi and algae), part 2434.
7261. gbpln2435.seq - Plant sequence entries (including fungi and algae), part 2435.
7262. gbpln2436.seq - Plant sequence entries (including fungi and algae), part 2436.
7263. gbpln2437.seq - Plant sequence entries (including fungi and algae), part 2437.
7264. gbpln2438.seq - Plant sequence entries (including fungi and algae), part 2438.
7265. gbpln2439.seq - Plant sequence entries (including fungi and algae), part 2439.
7266. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
7267. gbpln2440.seq - Plant sequence entries (including fungi and algae), part 2440.
7268. gbpln2441.seq - Plant sequence entries (including fungi and algae), part 2441.
7269. gbpln2442.seq - Plant sequence entries (including fungi and algae), part 2442.
7270. gbpln2443.seq - Plant sequence entries (including fungi and algae), part 2443.
7271. gbpln2444.seq - Plant sequence entries (including fungi and algae), part 2444.
7272. gbpln2445.seq - Plant sequence entries (including fungi and algae), part 2445.
7273. gbpln2446.seq - Plant sequence entries (including fungi and algae), part 2446.
7274. gbpln2447.seq - Plant sequence entries (including fungi and algae), part 2447.
7275. gbpln2448.seq - Plant sequence entries (including fungi and algae), part 2448.
7276. gbpln2449.seq - Plant sequence entries (including fungi and algae), part 2449.
7277. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
7278. gbpln2450.seq - Plant sequence entries (including fungi and algae), part 2450.
7279. gbpln2451.seq - Plant sequence entries (including fungi and algae), part 2451.
7280. gbpln2452.seq - Plant sequence entries (including fungi and algae), part 2452.
7281. gbpln2453.seq - Plant sequence entries (including fungi and algae), part 2453.
7282. gbpln2454.seq - Plant sequence entries (including fungi and algae), part 2454.
7283. gbpln2455.seq - Plant sequence entries (including fungi and algae), part 2455.
7284. gbpln2456.seq - Plant sequence entries (including fungi and algae), part 2456.
7285. gbpln2457.seq - Plant sequence entries (including fungi and algae), part 2457.
7286. gbpln2458.seq - Plant sequence entries (including fungi and algae), part 2458.
7287. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
7288. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
7289. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
7290. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
7291. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
7292. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
7293. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
7294. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
7295. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
7296. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
7297. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
7298. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
7299. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
7300. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
7301. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
7302. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
7303. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
7304. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
7305. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
7306. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
7307. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
7308. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
7309. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
7310. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
7311. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
7312. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
7313. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
7314. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
7315. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
7316. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
7317. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
7318. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
7319. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
7320. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
7321. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
7322. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
7323. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
7324. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
7325. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
7326. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
7327. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
7328. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
7329. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
7330. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
7331. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
7332. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
7333. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
7334. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
7335. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
7336. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
7337. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
7338. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
7339. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
7340. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
7341. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
7342. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
7343. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
7344. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
7345. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
7346. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
7347. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
7348. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
7349. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
7350. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
7351. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
7352. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
7353. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
7354. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
7355. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
7356. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
7357. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
7358. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
7359. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
7360. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
7361. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
7362. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
7363. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
7364. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
7365. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
7366. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
7367. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
7368. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
7369. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
7370. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
7371. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
7372. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
7373. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
7374. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
7375. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
7376. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
7377. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
7378. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
7379. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
7380. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
7381. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
7382. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
7383. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
7384. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
7385. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
7386. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
7387. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
7388. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
7389. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
7390. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
7391. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
7392. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
7393. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
7394. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
7395. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
7396. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
7397. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
7398. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
7399. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
7400. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
7401. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
7402. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
7403. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
7404. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
7405. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
7406. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
7407. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
7408. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
7409. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
7410. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
7411. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
7412. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
7413. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
7414. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
7415. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
7416. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
7417. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
7418. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
7419. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
7420. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
7421. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
7422. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
7423. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
7424. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
7425. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
7426. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
7427. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
7428. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
7429. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
7430. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
7431. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
7432. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
7433. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
7434. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
7435. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
7436. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
7437. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
7438. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
7439. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
7440. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
7441. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
7442. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
7443. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
7444. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
7445. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
7446. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
7447. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
7448. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
7449. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
7450. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
7451. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
7452. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
7453. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
7454. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
7455. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
7456. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
7457. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
7458. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
7459. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
7460. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
7461. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
7462. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
7463. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
7464. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
7465. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
7466. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
7467. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
7468. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
7469. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
7470. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
7471. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
7472. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
7473. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
7474. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
7475. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
7476. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
7477. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
7478. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
7479. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
7480. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
7481. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
7482. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
7483. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
7484. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
7485. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
7486. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
7487. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
7488. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
7489. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
7490. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
7491. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
7492. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
7493. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
7494. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
7495. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
7496. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
7497. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
7498. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
7499. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
7500. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
7501. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
7502. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
7503. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
7504. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
7505. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
7506. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
7507. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
7508. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
7509. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
7510. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
7511. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
7512. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
7513. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
7514. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
7515. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
7516. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
7517. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
7518. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
7519. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
7520. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
7521. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
7522. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
7523. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
7524. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
7525. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
7526. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
7527. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
7528. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
7529. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
7530. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
7531. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
7532. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
7533. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
7534. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
7535. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
7536. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
7537. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
7538. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
7539. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
7540. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
7541. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
7542. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
7543. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
7544. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
7545. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
7546. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
7547. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
7548. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
7549. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
7550. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
7551. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
7552. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
7553. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
7554. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
7555. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
7556. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
7557. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
7558. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
7559. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
7560. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
7561. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
7562. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
7563. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
7564. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
7565. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
7566. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
7567. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
7568. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
7569. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
7570. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
7571. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
7572. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
7573. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
7574. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
7575. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
7576. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
7577. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
7578. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
7579. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
7580. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
7581. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
7582. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
7583. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
7584. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
7585. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
7586. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
7587. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
7588. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
7589. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
7590. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
7591. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
7592. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
7593. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
7594. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
7595. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
7596. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
7597. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
7598. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
7599. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
7600. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
7601. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
7602. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
7603. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
7604. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
7605. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
7606. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
7607. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
7608. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
7609. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
7610. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
7611. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
7612. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
7613. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
7614. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
7615. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
7616. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
7617. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
7618. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
7619. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
7620. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
7621. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
7622. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
7623. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
7624. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
7625. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
7626. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
7627. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
7628. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
7629. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
7630. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
7631. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
7632. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
7633. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
7634. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
7635. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
7636. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
7637. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
7638. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
7639. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
7640. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
7641. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
7642. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
7643. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
7644. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
7645. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
7646. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
7647. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
7648. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
7649. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
7650. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
7651. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
7652. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
7653. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
7654. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
7655. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
7656. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
7657. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
7658. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
7659. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
7660. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
7661. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
7662. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
7663. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
7664. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
7665. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
7666. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
7667. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
7668. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
7669. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
7670. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
7671. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
7672. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
7673. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
7674. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
7675. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
7676. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
7677. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
7678. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
7679. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
7680. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
7681. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
7682. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
7683. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
7684. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
7685. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
7686. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
7687. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
7688. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
7689. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
7690. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
7691. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
7692. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
7693. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
7694. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
7695. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
7696. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
7697. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
7698. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
7699. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
7700. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
7701. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
7702. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
7703. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
7704. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
7705. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
7706. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
7707. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
7708. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
7709. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
7710. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
7711. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
7712. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
7713. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
7714. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
7715. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
7716. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
7717. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
7718. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
7719. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
7720. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
7721. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
7722. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
7723. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
7724. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
7725. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
7726. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
7727. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
7728. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
7729. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
7730. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
7731. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
7732. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
7733. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
7734. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
7735. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
7736. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
7737. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
7738. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
7739. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
7740. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
7741. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
7742. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
7743. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
7744. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
7745. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
7746. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
7747. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
7748. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
7749. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
7750. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
7751. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
7752. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
7753. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
7754. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
7755. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
7756. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
7757. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
7758. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
7759. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
7760. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
7761. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
7762. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
7763. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
7764. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
7765. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
7766. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
7767. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
7768. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
7769. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
7770. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
7771. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
7772. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
7773. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
7774. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
7775. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
7776. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
7777. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
7778. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
7779. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
7780. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
7781. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
7782. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
7783. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
7784. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
7785. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
7786. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
7787. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
7788. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
7789. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
7790. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
7791. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
7792. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
7793. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
7794. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
7795. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
7796. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
7797. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
7798. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
7799. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
7800. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
7801. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
7802. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
7803. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
7804. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
7805. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
7806. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
7807. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
7808. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
7809. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
7810. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
7811. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
7812. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
7813. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
7814. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
7815. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
7816. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
7817. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
7818. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
7819. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
7820. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
7821. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
7822. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
7823. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
7824. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
7825. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
7826. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
7827. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
7828. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
7829. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
7830. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
7831. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
7832. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
7833. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
7834. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
7835. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
7836. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
7837. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
7838. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
7839. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
7840. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
7841. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
7842. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
7843. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
7844. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
7845. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
7846. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
7847. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
7848. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
7849. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
7850. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
7851. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
7852. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
7853. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
7854. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
7855. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
7856. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
7857. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
7858. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
7859. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
7860. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
7861. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
7862. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
7863. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
7864. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
7865. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
7866. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
7867. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
7868. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
7869. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
7870. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
7871. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
7872. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
7873. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
7874. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
7875. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
7876. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
7877. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
7878. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
7879. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
7880. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
7881. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
7882. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
7883. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
7884. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
7885. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
7886. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
7887. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
7888. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
7889. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
7890. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
7891. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
7892. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
7893. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
7894. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
7895. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
7896. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
7897. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
7898. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
7899. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
7900. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
7901. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
7902. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
7903. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
7904. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
7905. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
7906. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
7907. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
7908. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
7909. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
7910. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
7911. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
7912. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
7913. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
7914. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
7915. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
7916. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
7917. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
7918. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
7919. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
7920. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
7921. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
7922. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
7923. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
7924. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
7925. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
7926. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
7927. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
7928. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
7929. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
7930. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
7931. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
7932. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
7933. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
7934. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
7935. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
7936. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
7937. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
7938. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
7939. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
7940. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
7941. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
7942. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
7943. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
7944. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
7945. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
7946. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
7947. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
7948. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
7949. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
7950. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
7951. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
7952. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
7953. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
7954. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
7955. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
7956. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
7957. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
7958. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
7959. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
7960. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
7961. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
7962. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
7963. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
7964. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
7965. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
7966. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
7967. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
7968. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
7969. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
7970. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
7971. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
7972. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
7973. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
7974. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
7975. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
7976. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
7977. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
7978. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
7979. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
7980. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
7981. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
7982. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
7983. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
7984. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
7985. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
7986. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
7987. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
7988. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
7989. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
7990. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
7991. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
7992. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
7993. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
7994. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
7995. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
7996. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
7997. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
7998. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
7999. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
8000. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
8001. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
8002. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
8003. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
8004. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
8005. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
8006. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
8007. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
8008. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
8009. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
8010. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
8011. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
8012. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
8013. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
8014. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
8015. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
8016. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
8017. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
8018. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
8019. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
8020. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
8021. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
8022. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
8023. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
8024. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
8025. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
8026. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
8027. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
8028. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
8029. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
8030. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
8031. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
8032. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
8033. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
8034. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
8035. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
8036. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
8037. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
8038. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
8039. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
8040. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
8041. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
8042. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
8043. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
8044. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
8045. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
8046. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
8047. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
8048. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
8049. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
8050. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
8051. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
8052. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
8053. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
8054. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
8055. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
8056. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
8057. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
8058. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
8059. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
8060. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
8061. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
8062. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
8063. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
8064. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
8065. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
8066. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
8067. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
8068. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
8069. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
8070. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
8071. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
8072. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
8073. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
8074. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
8075. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
8076. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
8077. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
8078. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
8079. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
8080. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
8081. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
8082. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
8083. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
8084. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
8085. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
8086. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
8087. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
8088. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
8089. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
8090. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
8091. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
8092. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
8093. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
8094. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
8095. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
8096. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
8097. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
8098. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
8099. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
8100. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
8101. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
8102. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
8103. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
8104. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
8105. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
8106. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
8107. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
8108. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
8109. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
8110. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
8111. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
8112. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
8113. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
8114. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
8115. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
8116. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
8117. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
8118. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
8119. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
8120. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
8121. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
8122. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
8123. gbpri1.seq - Primate sequence entries, part 1.
8124. gbpri10.seq - Primate sequence entries, part 10.
8125. gbpri11.seq - Primate sequence entries, part 11.
8126. gbpri12.seq - Primate sequence entries, part 12.
8127. gbpri13.seq - Primate sequence entries, part 13.
8128. gbpri14.seq - Primate sequence entries, part 14.
8129. gbpri15.seq - Primate sequence entries, part 15.
8130. gbpri16.seq - Primate sequence entries, part 16.
8131. gbpri17.seq - Primate sequence entries, part 17.
8132. gbpri18.seq - Primate sequence entries, part 18.
8133. gbpri19.seq - Primate sequence entries, part 19.
8134. gbpri2.seq - Primate sequence entries, part 2.
8135. gbpri20.seq - Primate sequence entries, part 20.
8136. gbpri21.seq - Primate sequence entries, part 21.
8137. gbpri22.seq - Primate sequence entries, part 22.
8138. gbpri23.seq - Primate sequence entries, part 23.
8139. gbpri24.seq - Primate sequence entries, part 24.
8140. gbpri25.seq - Primate sequence entries, part 25.
8141. gbpri26.seq - Primate sequence entries, part 26.
8142. gbpri27.seq - Primate sequence entries, part 27.
8143. gbpri28.seq - Primate sequence entries, part 28.
8144. gbpri29.seq - Primate sequence entries, part 29.
8145. gbpri3.seq - Primate sequence entries, part 3.
8146. gbpri30.seq - Primate sequence entries, part 30.
8147. gbpri31.seq - Primate sequence entries, part 31.
8148. gbpri32.seq - Primate sequence entries, part 32.
8149. gbpri33.seq - Primate sequence entries, part 33.
8150. gbpri34.seq - Primate sequence entries, part 34.
8151. gbpri35.seq - Primate sequence entries, part 35.
8152. gbpri36.seq - Primate sequence entries, part 36.
8153. gbpri37.seq - Primate sequence entries, part 37.
8154. gbpri38.seq - Primate sequence entries, part 38.
8155. gbpri39.seq - Primate sequence entries, part 39.
8156. gbpri4.seq - Primate sequence entries, part 4.
8157. gbpri40.seq - Primate sequence entries, part 40.
8158. gbpri41.seq - Primate sequence entries, part 41.
8159. gbpri42.seq - Primate sequence entries, part 42.
8160. gbpri43.seq - Primate sequence entries, part 43.
8161. gbpri44.seq - Primate sequence entries, part 44.
8162. gbpri45.seq - Primate sequence entries, part 45.
8163. gbpri46.seq - Primate sequence entries, part 46.
8164. gbpri47.seq - Primate sequence entries, part 47.
8165. gbpri48.seq - Primate sequence entries, part 48.
8166. gbpri49.seq - Primate sequence entries, part 49.
8167. gbpri5.seq - Primate sequence entries, part 5.
8168. gbpri50.seq - Primate sequence entries, part 50.
8169. gbpri51.seq - Primate sequence entries, part 51.
8170. gbpri52.seq - Primate sequence entries, part 52.
8171. gbpri53.seq - Primate sequence entries, part 53.
8172. gbpri54.seq - Primate sequence entries, part 54.
8173. gbpri55.seq - Primate sequence entries, part 55.
8174. gbpri56.seq - Primate sequence entries, part 56.
8175. gbpri57.seq - Primate sequence entries, part 57.
8176. gbpri58.seq - Primate sequence entries, part 58.
8177. gbpri59.seq - Primate sequence entries, part 59.
8178. gbpri6.seq - Primate sequence entries, part 6.
8179. gbpri60.seq - Primate sequence entries, part 60.
8180. gbpri61.seq - Primate sequence entries, part 61.
8181. gbpri62.seq - Primate sequence entries, part 62.
8182. gbpri63.seq - Primate sequence entries, part 63.
8183. gbpri64.seq - Primate sequence entries, part 64.
8184. gbpri65.seq - Primate sequence entries, part 65.
8185. gbpri66.seq - Primate sequence entries, part 66.
8186. gbpri67.seq - Primate sequence entries, part 67.
8187. gbpri68.seq - Primate sequence entries, part 68.
8188. gbpri69.seq - Primate sequence entries, part 69.
8189. gbpri7.seq - Primate sequence entries, part 7.
8190. gbpri70.seq - Primate sequence entries, part 70.
8191. gbpri71.seq - Primate sequence entries, part 71.
8192. gbpri72.seq - Primate sequence entries, part 72.
8193. gbpri73.seq - Primate sequence entries, part 73.
8194. gbpri74.seq - Primate sequence entries, part 74.
8195. gbpri75.seq - Primate sequence entries, part 75.
8196. gbpri76.seq - Primate sequence entries, part 76.
8197. gbpri77.seq - Primate sequence entries, part 77.
8198. gbpri78.seq - Primate sequence entries, part 78.
8199. gbpri79.seq - Primate sequence entries, part 79.
8200. gbpri8.seq - Primate sequence entries, part 8.
8201. gbpri80.seq - Primate sequence entries, part 80.
8202. gbpri81.seq - Primate sequence entries, part 81.
8203. gbpri82.seq - Primate sequence entries, part 82.
8204. gbpri83.seq - Primate sequence entries, part 83.
8205. gbpri84.seq - Primate sequence entries, part 84.
8206. gbpri85.seq - Primate sequence entries, part 85.
8207. gbpri86.seq - Primate sequence entries, part 86.
8208. gbpri87.seq - Primate sequence entries, part 87.
8209. gbpri9.seq - Primate sequence entries, part 9.
8210. gbrel.txt - Release notes (this document).
8211. gbrod1.seq - Rodent sequence entries, part 1.
8212. gbrod10.seq - Rodent sequence entries, part 10.
8213. gbrod100.seq - Rodent sequence entries, part 100.
8214. gbrod101.seq - Rodent sequence entries, part 101.
8215. gbrod102.seq - Rodent sequence entries, part 102.
8216. gbrod103.seq - Rodent sequence entries, part 103.
8217. gbrod104.seq - Rodent sequence entries, part 104.
8218. gbrod105.seq - Rodent sequence entries, part 105.
8219. gbrod106.seq - Rodent sequence entries, part 106.
8220. gbrod107.seq - Rodent sequence entries, part 107.
8221. gbrod108.seq - Rodent sequence entries, part 108.
8222. gbrod109.seq - Rodent sequence entries, part 109.
8223. gbrod11.seq - Rodent sequence entries, part 11.
8224. gbrod110.seq - Rodent sequence entries, part 110.
8225. gbrod111.seq - Rodent sequence entries, part 111.
8226. gbrod112.seq - Rodent sequence entries, part 112.
8227. gbrod113.seq - Rodent sequence entries, part 113.
8228. gbrod114.seq - Rodent sequence entries, part 114.
8229. gbrod115.seq - Rodent sequence entries, part 115.
8230. gbrod116.seq - Rodent sequence entries, part 116.
8231. gbrod117.seq - Rodent sequence entries, part 117.
8232. gbrod118.seq - Rodent sequence entries, part 118.
8233. gbrod119.seq - Rodent sequence entries, part 119.
8234. gbrod12.seq - Rodent sequence entries, part 12.
8235. gbrod120.seq - Rodent sequence entries, part 120.
8236. gbrod121.seq - Rodent sequence entries, part 121.
8237. gbrod122.seq - Rodent sequence entries, part 122.
8238. gbrod123.seq - Rodent sequence entries, part 123.
8239. gbrod124.seq - Rodent sequence entries, part 124.
8240. gbrod125.seq - Rodent sequence entries, part 125.
8241. gbrod126.seq - Rodent sequence entries, part 126.
8242. gbrod127.seq - Rodent sequence entries, part 127.
8243. gbrod128.seq - Rodent sequence entries, part 128.
8244. gbrod129.seq - Rodent sequence entries, part 129.
8245. gbrod13.seq - Rodent sequence entries, part 13.
8246. gbrod130.seq - Rodent sequence entries, part 130.
8247. gbrod131.seq - Rodent sequence entries, part 131.
8248. gbrod132.seq - Rodent sequence entries, part 132.
8249. gbrod133.seq - Rodent sequence entries, part 133.
8250. gbrod134.seq - Rodent sequence entries, part 134.
8251. gbrod135.seq - Rodent sequence entries, part 135.
8252. gbrod136.seq - Rodent sequence entries, part 136.
8253. gbrod137.seq - Rodent sequence entries, part 137.
8254. gbrod138.seq - Rodent sequence entries, part 138.
8255. gbrod139.seq - Rodent sequence entries, part 139.
8256. gbrod14.seq - Rodent sequence entries, part 14.
8257. gbrod140.seq - Rodent sequence entries, part 140.
8258. gbrod141.seq - Rodent sequence entries, part 141.
8259. gbrod142.seq - Rodent sequence entries, part 142.
8260. gbrod143.seq - Rodent sequence entries, part 143.
8261. gbrod144.seq - Rodent sequence entries, part 144.
8262. gbrod145.seq - Rodent sequence entries, part 145.
8263. gbrod146.seq - Rodent sequence entries, part 146.
8264. gbrod147.seq - Rodent sequence entries, part 147.
8265. gbrod148.seq - Rodent sequence entries, part 148.
8266. gbrod149.seq - Rodent sequence entries, part 149.
8267. gbrod15.seq - Rodent sequence entries, part 15.
8268. gbrod150.seq - Rodent sequence entries, part 150.
8269. gbrod151.seq - Rodent sequence entries, part 151.
8270. gbrod152.seq - Rodent sequence entries, part 152.
8271. gbrod153.seq - Rodent sequence entries, part 153.
8272. gbrod154.seq - Rodent sequence entries, part 154.
8273. gbrod155.seq - Rodent sequence entries, part 155.
8274. gbrod156.seq - Rodent sequence entries, part 156.
8275. gbrod157.seq - Rodent sequence entries, part 157.
8276. gbrod158.seq - Rodent sequence entries, part 158.
8277. gbrod159.seq - Rodent sequence entries, part 159.
8278. gbrod16.seq - Rodent sequence entries, part 16.
8279. gbrod160.seq - Rodent sequence entries, part 160.
8280. gbrod161.seq - Rodent sequence entries, part 161.
8281. gbrod162.seq - Rodent sequence entries, part 162.
8282. gbrod163.seq - Rodent sequence entries, part 163.
8283. gbrod164.seq - Rodent sequence entries, part 164.
8284. gbrod165.seq - Rodent sequence entries, part 165.
8285. gbrod166.seq - Rodent sequence entries, part 166.
8286. gbrod167.seq - Rodent sequence entries, part 167.
8287. gbrod168.seq - Rodent sequence entries, part 168.
8288. gbrod169.seq - Rodent sequence entries, part 169.
8289. gbrod17.seq - Rodent sequence entries, part 17.
8290. gbrod170.seq - Rodent sequence entries, part 170.
8291. gbrod171.seq - Rodent sequence entries, part 171.
8292. gbrod172.seq - Rodent sequence entries, part 172.
8293. gbrod173.seq - Rodent sequence entries, part 173.
8294. gbrod174.seq - Rodent sequence entries, part 174.
8295. gbrod175.seq - Rodent sequence entries, part 175.
8296. gbrod176.seq - Rodent sequence entries, part 176.
8297. gbrod177.seq - Rodent sequence entries, part 177.
8298. gbrod178.seq - Rodent sequence entries, part 178.
8299. gbrod179.seq - Rodent sequence entries, part 179.
8300. gbrod18.seq - Rodent sequence entries, part 18.
8301. gbrod180.seq - Rodent sequence entries, part 180.
8302. gbrod181.seq - Rodent sequence entries, part 181.
8303. gbrod182.seq - Rodent sequence entries, part 182.
8304. gbrod183.seq - Rodent sequence entries, part 183.
8305. gbrod184.seq - Rodent sequence entries, part 184.
8306. gbrod185.seq - Rodent sequence entries, part 185.
8307. gbrod186.seq - Rodent sequence entries, part 186.
8308. gbrod187.seq - Rodent sequence entries, part 187.
8309. gbrod188.seq - Rodent sequence entries, part 188.
8310. gbrod189.seq - Rodent sequence entries, part 189.
8311. gbrod19.seq - Rodent sequence entries, part 19.
8312. gbrod190.seq - Rodent sequence entries, part 190.
8313. gbrod191.seq - Rodent sequence entries, part 191.
8314. gbrod192.seq - Rodent sequence entries, part 192.
8315. gbrod193.seq - Rodent sequence entries, part 193.
8316. gbrod194.seq - Rodent sequence entries, part 194.
8317. gbrod195.seq - Rodent sequence entries, part 195.
8318. gbrod196.seq - Rodent sequence entries, part 196.
8319. gbrod197.seq - Rodent sequence entries, part 197.
8320. gbrod198.seq - Rodent sequence entries, part 198.
8321. gbrod199.seq - Rodent sequence entries, part 199.
8322. gbrod2.seq - Rodent sequence entries, part 2.
8323. gbrod20.seq - Rodent sequence entries, part 20.
8324. gbrod200.seq - Rodent sequence entries, part 200.
8325. gbrod201.seq - Rodent sequence entries, part 201.
8326. gbrod202.seq - Rodent sequence entries, part 202.
8327. gbrod203.seq - Rodent sequence entries, part 203.
8328. gbrod204.seq - Rodent sequence entries, part 204.
8329. gbrod205.seq - Rodent sequence entries, part 205.
8330. gbrod206.seq - Rodent sequence entries, part 206.
8331. gbrod207.seq - Rodent sequence entries, part 207.
8332. gbrod208.seq - Rodent sequence entries, part 208.
8333. gbrod209.seq - Rodent sequence entries, part 209.
8334. gbrod21.seq - Rodent sequence entries, part 21.
8335. gbrod210.seq - Rodent sequence entries, part 210.
8336. gbrod211.seq - Rodent sequence entries, part 211.
8337. gbrod212.seq - Rodent sequence entries, part 212.
8338. gbrod213.seq - Rodent sequence entries, part 213.
8339. gbrod214.seq - Rodent sequence entries, part 214.
8340. gbrod215.seq - Rodent sequence entries, part 215.
8341. gbrod216.seq - Rodent sequence entries, part 216.
8342. gbrod217.seq - Rodent sequence entries, part 217.
8343. gbrod218.seq - Rodent sequence entries, part 218.
8344. gbrod219.seq - Rodent sequence entries, part 219.
8345. gbrod22.seq - Rodent sequence entries, part 22.
8346. gbrod220.seq - Rodent sequence entries, part 220.
8347. gbrod221.seq - Rodent sequence entries, part 221.
8348. gbrod222.seq - Rodent sequence entries, part 222.
8349. gbrod223.seq - Rodent sequence entries, part 223.
8350. gbrod224.seq - Rodent sequence entries, part 224.
8351. gbrod225.seq - Rodent sequence entries, part 225.
8352. gbrod226.seq - Rodent sequence entries, part 226.
8353. gbrod227.seq - Rodent sequence entries, part 227.
8354. gbrod228.seq - Rodent sequence entries, part 228.
8355. gbrod229.seq - Rodent sequence entries, part 229.
8356. gbrod23.seq - Rodent sequence entries, part 23.
8357. gbrod230.seq - Rodent sequence entries, part 230.
8358. gbrod231.seq - Rodent sequence entries, part 231.
8359. gbrod232.seq - Rodent sequence entries, part 232.
8360. gbrod233.seq - Rodent sequence entries, part 233.
8361. gbrod234.seq - Rodent sequence entries, part 234.
8362. gbrod235.seq - Rodent sequence entries, part 235.
8363. gbrod236.seq - Rodent sequence entries, part 236.
8364. gbrod237.seq - Rodent sequence entries, part 237.
8365. gbrod238.seq - Rodent sequence entries, part 238.
8366. gbrod239.seq - Rodent sequence entries, part 239.
8367. gbrod24.seq - Rodent sequence entries, part 24.
8368. gbrod240.seq - Rodent sequence entries, part 240.
8369. gbrod241.seq - Rodent sequence entries, part 241.
8370. gbrod242.seq - Rodent sequence entries, part 242.
8371. gbrod243.seq - Rodent sequence entries, part 243.
8372. gbrod244.seq - Rodent sequence entries, part 244.
8373. gbrod245.seq - Rodent sequence entries, part 245.
8374. gbrod246.seq - Rodent sequence entries, part 246.
8375. gbrod247.seq - Rodent sequence entries, part 247.
8376. gbrod248.seq - Rodent sequence entries, part 248.
8377. gbrod249.seq - Rodent sequence entries, part 249.
8378. gbrod25.seq - Rodent sequence entries, part 25.
8379. gbrod250.seq - Rodent sequence entries, part 250.
8380. gbrod251.seq - Rodent sequence entries, part 251.
8381. gbrod252.seq - Rodent sequence entries, part 252.
8382. gbrod253.seq - Rodent sequence entries, part 253.
8383. gbrod254.seq - Rodent sequence entries, part 254.
8384. gbrod255.seq - Rodent sequence entries, part 255.
8385. gbrod256.seq - Rodent sequence entries, part 256.
8386. gbrod257.seq - Rodent sequence entries, part 257.
8387. gbrod258.seq - Rodent sequence entries, part 258.
8388. gbrod259.seq - Rodent sequence entries, part 259.
8389. gbrod26.seq - Rodent sequence entries, part 26.
8390. gbrod260.seq - Rodent sequence entries, part 260.
8391. gbrod261.seq - Rodent sequence entries, part 261.
8392. gbrod262.seq - Rodent sequence entries, part 262.
8393. gbrod263.seq - Rodent sequence entries, part 263.
8394. gbrod264.seq - Rodent sequence entries, part 264.
8395. gbrod265.seq - Rodent sequence entries, part 265.
8396. gbrod266.seq - Rodent sequence entries, part 266.
8397. gbrod267.seq - Rodent sequence entries, part 267.
8398. gbrod268.seq - Rodent sequence entries, part 268.
8399. gbrod269.seq - Rodent sequence entries, part 269.
8400. gbrod27.seq - Rodent sequence entries, part 27.
8401. gbrod270.seq - Rodent sequence entries, part 270.
8402. gbrod271.seq - Rodent sequence entries, part 271.
8403. gbrod272.seq - Rodent sequence entries, part 272.
8404. gbrod273.seq - Rodent sequence entries, part 273.
8405. gbrod274.seq - Rodent sequence entries, part 274.
8406. gbrod275.seq - Rodent sequence entries, part 275.
8407. gbrod276.seq - Rodent sequence entries, part 276.
8408. gbrod277.seq - Rodent sequence entries, part 277.
8409. gbrod278.seq - Rodent sequence entries, part 278.
8410. gbrod279.seq - Rodent sequence entries, part 279.
8411. gbrod28.seq - Rodent sequence entries, part 28.
8412. gbrod280.seq - Rodent sequence entries, part 280.
8413. gbrod281.seq - Rodent sequence entries, part 281.
8414. gbrod282.seq - Rodent sequence entries, part 282.
8415. gbrod283.seq - Rodent sequence entries, part 283.
8416. gbrod284.seq - Rodent sequence entries, part 284.
8417. gbrod285.seq - Rodent sequence entries, part 285.
8418. gbrod286.seq - Rodent sequence entries, part 286.
8419. gbrod287.seq - Rodent sequence entries, part 287.
8420. gbrod288.seq - Rodent sequence entries, part 288.
8421. gbrod289.seq - Rodent sequence entries, part 289.
8422. gbrod29.seq - Rodent sequence entries, part 29.
8423. gbrod290.seq - Rodent sequence entries, part 290.
8424. gbrod291.seq - Rodent sequence entries, part 291.
8425. gbrod292.seq - Rodent sequence entries, part 292.
8426. gbrod293.seq - Rodent sequence entries, part 293.
8427. gbrod294.seq - Rodent sequence entries, part 294.
8428. gbrod295.seq - Rodent sequence entries, part 295.
8429. gbrod296.seq - Rodent sequence entries, part 296.
8430. gbrod297.seq - Rodent sequence entries, part 297.
8431. gbrod298.seq - Rodent sequence entries, part 298.
8432. gbrod299.seq - Rodent sequence entries, part 299.
8433. gbrod3.seq - Rodent sequence entries, part 3.
8434. gbrod30.seq - Rodent sequence entries, part 30.
8435. gbrod300.seq - Rodent sequence entries, part 300.
8436. gbrod301.seq - Rodent sequence entries, part 301.
8437. gbrod302.seq - Rodent sequence entries, part 302.
8438. gbrod303.seq - Rodent sequence entries, part 303.
8439. gbrod304.seq - Rodent sequence entries, part 304.
8440. gbrod305.seq - Rodent sequence entries, part 305.
8441. gbrod306.seq - Rodent sequence entries, part 306.
8442. gbrod307.seq - Rodent sequence entries, part 307.
8443. gbrod308.seq - Rodent sequence entries, part 308.
8444. gbrod309.seq - Rodent sequence entries, part 309.
8445. gbrod31.seq - Rodent sequence entries, part 31.
8446. gbrod310.seq - Rodent sequence entries, part 310.
8447. gbrod311.seq - Rodent sequence entries, part 311.
8448. gbrod312.seq - Rodent sequence entries, part 312.
8449. gbrod313.seq - Rodent sequence entries, part 313.
8450. gbrod314.seq - Rodent sequence entries, part 314.
8451. gbrod315.seq - Rodent sequence entries, part 315.
8452. gbrod316.seq - Rodent sequence entries, part 316.
8453. gbrod317.seq - Rodent sequence entries, part 317.
8454. gbrod318.seq - Rodent sequence entries, part 318.
8455. gbrod319.seq - Rodent sequence entries, part 319.
8456. gbrod32.seq - Rodent sequence entries, part 32.
8457. gbrod320.seq - Rodent sequence entries, part 320.
8458. gbrod321.seq - Rodent sequence entries, part 321.
8459. gbrod322.seq - Rodent sequence entries, part 322.
8460. gbrod323.seq - Rodent sequence entries, part 323.
8461. gbrod324.seq - Rodent sequence entries, part 324.
8462. gbrod325.seq - Rodent sequence entries, part 325.
8463. gbrod326.seq - Rodent sequence entries, part 326.
8464. gbrod327.seq - Rodent sequence entries, part 327.
8465. gbrod328.seq - Rodent sequence entries, part 328.
8466. gbrod329.seq - Rodent sequence entries, part 329.
8467. gbrod33.seq - Rodent sequence entries, part 33.
8468. gbrod330.seq - Rodent sequence entries, part 330.
8469. gbrod331.seq - Rodent sequence entries, part 331.
8470. gbrod332.seq - Rodent sequence entries, part 332.
8471. gbrod333.seq - Rodent sequence entries, part 333.
8472. gbrod334.seq - Rodent sequence entries, part 334.
8473. gbrod335.seq - Rodent sequence entries, part 335.
8474. gbrod336.seq - Rodent sequence entries, part 336.
8475. gbrod337.seq - Rodent sequence entries, part 337.
8476. gbrod338.seq - Rodent sequence entries, part 338.
8477. gbrod339.seq - Rodent sequence entries, part 339.
8478. gbrod34.seq - Rodent sequence entries, part 34.
8479. gbrod340.seq - Rodent sequence entries, part 340.
8480. gbrod341.seq - Rodent sequence entries, part 341.
8481. gbrod342.seq - Rodent sequence entries, part 342.
8482. gbrod343.seq - Rodent sequence entries, part 343.
8483. gbrod35.seq - Rodent sequence entries, part 35.
8484. gbrod36.seq - Rodent sequence entries, part 36.
8485. gbrod37.seq - Rodent sequence entries, part 37.
8486. gbrod38.seq - Rodent sequence entries, part 38.
8487. gbrod39.seq - Rodent sequence entries, part 39.
8488. gbrod4.seq - Rodent sequence entries, part 4.
8489. gbrod40.seq - Rodent sequence entries, part 40.
8490. gbrod41.seq - Rodent sequence entries, part 41.
8491. gbrod42.seq - Rodent sequence entries, part 42.
8492. gbrod43.seq - Rodent sequence entries, part 43.
8493. gbrod44.seq - Rodent sequence entries, part 44.
8494. gbrod45.seq - Rodent sequence entries, part 45.
8495. gbrod46.seq - Rodent sequence entries, part 46.
8496. gbrod47.seq - Rodent sequence entries, part 47.
8497. gbrod48.seq - Rodent sequence entries, part 48.
8498. gbrod49.seq - Rodent sequence entries, part 49.
8499. gbrod5.seq - Rodent sequence entries, part 5.
8500. gbrod50.seq - Rodent sequence entries, part 50.
8501. gbrod51.seq - Rodent sequence entries, part 51.
8502. gbrod52.seq - Rodent sequence entries, part 52.
8503. gbrod53.seq - Rodent sequence entries, part 53.
8504. gbrod54.seq - Rodent sequence entries, part 54.
8505. gbrod55.seq - Rodent sequence entries, part 55.
8506. gbrod56.seq - Rodent sequence entries, part 56.
8507. gbrod57.seq - Rodent sequence entries, part 57.
8508. gbrod58.seq - Rodent sequence entries, part 58.
8509. gbrod59.seq - Rodent sequence entries, part 59.
8510. gbrod6.seq - Rodent sequence entries, part 6.
8511. gbrod60.seq - Rodent sequence entries, part 60.
8512. gbrod61.seq - Rodent sequence entries, part 61.
8513. gbrod62.seq - Rodent sequence entries, part 62.
8514. gbrod63.seq - Rodent sequence entries, part 63.
8515. gbrod64.seq - Rodent sequence entries, part 64.
8516. gbrod65.seq - Rodent sequence entries, part 65.
8517. gbrod66.seq - Rodent sequence entries, part 66.
8518. gbrod67.seq - Rodent sequence entries, part 67.
8519. gbrod68.seq - Rodent sequence entries, part 68.
8520. gbrod69.seq - Rodent sequence entries, part 69.
8521. gbrod7.seq - Rodent sequence entries, part 7.
8522. gbrod70.seq - Rodent sequence entries, part 70.
8523. gbrod71.seq - Rodent sequence entries, part 71.
8524. gbrod72.seq - Rodent sequence entries, part 72.
8525. gbrod73.seq - Rodent sequence entries, part 73.
8526. gbrod74.seq - Rodent sequence entries, part 74.
8527. gbrod75.seq - Rodent sequence entries, part 75.
8528. gbrod76.seq - Rodent sequence entries, part 76.
8529. gbrod77.seq - Rodent sequence entries, part 77.
8530. gbrod78.seq - Rodent sequence entries, part 78.
8531. gbrod79.seq - Rodent sequence entries, part 79.
8532. gbrod8.seq - Rodent sequence entries, part 8.
8533. gbrod80.seq - Rodent sequence entries, part 80.
8534. gbrod81.seq - Rodent sequence entries, part 81.
8535. gbrod82.seq - Rodent sequence entries, part 82.
8536. gbrod83.seq - Rodent sequence entries, part 83.
8537. gbrod84.seq - Rodent sequence entries, part 84.
8538. gbrod85.seq - Rodent sequence entries, part 85.
8539. gbrod86.seq - Rodent sequence entries, part 86.
8540. gbrod87.seq - Rodent sequence entries, part 87.
8541. gbrod88.seq - Rodent sequence entries, part 88.
8542. gbrod89.seq - Rodent sequence entries, part 89.
8543. gbrod9.seq - Rodent sequence entries, part 9.
8544. gbrod90.seq - Rodent sequence entries, part 90.
8545. gbrod91.seq - Rodent sequence entries, part 91.
8546. gbrod92.seq - Rodent sequence entries, part 92.
8547. gbrod93.seq - Rodent sequence entries, part 93.
8548. gbrod94.seq - Rodent sequence entries, part 94.
8549. gbrod95.seq - Rodent sequence entries, part 95.
8550. gbrod96.seq - Rodent sequence entries, part 96.
8551. gbrod97.seq - Rodent sequence entries, part 97.
8552. gbrod98.seq - Rodent sequence entries, part 98.
8553. gbrod99.seq - Rodent sequence entries, part 99.
8554. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
8555. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
8556. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
8557. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
8558. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
8559. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
8560. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
8561. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
8562. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
8563. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
8564. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
8565. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
8566. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
8567. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
8568. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
8569. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
8570. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
8571. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
8572. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
8573. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
8574. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
8575. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
8576. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
8577. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
8578. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
8579. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
8580. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
8581. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
8582. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
8583. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
8584. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
8585. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
8586. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
8587. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
8588. gbsyn30.seq - Synthetic and chimeric sequence entries, part 30.
8589. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
8590. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
8591. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
8592. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
8593. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
8594. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
8595. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
8596. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
8597. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
8598. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
8599. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
8600. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
8601. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
8602. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
8603. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
8604. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
8605. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
8606. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
8607. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
8608. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
8609. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
8610. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
8611. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
8612. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
8613. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
8614. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
8615. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
8616. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
8617. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
8618. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
8619. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
8620. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
8621. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
8622. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
8623. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
8624. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
8625. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
8626. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
8627. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
8628. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
8629. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
8630. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
8631. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
8632. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
8633. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
8634. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
8635. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
8636. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
8637. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
8638. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
8639. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
8640. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
8641. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
8642. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
8643. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
8644. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
8645. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
8646. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
8647. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
8648. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
8649. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
8650. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
8651. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
8652. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
8653. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
8654. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
8655. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
8656. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
8657. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
8658. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
8659. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
8660. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
8661. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
8662. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
8663. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
8664. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
8665. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
8666. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
8667. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
8668. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
8669. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
8670. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
8671. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
8672. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
8673. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
8674. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
8675. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
8676. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
8677. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
8678. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
8679. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
8680. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
8681. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
8682. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
8683. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
8684. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
8685. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
8686. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
8687. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
8688. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
8689. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
8690. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
8691. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
8692. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
8693. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
8694. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
8695. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
8696. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
8697. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
8698. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
8699. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
8700. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
8701. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
8702. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
8703. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
8704. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
8705. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
8706. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
8707. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
8708. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
8709. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
8710. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
8711. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
8712. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
8713. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
8714. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
8715. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
8716. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
8717. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
8718. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
8719. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
8720. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
8721. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
8722. gbuna1.seq - Unannotated sequence entries, part 1.
8723. gbvrl1.seq - Viral sequence entries, part 1.
8724. gbvrl10.seq - Viral sequence entries, part 10.
8725. gbvrl100.seq - Viral sequence entries, part 100.
8726. gbvrl1000.seq - Viral sequence entries, part 1000.
8727. gbvrl1001.seq - Viral sequence entries, part 1001.
8728. gbvrl1002.seq - Viral sequence entries, part 1002.
8729. gbvrl1003.seq - Viral sequence entries, part 1003.
8730. gbvrl1004.seq - Viral sequence entries, part 1004.
8731. gbvrl1005.seq - Viral sequence entries, part 1005.
8732. gbvrl1006.seq - Viral sequence entries, part 1006.
8733. gbvrl1007.seq - Viral sequence entries, part 1007.
8734. gbvrl1008.seq - Viral sequence entries, part 1008.
8735. gbvrl1009.seq - Viral sequence entries, part 1009.
8736. gbvrl101.seq - Viral sequence entries, part 101.
8737. gbvrl1010.seq - Viral sequence entries, part 1010.
8738. gbvrl1011.seq - Viral sequence entries, part 1011.
8739. gbvrl1012.seq - Viral sequence entries, part 1012.
8740. gbvrl1013.seq - Viral sequence entries, part 1013.
8741. gbvrl1014.seq - Viral sequence entries, part 1014.
8742. gbvrl1015.seq - Viral sequence entries, part 1015.
8743. gbvrl1016.seq - Viral sequence entries, part 1016.
8744. gbvrl1017.seq - Viral sequence entries, part 1017.
8745. gbvrl1018.seq - Viral sequence entries, part 1018.
8746. gbvrl1019.seq - Viral sequence entries, part 1019.
8747. gbvrl102.seq - Viral sequence entries, part 102.
8748. gbvrl1020.seq - Viral sequence entries, part 1020.
8749. gbvrl1021.seq - Viral sequence entries, part 1021.
8750. gbvrl1022.seq - Viral sequence entries, part 1022.
8751. gbvrl1023.seq - Viral sequence entries, part 1023.
8752. gbvrl1024.seq - Viral sequence entries, part 1024.
8753. gbvrl1025.seq - Viral sequence entries, part 1025.
8754. gbvrl1026.seq - Viral sequence entries, part 1026.
8755. gbvrl1027.seq - Viral sequence entries, part 1027.
8756. gbvrl1028.seq - Viral sequence entries, part 1028.
8757. gbvrl1029.seq - Viral sequence entries, part 1029.
8758. gbvrl103.seq - Viral sequence entries, part 103.
8759. gbvrl1030.seq - Viral sequence entries, part 1030.
8760. gbvrl1031.seq - Viral sequence entries, part 1031.
8761. gbvrl1032.seq - Viral sequence entries, part 1032.
8762. gbvrl1033.seq - Viral sequence entries, part 1033.
8763. gbvrl1034.seq - Viral sequence entries, part 1034.
8764. gbvrl1035.seq - Viral sequence entries, part 1035.
8765. gbvrl1036.seq - Viral sequence entries, part 1036.
8766. gbvrl1037.seq - Viral sequence entries, part 1037.
8767. gbvrl1038.seq - Viral sequence entries, part 1038.
8768. gbvrl1039.seq - Viral sequence entries, part 1039.
8769. gbvrl104.seq - Viral sequence entries, part 104.
8770. gbvrl1040.seq - Viral sequence entries, part 1040.
8771. gbvrl1041.seq - Viral sequence entries, part 1041.
8772. gbvrl1042.seq - Viral sequence entries, part 1042.
8773. gbvrl1043.seq - Viral sequence entries, part 1043.
8774. gbvrl1044.seq - Viral sequence entries, part 1044.
8775. gbvrl1045.seq - Viral sequence entries, part 1045.
8776. gbvrl1046.seq - Viral sequence entries, part 1046.
8777. gbvrl1047.seq - Viral sequence entries, part 1047.
8778. gbvrl1048.seq - Viral sequence entries, part 1048.
8779. gbvrl1049.seq - Viral sequence entries, part 1049.
8780. gbvrl105.seq - Viral sequence entries, part 105.
8781. gbvrl1050.seq - Viral sequence entries, part 1050.
8782. gbvrl1051.seq - Viral sequence entries, part 1051.
8783. gbvrl1052.seq - Viral sequence entries, part 1052.
8784. gbvrl1053.seq - Viral sequence entries, part 1053.
8785. gbvrl1054.seq - Viral sequence entries, part 1054.
8786. gbvrl1055.seq - Viral sequence entries, part 1055.
8787. gbvrl1056.seq - Viral sequence entries, part 1056.
8788. gbvrl1057.seq - Viral sequence entries, part 1057.
8789. gbvrl1058.seq - Viral sequence entries, part 1058.
8790. gbvrl1059.seq - Viral sequence entries, part 1059.
8791. gbvrl106.seq - Viral sequence entries, part 106.
8792. gbvrl1060.seq - Viral sequence entries, part 1060.
8793. gbvrl1061.seq - Viral sequence entries, part 1061.
8794. gbvrl1062.seq - Viral sequence entries, part 1062.
8795. gbvrl1063.seq - Viral sequence entries, part 1063.
8796. gbvrl1064.seq - Viral sequence entries, part 1064.
8797. gbvrl1065.seq - Viral sequence entries, part 1065.
8798. gbvrl1066.seq - Viral sequence entries, part 1066.
8799. gbvrl1067.seq - Viral sequence entries, part 1067.
8800. gbvrl1068.seq - Viral sequence entries, part 1068.
8801. gbvrl1069.seq - Viral sequence entries, part 1069.
8802. gbvrl107.seq - Viral sequence entries, part 107.
8803. gbvrl1070.seq - Viral sequence entries, part 1070.
8804. gbvrl1071.seq - Viral sequence entries, part 1071.
8805. gbvrl1072.seq - Viral sequence entries, part 1072.
8806. gbvrl1073.seq - Viral sequence entries, part 1073.
8807. gbvrl1074.seq - Viral sequence entries, part 1074.
8808. gbvrl1075.seq - Viral sequence entries, part 1075.
8809. gbvrl1076.seq - Viral sequence entries, part 1076.
8810. gbvrl1077.seq - Viral sequence entries, part 1077.
8811. gbvrl1078.seq - Viral sequence entries, part 1078.
8812. gbvrl1079.seq - Viral sequence entries, part 1079.
8813. gbvrl108.seq - Viral sequence entries, part 108.
8814. gbvrl1080.seq - Viral sequence entries, part 1080.
8815. gbvrl1081.seq - Viral sequence entries, part 1081.
8816. gbvrl1082.seq - Viral sequence entries, part 1082.
8817. gbvrl1083.seq - Viral sequence entries, part 1083.
8818. gbvrl1084.seq - Viral sequence entries, part 1084.
8819. gbvrl1085.seq - Viral sequence entries, part 1085.
8820. gbvrl1086.seq - Viral sequence entries, part 1086.
8821. gbvrl1087.seq - Viral sequence entries, part 1087.
8822. gbvrl1088.seq - Viral sequence entries, part 1088.
8823. gbvrl1089.seq - Viral sequence entries, part 1089.
8824. gbvrl109.seq - Viral sequence entries, part 109.
8825. gbvrl1090.seq - Viral sequence entries, part 1090.
8826. gbvrl1091.seq - Viral sequence entries, part 1091.
8827. gbvrl1092.seq - Viral sequence entries, part 1092.
8828. gbvrl1093.seq - Viral sequence entries, part 1093.
8829. gbvrl1094.seq - Viral sequence entries, part 1094.
8830. gbvrl1095.seq - Viral sequence entries, part 1095.
8831. gbvrl11.seq - Viral sequence entries, part 11.
8832. gbvrl110.seq - Viral sequence entries, part 110.
8833. gbvrl111.seq - Viral sequence entries, part 111.
8834. gbvrl112.seq - Viral sequence entries, part 112.
8835. gbvrl113.seq - Viral sequence entries, part 113.
8836. gbvrl114.seq - Viral sequence entries, part 114.
8837. gbvrl115.seq - Viral sequence entries, part 115.
8838. gbvrl116.seq - Viral sequence entries, part 116.
8839. gbvrl117.seq - Viral sequence entries, part 117.
8840. gbvrl118.seq - Viral sequence entries, part 118.
8841. gbvrl119.seq - Viral sequence entries, part 119.
8842. gbvrl12.seq - Viral sequence entries, part 12.
8843. gbvrl120.seq - Viral sequence entries, part 120.
8844. gbvrl121.seq - Viral sequence entries, part 121.
8845. gbvrl122.seq - Viral sequence entries, part 122.
8846. gbvrl123.seq - Viral sequence entries, part 123.
8847. gbvrl124.seq - Viral sequence entries, part 124.
8848. gbvrl125.seq - Viral sequence entries, part 125.
8849. gbvrl126.seq - Viral sequence entries, part 126.
8850. gbvrl127.seq - Viral sequence entries, part 127.
8851. gbvrl128.seq - Viral sequence entries, part 128.
8852. gbvrl129.seq - Viral sequence entries, part 129.
8853. gbvrl13.seq - Viral sequence entries, part 13.
8854. gbvrl130.seq - Viral sequence entries, part 130.
8855. gbvrl131.seq - Viral sequence entries, part 131.
8856. gbvrl132.seq - Viral sequence entries, part 132.
8857. gbvrl133.seq - Viral sequence entries, part 133.
8858. gbvrl134.seq - Viral sequence entries, part 134.
8859. gbvrl135.seq - Viral sequence entries, part 135.
8860. gbvrl136.seq - Viral sequence entries, part 136.
8861. gbvrl137.seq - Viral sequence entries, part 137.
8862. gbvrl138.seq - Viral sequence entries, part 138.
8863. gbvrl139.seq - Viral sequence entries, part 139.
8864. gbvrl14.seq - Viral sequence entries, part 14.
8865. gbvrl140.seq - Viral sequence entries, part 140.
8866. gbvrl141.seq - Viral sequence entries, part 141.
8867. gbvrl142.seq - Viral sequence entries, part 142.
8868. gbvrl143.seq - Viral sequence entries, part 143.
8869. gbvrl144.seq - Viral sequence entries, part 144.
8870. gbvrl145.seq - Viral sequence entries, part 145.
8871. gbvrl146.seq - Viral sequence entries, part 146.
8872. gbvrl147.seq - Viral sequence entries, part 147.
8873. gbvrl148.seq - Viral sequence entries, part 148.
8874. gbvrl149.seq - Viral sequence entries, part 149.
8875. gbvrl15.seq - Viral sequence entries, part 15.
8876. gbvrl150.seq - Viral sequence entries, part 150.
8877. gbvrl151.seq - Viral sequence entries, part 151.
8878. gbvrl152.seq - Viral sequence entries, part 152.
8879. gbvrl153.seq - Viral sequence entries, part 153.
8880. gbvrl154.seq - Viral sequence entries, part 154.
8881. gbvrl155.seq - Viral sequence entries, part 155.
8882. gbvrl156.seq - Viral sequence entries, part 156.
8883. gbvrl157.seq - Viral sequence entries, part 157.
8884. gbvrl158.seq - Viral sequence entries, part 158.
8885. gbvrl159.seq - Viral sequence entries, part 159.
8886. gbvrl16.seq - Viral sequence entries, part 16.
8887. gbvrl160.seq - Viral sequence entries, part 160.
8888. gbvrl161.seq - Viral sequence entries, part 161.
8889. gbvrl162.seq - Viral sequence entries, part 162.
8890. gbvrl163.seq - Viral sequence entries, part 163.
8891. gbvrl164.seq - Viral sequence entries, part 164.
8892. gbvrl165.seq - Viral sequence entries, part 165.
8893. gbvrl166.seq - Viral sequence entries, part 166.
8894. gbvrl167.seq - Viral sequence entries, part 167.
8895. gbvrl168.seq - Viral sequence entries, part 168.
8896. gbvrl169.seq - Viral sequence entries, part 169.
8897. gbvrl17.seq - Viral sequence entries, part 17.
8898. gbvrl170.seq - Viral sequence entries, part 170.
8899. gbvrl171.seq - Viral sequence entries, part 171.
8900. gbvrl172.seq - Viral sequence entries, part 172.
8901. gbvrl173.seq - Viral sequence entries, part 173.
8902. gbvrl174.seq - Viral sequence entries, part 174.
8903. gbvrl175.seq - Viral sequence entries, part 175.
8904. gbvrl176.seq - Viral sequence entries, part 176.
8905. gbvrl177.seq - Viral sequence entries, part 177.
8906. gbvrl178.seq - Viral sequence entries, part 178.
8907. gbvrl179.seq - Viral sequence entries, part 179.
8908. gbvrl18.seq - Viral sequence entries, part 18.
8909. gbvrl180.seq - Viral sequence entries, part 180.
8910. gbvrl181.seq - Viral sequence entries, part 181.
8911. gbvrl182.seq - Viral sequence entries, part 182.
8912. gbvrl183.seq - Viral sequence entries, part 183.
8913. gbvrl184.seq - Viral sequence entries, part 184.
8914. gbvrl185.seq - Viral sequence entries, part 185.
8915. gbvrl186.seq - Viral sequence entries, part 186.
8916. gbvrl187.seq - Viral sequence entries, part 187.
8917. gbvrl188.seq - Viral sequence entries, part 188.
8918. gbvrl189.seq - Viral sequence entries, part 189.
8919. gbvrl19.seq - Viral sequence entries, part 19.
8920. gbvrl190.seq - Viral sequence entries, part 190.
8921. gbvrl191.seq - Viral sequence entries, part 191.
8922. gbvrl192.seq - Viral sequence entries, part 192.
8923. gbvrl193.seq - Viral sequence entries, part 193.
8924. gbvrl194.seq - Viral sequence entries, part 194.
8925. gbvrl195.seq - Viral sequence entries, part 195.
8926. gbvrl196.seq - Viral sequence entries, part 196.
8927. gbvrl197.seq - Viral sequence entries, part 197.
8928. gbvrl198.seq - Viral sequence entries, part 198.
8929. gbvrl199.seq - Viral sequence entries, part 199.
8930. gbvrl2.seq - Viral sequence entries, part 2.
8931. gbvrl20.seq - Viral sequence entries, part 20.
8932. gbvrl200.seq - Viral sequence entries, part 200.
8933. gbvrl201.seq - Viral sequence entries, part 201.
8934. gbvrl202.seq - Viral sequence entries, part 202.
8935. gbvrl203.seq - Viral sequence entries, part 203.
8936. gbvrl204.seq - Viral sequence entries, part 204.
8937. gbvrl205.seq - Viral sequence entries, part 205.
8938. gbvrl206.seq - Viral sequence entries, part 206.
8939. gbvrl207.seq - Viral sequence entries, part 207.
8940. gbvrl208.seq - Viral sequence entries, part 208.
8941. gbvrl209.seq - Viral sequence entries, part 209.
8942. gbvrl21.seq - Viral sequence entries, part 21.
8943. gbvrl210.seq - Viral sequence entries, part 210.
8944. gbvrl211.seq - Viral sequence entries, part 211.
8945. gbvrl212.seq - Viral sequence entries, part 212.
8946. gbvrl213.seq - Viral sequence entries, part 213.
8947. gbvrl214.seq - Viral sequence entries, part 214.
8948. gbvrl215.seq - Viral sequence entries, part 215.
8949. gbvrl216.seq - Viral sequence entries, part 216.
8950. gbvrl217.seq - Viral sequence entries, part 217.
8951. gbvrl218.seq - Viral sequence entries, part 218.
8952. gbvrl219.seq - Viral sequence entries, part 219.
8953. gbvrl22.seq - Viral sequence entries, part 22.
8954. gbvrl220.seq - Viral sequence entries, part 220.
8955. gbvrl221.seq - Viral sequence entries, part 221.
8956. gbvrl222.seq - Viral sequence entries, part 222.
8957. gbvrl223.seq - Viral sequence entries, part 223.
8958. gbvrl224.seq - Viral sequence entries, part 224.
8959. gbvrl225.seq - Viral sequence entries, part 225.
8960. gbvrl226.seq - Viral sequence entries, part 226.
8961. gbvrl227.seq - Viral sequence entries, part 227.
8962. gbvrl228.seq - Viral sequence entries, part 228.
8963. gbvrl229.seq - Viral sequence entries, part 229.
8964. gbvrl23.seq - Viral sequence entries, part 23.
8965. gbvrl230.seq - Viral sequence entries, part 230.
8966. gbvrl231.seq - Viral sequence entries, part 231.
8967. gbvrl232.seq - Viral sequence entries, part 232.
8968. gbvrl233.seq - Viral sequence entries, part 233.
8969. gbvrl234.seq - Viral sequence entries, part 234.
8970. gbvrl235.seq - Viral sequence entries, part 235.
8971. gbvrl236.seq - Viral sequence entries, part 236.
8972. gbvrl237.seq - Viral sequence entries, part 237.
8973. gbvrl238.seq - Viral sequence entries, part 238.
8974. gbvrl239.seq - Viral sequence entries, part 239.
8975. gbvrl24.seq - Viral sequence entries, part 24.
8976. gbvrl240.seq - Viral sequence entries, part 240.
8977. gbvrl241.seq - Viral sequence entries, part 241.
8978. gbvrl242.seq - Viral sequence entries, part 242.
8979. gbvrl243.seq - Viral sequence entries, part 243.
8980. gbvrl244.seq - Viral sequence entries, part 244.
8981. gbvrl245.seq - Viral sequence entries, part 245.
8982. gbvrl246.seq - Viral sequence entries, part 246.
8983. gbvrl247.seq - Viral sequence entries, part 247.
8984. gbvrl248.seq - Viral sequence entries, part 248.
8985. gbvrl249.seq - Viral sequence entries, part 249.
8986. gbvrl25.seq - Viral sequence entries, part 25.
8987. gbvrl250.seq - Viral sequence entries, part 250.
8988. gbvrl251.seq - Viral sequence entries, part 251.
8989. gbvrl252.seq - Viral sequence entries, part 252.
8990. gbvrl253.seq - Viral sequence entries, part 253.
8991. gbvrl254.seq - Viral sequence entries, part 254.
8992. gbvrl255.seq - Viral sequence entries, part 255.
8993. gbvrl256.seq - Viral sequence entries, part 256.
8994. gbvrl257.seq - Viral sequence entries, part 257.
8995. gbvrl258.seq - Viral sequence entries, part 258.
8996. gbvrl259.seq - Viral sequence entries, part 259.
8997. gbvrl26.seq - Viral sequence entries, part 26.
8998. gbvrl260.seq - Viral sequence entries, part 260.
8999. gbvrl261.seq - Viral sequence entries, part 261.
9000. gbvrl262.seq - Viral sequence entries, part 262.
9001. gbvrl263.seq - Viral sequence entries, part 263.
9002. gbvrl264.seq - Viral sequence entries, part 264.
9003. gbvrl265.seq - Viral sequence entries, part 265.
9004. gbvrl266.seq - Viral sequence entries, part 266.
9005. gbvrl267.seq - Viral sequence entries, part 267.
9006. gbvrl268.seq - Viral sequence entries, part 268.
9007. gbvrl269.seq - Viral sequence entries, part 269.
9008. gbvrl27.seq - Viral sequence entries, part 27.
9009. gbvrl270.seq - Viral sequence entries, part 270.
9010. gbvrl271.seq - Viral sequence entries, part 271.
9011. gbvrl272.seq - Viral sequence entries, part 272.
9012. gbvrl273.seq - Viral sequence entries, part 273.
9013. gbvrl274.seq - Viral sequence entries, part 274.
9014. gbvrl275.seq - Viral sequence entries, part 275.
9015. gbvrl276.seq - Viral sequence entries, part 276.
9016. gbvrl277.seq - Viral sequence entries, part 277.
9017. gbvrl278.seq - Viral sequence entries, part 278.
9018. gbvrl279.seq - Viral sequence entries, part 279.
9019. gbvrl28.seq - Viral sequence entries, part 28.
9020. gbvrl280.seq - Viral sequence entries, part 280.
9021. gbvrl281.seq - Viral sequence entries, part 281.
9022. gbvrl282.seq - Viral sequence entries, part 282.
9023. gbvrl283.seq - Viral sequence entries, part 283.
9024. gbvrl284.seq - Viral sequence entries, part 284.
9025. gbvrl285.seq - Viral sequence entries, part 285.
9026. gbvrl286.seq - Viral sequence entries, part 286.
9027. gbvrl287.seq - Viral sequence entries, part 287.
9028. gbvrl288.seq - Viral sequence entries, part 288.
9029. gbvrl289.seq - Viral sequence entries, part 289.
9030. gbvrl29.seq - Viral sequence entries, part 29.
9031. gbvrl290.seq - Viral sequence entries, part 290.
9032. gbvrl291.seq - Viral sequence entries, part 291.
9033. gbvrl292.seq - Viral sequence entries, part 292.
9034. gbvrl293.seq - Viral sequence entries, part 293.
9035. gbvrl294.seq - Viral sequence entries, part 294.
9036. gbvrl295.seq - Viral sequence entries, part 295.
9037. gbvrl296.seq - Viral sequence entries, part 296.
9038. gbvrl297.seq - Viral sequence entries, part 297.
9039. gbvrl298.seq - Viral sequence entries, part 298.
9040. gbvrl299.seq - Viral sequence entries, part 299.
9041. gbvrl3.seq - Viral sequence entries, part 3.
9042. gbvrl30.seq - Viral sequence entries, part 30.
9043. gbvrl300.seq - Viral sequence entries, part 300.
9044. gbvrl301.seq - Viral sequence entries, part 301.
9045. gbvrl302.seq - Viral sequence entries, part 302.
9046. gbvrl303.seq - Viral sequence entries, part 303.
9047. gbvrl304.seq - Viral sequence entries, part 304.
9048. gbvrl305.seq - Viral sequence entries, part 305.
9049. gbvrl306.seq - Viral sequence entries, part 306.
9050. gbvrl307.seq - Viral sequence entries, part 307.
9051. gbvrl308.seq - Viral sequence entries, part 308.
9052. gbvrl309.seq - Viral sequence entries, part 309.
9053. gbvrl31.seq - Viral sequence entries, part 31.
9054. gbvrl310.seq - Viral sequence entries, part 310.
9055. gbvrl311.seq - Viral sequence entries, part 311.
9056. gbvrl312.seq - Viral sequence entries, part 312.
9057. gbvrl313.seq - Viral sequence entries, part 313.
9058. gbvrl314.seq - Viral sequence entries, part 314.
9059. gbvrl315.seq - Viral sequence entries, part 315.
9060. gbvrl316.seq - Viral sequence entries, part 316.
9061. gbvrl317.seq - Viral sequence entries, part 317.
9062. gbvrl318.seq - Viral sequence entries, part 318.
9063. gbvrl319.seq - Viral sequence entries, part 319.
9064. gbvrl32.seq - Viral sequence entries, part 32.
9065. gbvrl320.seq - Viral sequence entries, part 320.
9066. gbvrl321.seq - Viral sequence entries, part 321.
9067. gbvrl322.seq - Viral sequence entries, part 322.
9068. gbvrl323.seq - Viral sequence entries, part 323.
9069. gbvrl324.seq - Viral sequence entries, part 324.
9070. gbvrl325.seq - Viral sequence entries, part 325.
9071. gbvrl326.seq - Viral sequence entries, part 326.
9072. gbvrl327.seq - Viral sequence entries, part 327.
9073. gbvrl328.seq - Viral sequence entries, part 328.
9074. gbvrl329.seq - Viral sequence entries, part 329.
9075. gbvrl33.seq - Viral sequence entries, part 33.
9076. gbvrl330.seq - Viral sequence entries, part 330.
9077. gbvrl331.seq - Viral sequence entries, part 331.
9078. gbvrl332.seq - Viral sequence entries, part 332.
9079. gbvrl333.seq - Viral sequence entries, part 333.
9080. gbvrl334.seq - Viral sequence entries, part 334.
9081. gbvrl335.seq - Viral sequence entries, part 335.
9082. gbvrl336.seq - Viral sequence entries, part 336.
9083. gbvrl337.seq - Viral sequence entries, part 337.
9084. gbvrl338.seq - Viral sequence entries, part 338.
9085. gbvrl339.seq - Viral sequence entries, part 339.
9086. gbvrl34.seq - Viral sequence entries, part 34.
9087. gbvrl340.seq - Viral sequence entries, part 340.
9088. gbvrl341.seq - Viral sequence entries, part 341.
9089. gbvrl342.seq - Viral sequence entries, part 342.
9090. gbvrl343.seq - Viral sequence entries, part 343.
9091. gbvrl344.seq - Viral sequence entries, part 344.
9092. gbvrl345.seq - Viral sequence entries, part 345.
9093. gbvrl346.seq - Viral sequence entries, part 346.
9094. gbvrl347.seq - Viral sequence entries, part 347.
9095. gbvrl348.seq - Viral sequence entries, part 348.
9096. gbvrl349.seq - Viral sequence entries, part 349.
9097. gbvrl35.seq - Viral sequence entries, part 35.
9098. gbvrl350.seq - Viral sequence entries, part 350.
9099. gbvrl351.seq - Viral sequence entries, part 351.
9100. gbvrl352.seq - Viral sequence entries, part 352.
9101. gbvrl353.seq - Viral sequence entries, part 353.
9102. gbvrl354.seq - Viral sequence entries, part 354.
9103. gbvrl355.seq - Viral sequence entries, part 355.
9104. gbvrl356.seq - Viral sequence entries, part 356.
9105. gbvrl357.seq - Viral sequence entries, part 357.
9106. gbvrl358.seq - Viral sequence entries, part 358.
9107. gbvrl359.seq - Viral sequence entries, part 359.
9108. gbvrl36.seq - Viral sequence entries, part 36.
9109. gbvrl360.seq - Viral sequence entries, part 360.
9110. gbvrl361.seq - Viral sequence entries, part 361.
9111. gbvrl362.seq - Viral sequence entries, part 362.
9112. gbvrl363.seq - Viral sequence entries, part 363.
9113. gbvrl364.seq - Viral sequence entries, part 364.
9114. gbvrl365.seq - Viral sequence entries, part 365.
9115. gbvrl366.seq - Viral sequence entries, part 366.
9116. gbvrl367.seq - Viral sequence entries, part 367.
9117. gbvrl368.seq - Viral sequence entries, part 368.
9118. gbvrl369.seq - Viral sequence entries, part 369.
9119. gbvrl37.seq - Viral sequence entries, part 37.
9120. gbvrl370.seq - Viral sequence entries, part 370.
9121. gbvrl371.seq - Viral sequence entries, part 371.
9122. gbvrl372.seq - Viral sequence entries, part 372.
9123. gbvrl373.seq - Viral sequence entries, part 373.
9124. gbvrl374.seq - Viral sequence entries, part 374.
9125. gbvrl375.seq - Viral sequence entries, part 375.
9126. gbvrl376.seq - Viral sequence entries, part 376.
9127. gbvrl377.seq - Viral sequence entries, part 377.
9128. gbvrl378.seq - Viral sequence entries, part 378.
9129. gbvrl379.seq - Viral sequence entries, part 379.
9130. gbvrl38.seq - Viral sequence entries, part 38.
9131. gbvrl380.seq - Viral sequence entries, part 380.
9132. gbvrl381.seq - Viral sequence entries, part 381.
9133. gbvrl382.seq - Viral sequence entries, part 382.
9134. gbvrl383.seq - Viral sequence entries, part 383.
9135. gbvrl384.seq - Viral sequence entries, part 384.
9136. gbvrl385.seq - Viral sequence entries, part 385.
9137. gbvrl386.seq - Viral sequence entries, part 386.
9138. gbvrl387.seq - Viral sequence entries, part 387.
9139. gbvrl388.seq - Viral sequence entries, part 388.
9140. gbvrl389.seq - Viral sequence entries, part 389.
9141. gbvrl39.seq - Viral sequence entries, part 39.
9142. gbvrl390.seq - Viral sequence entries, part 390.
9143. gbvrl391.seq - Viral sequence entries, part 391.
9144. gbvrl392.seq - Viral sequence entries, part 392.
9145. gbvrl393.seq - Viral sequence entries, part 393.
9146. gbvrl394.seq - Viral sequence entries, part 394.
9147. gbvrl395.seq - Viral sequence entries, part 395.
9148. gbvrl396.seq - Viral sequence entries, part 396.
9149. gbvrl397.seq - Viral sequence entries, part 397.
9150. gbvrl398.seq - Viral sequence entries, part 398.
9151. gbvrl399.seq - Viral sequence entries, part 399.
9152. gbvrl4.seq - Viral sequence entries, part 4.
9153. gbvrl40.seq - Viral sequence entries, part 40.
9154. gbvrl400.seq - Viral sequence entries, part 400.
9155. gbvrl401.seq - Viral sequence entries, part 401.
9156. gbvrl402.seq - Viral sequence entries, part 402.
9157. gbvrl403.seq - Viral sequence entries, part 403.
9158. gbvrl404.seq - Viral sequence entries, part 404.
9159. gbvrl405.seq - Viral sequence entries, part 405.
9160. gbvrl406.seq - Viral sequence entries, part 406.
9161. gbvrl407.seq - Viral sequence entries, part 407.
9162. gbvrl408.seq - Viral sequence entries, part 408.
9163. gbvrl409.seq - Viral sequence entries, part 409.
9164. gbvrl41.seq - Viral sequence entries, part 41.
9165. gbvrl410.seq - Viral sequence entries, part 410.
9166. gbvrl411.seq - Viral sequence entries, part 411.
9167. gbvrl412.seq - Viral sequence entries, part 412.
9168. gbvrl413.seq - Viral sequence entries, part 413.
9169. gbvrl414.seq - Viral sequence entries, part 414.
9170. gbvrl415.seq - Viral sequence entries, part 415.
9171. gbvrl416.seq - Viral sequence entries, part 416.
9172. gbvrl417.seq - Viral sequence entries, part 417.
9173. gbvrl418.seq - Viral sequence entries, part 418.
9174. gbvrl419.seq - Viral sequence entries, part 419.
9175. gbvrl42.seq - Viral sequence entries, part 42.
9176. gbvrl420.seq - Viral sequence entries, part 420.
9177. gbvrl421.seq - Viral sequence entries, part 421.
9178. gbvrl422.seq - Viral sequence entries, part 422.
9179. gbvrl423.seq - Viral sequence entries, part 423.
9180. gbvrl424.seq - Viral sequence entries, part 424.
9181. gbvrl425.seq - Viral sequence entries, part 425.
9182. gbvrl426.seq - Viral sequence entries, part 426.
9183. gbvrl427.seq - Viral sequence entries, part 427.
9184. gbvrl428.seq - Viral sequence entries, part 428.
9185. gbvrl429.seq - Viral sequence entries, part 429.
9186. gbvrl43.seq - Viral sequence entries, part 43.
9187. gbvrl430.seq - Viral sequence entries, part 430.
9188. gbvrl431.seq - Viral sequence entries, part 431.
9189. gbvrl432.seq - Viral sequence entries, part 432.
9190. gbvrl433.seq - Viral sequence entries, part 433.
9191. gbvrl434.seq - Viral sequence entries, part 434.
9192. gbvrl435.seq - Viral sequence entries, part 435.
9193. gbvrl436.seq - Viral sequence entries, part 436.
9194. gbvrl437.seq - Viral sequence entries, part 437.
9195. gbvrl438.seq - Viral sequence entries, part 438.
9196. gbvrl439.seq - Viral sequence entries, part 439.
9197. gbvrl44.seq - Viral sequence entries, part 44.
9198. gbvrl440.seq - Viral sequence entries, part 440.
9199. gbvrl441.seq - Viral sequence entries, part 441.
9200. gbvrl442.seq - Viral sequence entries, part 442.
9201. gbvrl443.seq - Viral sequence entries, part 443.
9202. gbvrl444.seq - Viral sequence entries, part 444.
9203. gbvrl445.seq - Viral sequence entries, part 445.
9204. gbvrl446.seq - Viral sequence entries, part 446.
9205. gbvrl447.seq - Viral sequence entries, part 447.
9206. gbvrl448.seq - Viral sequence entries, part 448.
9207. gbvrl449.seq - Viral sequence entries, part 449.
9208. gbvrl45.seq - Viral sequence entries, part 45.
9209. gbvrl450.seq - Viral sequence entries, part 450.
9210. gbvrl451.seq - Viral sequence entries, part 451.
9211. gbvrl452.seq - Viral sequence entries, part 452.
9212. gbvrl453.seq - Viral sequence entries, part 453.
9213. gbvrl454.seq - Viral sequence entries, part 454.
9214. gbvrl455.seq - Viral sequence entries, part 455.
9215. gbvrl456.seq - Viral sequence entries, part 456.
9216. gbvrl457.seq - Viral sequence entries, part 457.
9217. gbvrl458.seq - Viral sequence entries, part 458.
9218. gbvrl459.seq - Viral sequence entries, part 459.
9219. gbvrl46.seq - Viral sequence entries, part 46.
9220. gbvrl460.seq - Viral sequence entries, part 460.
9221. gbvrl461.seq - Viral sequence entries, part 461.
9222. gbvrl462.seq - Viral sequence entries, part 462.
9223. gbvrl463.seq - Viral sequence entries, part 463.
9224. gbvrl464.seq - Viral sequence entries, part 464.
9225. gbvrl465.seq - Viral sequence entries, part 465.
9226. gbvrl466.seq - Viral sequence entries, part 466.
9227. gbvrl467.seq - Viral sequence entries, part 467.
9228. gbvrl468.seq - Viral sequence entries, part 468.
9229. gbvrl469.seq - Viral sequence entries, part 469.
9230. gbvrl47.seq - Viral sequence entries, part 47.
9231. gbvrl470.seq - Viral sequence entries, part 470.
9232. gbvrl471.seq - Viral sequence entries, part 471.
9233. gbvrl472.seq - Viral sequence entries, part 472.
9234. gbvrl473.seq - Viral sequence entries, part 473.
9235. gbvrl474.seq - Viral sequence entries, part 474.
9236. gbvrl475.seq - Viral sequence entries, part 475.
9237. gbvrl476.seq - Viral sequence entries, part 476.
9238. gbvrl477.seq - Viral sequence entries, part 477.
9239. gbvrl478.seq - Viral sequence entries, part 478.
9240. gbvrl479.seq - Viral sequence entries, part 479.
9241. gbvrl48.seq - Viral sequence entries, part 48.
9242. gbvrl480.seq - Viral sequence entries, part 480.
9243. gbvrl481.seq - Viral sequence entries, part 481.
9244. gbvrl482.seq - Viral sequence entries, part 482.
9245. gbvrl483.seq - Viral sequence entries, part 483.
9246. gbvrl484.seq - Viral sequence entries, part 484.
9247. gbvrl485.seq - Viral sequence entries, part 485.
9248. gbvrl486.seq - Viral sequence entries, part 486.
9249. gbvrl487.seq - Viral sequence entries, part 487.
9250. gbvrl488.seq - Viral sequence entries, part 488.
9251. gbvrl489.seq - Viral sequence entries, part 489.
9252. gbvrl49.seq - Viral sequence entries, part 49.
9253. gbvrl490.seq - Viral sequence entries, part 490.
9254. gbvrl491.seq - Viral sequence entries, part 491.
9255. gbvrl492.seq - Viral sequence entries, part 492.
9256. gbvrl493.seq - Viral sequence entries, part 493.
9257. gbvrl494.seq - Viral sequence entries, part 494.
9258. gbvrl495.seq - Viral sequence entries, part 495.
9259. gbvrl496.seq - Viral sequence entries, part 496.
9260. gbvrl497.seq - Viral sequence entries, part 497.
9261. gbvrl498.seq - Viral sequence entries, part 498.
9262. gbvrl499.seq - Viral sequence entries, part 499.
9263. gbvrl5.seq - Viral sequence entries, part 5.
9264. gbvrl50.seq - Viral sequence entries, part 50.
9265. gbvrl500.seq - Viral sequence entries, part 500.
9266. gbvrl501.seq - Viral sequence entries, part 501.
9267. gbvrl502.seq - Viral sequence entries, part 502.
9268. gbvrl503.seq - Viral sequence entries, part 503.
9269. gbvrl504.seq - Viral sequence entries, part 504.
9270. gbvrl505.seq - Viral sequence entries, part 505.
9271. gbvrl506.seq - Viral sequence entries, part 506.
9272. gbvrl507.seq - Viral sequence entries, part 507.
9273. gbvrl508.seq - Viral sequence entries, part 508.
9274. gbvrl509.seq - Viral sequence entries, part 509.
9275. gbvrl51.seq - Viral sequence entries, part 51.
9276. gbvrl510.seq - Viral sequence entries, part 510.
9277. gbvrl511.seq - Viral sequence entries, part 511.
9278. gbvrl512.seq - Viral sequence entries, part 512.
9279. gbvrl513.seq - Viral sequence entries, part 513.
9280. gbvrl514.seq - Viral sequence entries, part 514.
9281. gbvrl515.seq - Viral sequence entries, part 515.
9282. gbvrl516.seq - Viral sequence entries, part 516.
9283. gbvrl517.seq - Viral sequence entries, part 517.
9284. gbvrl518.seq - Viral sequence entries, part 518.
9285. gbvrl519.seq - Viral sequence entries, part 519.
9286. gbvrl52.seq - Viral sequence entries, part 52.
9287. gbvrl520.seq - Viral sequence entries, part 520.
9288. gbvrl521.seq - Viral sequence entries, part 521.
9289. gbvrl522.seq - Viral sequence entries, part 522.
9290. gbvrl523.seq - Viral sequence entries, part 523.
9291. gbvrl524.seq - Viral sequence entries, part 524.
9292. gbvrl525.seq - Viral sequence entries, part 525.
9293. gbvrl526.seq - Viral sequence entries, part 526.
9294. gbvrl527.seq - Viral sequence entries, part 527.
9295. gbvrl528.seq - Viral sequence entries, part 528.
9296. gbvrl529.seq - Viral sequence entries, part 529.
9297. gbvrl53.seq - Viral sequence entries, part 53.
9298. gbvrl530.seq - Viral sequence entries, part 530.
9299. gbvrl531.seq - Viral sequence entries, part 531.
9300. gbvrl532.seq - Viral sequence entries, part 532.
9301. gbvrl533.seq - Viral sequence entries, part 533.
9302. gbvrl534.seq - Viral sequence entries, part 534.
9303. gbvrl535.seq - Viral sequence entries, part 535.
9304. gbvrl536.seq - Viral sequence entries, part 536.
9305. gbvrl537.seq - Viral sequence entries, part 537.
9306. gbvrl538.seq - Viral sequence entries, part 538.
9307. gbvrl539.seq - Viral sequence entries, part 539.
9308. gbvrl54.seq - Viral sequence entries, part 54.
9309. gbvrl540.seq - Viral sequence entries, part 540.
9310. gbvrl541.seq - Viral sequence entries, part 541.
9311. gbvrl542.seq - Viral sequence entries, part 542.
9312. gbvrl543.seq - Viral sequence entries, part 543.
9313. gbvrl544.seq - Viral sequence entries, part 544.
9314. gbvrl545.seq - Viral sequence entries, part 545.
9315. gbvrl546.seq - Viral sequence entries, part 546.
9316. gbvrl547.seq - Viral sequence entries, part 547.
9317. gbvrl548.seq - Viral sequence entries, part 548.
9318. gbvrl549.seq - Viral sequence entries, part 549.
9319. gbvrl55.seq - Viral sequence entries, part 55.
9320. gbvrl550.seq - Viral sequence entries, part 550.
9321. gbvrl551.seq - Viral sequence entries, part 551.
9322. gbvrl552.seq - Viral sequence entries, part 552.
9323. gbvrl553.seq - Viral sequence entries, part 553.
9324. gbvrl554.seq - Viral sequence entries, part 554.
9325. gbvrl555.seq - Viral sequence entries, part 555.
9326. gbvrl556.seq - Viral sequence entries, part 556.
9327. gbvrl557.seq - Viral sequence entries, part 557.
9328. gbvrl558.seq - Viral sequence entries, part 558.
9329. gbvrl559.seq - Viral sequence entries, part 559.
9330. gbvrl56.seq - Viral sequence entries, part 56.
9331. gbvrl560.seq - Viral sequence entries, part 560.
9332. gbvrl561.seq - Viral sequence entries, part 561.
9333. gbvrl562.seq - Viral sequence entries, part 562.
9334. gbvrl563.seq - Viral sequence entries, part 563.
9335. gbvrl564.seq - Viral sequence entries, part 564.
9336. gbvrl565.seq - Viral sequence entries, part 565.
9337. gbvrl566.seq - Viral sequence entries, part 566.
9338. gbvrl567.seq - Viral sequence entries, part 567.
9339. gbvrl568.seq - Viral sequence entries, part 568.
9340. gbvrl569.seq - Viral sequence entries, part 569.
9341. gbvrl57.seq - Viral sequence entries, part 57.
9342. gbvrl570.seq - Viral sequence entries, part 570.
9343. gbvrl571.seq - Viral sequence entries, part 571.
9344. gbvrl572.seq - Viral sequence entries, part 572.
9345. gbvrl573.seq - Viral sequence entries, part 573.
9346. gbvrl574.seq - Viral sequence entries, part 574.
9347. gbvrl575.seq - Viral sequence entries, part 575.
9348. gbvrl576.seq - Viral sequence entries, part 576.
9349. gbvrl577.seq - Viral sequence entries, part 577.
9350. gbvrl578.seq - Viral sequence entries, part 578.
9351. gbvrl579.seq - Viral sequence entries, part 579.
9352. gbvrl58.seq - Viral sequence entries, part 58.
9353. gbvrl580.seq - Viral sequence entries, part 580.
9354. gbvrl581.seq - Viral sequence entries, part 581.
9355. gbvrl582.seq - Viral sequence entries, part 582.
9356. gbvrl583.seq - Viral sequence entries, part 583.
9357. gbvrl584.seq - Viral sequence entries, part 584.
9358. gbvrl585.seq - Viral sequence entries, part 585.
9359. gbvrl586.seq - Viral sequence entries, part 586.
9360. gbvrl587.seq - Viral sequence entries, part 587.
9361. gbvrl588.seq - Viral sequence entries, part 588.
9362. gbvrl589.seq - Viral sequence entries, part 589.
9363. gbvrl59.seq - Viral sequence entries, part 59.
9364. gbvrl590.seq - Viral sequence entries, part 590.
9365. gbvrl591.seq - Viral sequence entries, part 591.
9366. gbvrl592.seq - Viral sequence entries, part 592.
9367. gbvrl593.seq - Viral sequence entries, part 593.
9368. gbvrl594.seq - Viral sequence entries, part 594.
9369. gbvrl595.seq - Viral sequence entries, part 595.
9370. gbvrl596.seq - Viral sequence entries, part 596.
9371. gbvrl597.seq - Viral sequence entries, part 597.
9372. gbvrl598.seq - Viral sequence entries, part 598.
9373. gbvrl599.seq - Viral sequence entries, part 599.
9374. gbvrl6.seq - Viral sequence entries, part 6.
9375. gbvrl60.seq - Viral sequence entries, part 60.
9376. gbvrl600.seq - Viral sequence entries, part 600.
9377. gbvrl601.seq - Viral sequence entries, part 601.
9378. gbvrl602.seq - Viral sequence entries, part 602.
9379. gbvrl603.seq - Viral sequence entries, part 603.
9380. gbvrl604.seq - Viral sequence entries, part 604.
9381. gbvrl605.seq - Viral sequence entries, part 605.
9382. gbvrl606.seq - Viral sequence entries, part 606.
9383. gbvrl607.seq - Viral sequence entries, part 607.
9384. gbvrl608.seq - Viral sequence entries, part 608.
9385. gbvrl609.seq - Viral sequence entries, part 609.
9386. gbvrl61.seq - Viral sequence entries, part 61.
9387. gbvrl610.seq - Viral sequence entries, part 610.
9388. gbvrl611.seq - Viral sequence entries, part 611.
9389. gbvrl612.seq - Viral sequence entries, part 612.
9390. gbvrl613.seq - Viral sequence entries, part 613.
9391. gbvrl614.seq - Viral sequence entries, part 614.
9392. gbvrl615.seq - Viral sequence entries, part 615.
9393. gbvrl616.seq - Viral sequence entries, part 616.
9394. gbvrl617.seq - Viral sequence entries, part 617.
9395. gbvrl618.seq - Viral sequence entries, part 618.
9396. gbvrl619.seq - Viral sequence entries, part 619.
9397. gbvrl62.seq - Viral sequence entries, part 62.
9398. gbvrl620.seq - Viral sequence entries, part 620.
9399. gbvrl621.seq - Viral sequence entries, part 621.
9400. gbvrl622.seq - Viral sequence entries, part 622.
9401. gbvrl623.seq - Viral sequence entries, part 623.
9402. gbvrl624.seq - Viral sequence entries, part 624.
9403. gbvrl625.seq - Viral sequence entries, part 625.
9404. gbvrl626.seq - Viral sequence entries, part 626.
9405. gbvrl627.seq - Viral sequence entries, part 627.
9406. gbvrl628.seq - Viral sequence entries, part 628.
9407. gbvrl629.seq - Viral sequence entries, part 629.
9408. gbvrl63.seq - Viral sequence entries, part 63.
9409. gbvrl630.seq - Viral sequence entries, part 630.
9410. gbvrl631.seq - Viral sequence entries, part 631.
9411. gbvrl632.seq - Viral sequence entries, part 632.
9412. gbvrl633.seq - Viral sequence entries, part 633.
9413. gbvrl634.seq - Viral sequence entries, part 634.
9414. gbvrl635.seq - Viral sequence entries, part 635.
9415. gbvrl636.seq - Viral sequence entries, part 636.
9416. gbvrl637.seq - Viral sequence entries, part 637.
9417. gbvrl638.seq - Viral sequence entries, part 638.
9418. gbvrl639.seq - Viral sequence entries, part 639.
9419. gbvrl64.seq - Viral sequence entries, part 64.
9420. gbvrl640.seq - Viral sequence entries, part 640.
9421. gbvrl641.seq - Viral sequence entries, part 641.
9422. gbvrl642.seq - Viral sequence entries, part 642.
9423. gbvrl643.seq - Viral sequence entries, part 643.
9424. gbvrl644.seq - Viral sequence entries, part 644.
9425. gbvrl645.seq - Viral sequence entries, part 645.
9426. gbvrl646.seq - Viral sequence entries, part 646.
9427. gbvrl647.seq - Viral sequence entries, part 647.
9428. gbvrl648.seq - Viral sequence entries, part 648.
9429. gbvrl649.seq - Viral sequence entries, part 649.
9430. gbvrl65.seq - Viral sequence entries, part 65.
9431. gbvrl650.seq - Viral sequence entries, part 650.
9432. gbvrl651.seq - Viral sequence entries, part 651.
9433. gbvrl652.seq - Viral sequence entries, part 652.
9434. gbvrl653.seq - Viral sequence entries, part 653.
9435. gbvrl654.seq - Viral sequence entries, part 654.
9436. gbvrl655.seq - Viral sequence entries, part 655.
9437. gbvrl656.seq - Viral sequence entries, part 656.
9438. gbvrl657.seq - Viral sequence entries, part 657.
9439. gbvrl658.seq - Viral sequence entries, part 658.
9440. gbvrl659.seq - Viral sequence entries, part 659.
9441. gbvrl66.seq - Viral sequence entries, part 66.
9442. gbvrl660.seq - Viral sequence entries, part 660.
9443. gbvrl661.seq - Viral sequence entries, part 661.
9444. gbvrl662.seq - Viral sequence entries, part 662.
9445. gbvrl663.seq - Viral sequence entries, part 663.
9446. gbvrl664.seq - Viral sequence entries, part 664.
9447. gbvrl665.seq - Viral sequence entries, part 665.
9448. gbvrl666.seq - Viral sequence entries, part 666.
9449. gbvrl667.seq - Viral sequence entries, part 667.
9450. gbvrl668.seq - Viral sequence entries, part 668.
9451. gbvrl669.seq - Viral sequence entries, part 669.
9452. gbvrl67.seq - Viral sequence entries, part 67.
9453. gbvrl670.seq - Viral sequence entries, part 670.
9454. gbvrl671.seq - Viral sequence entries, part 671.
9455. gbvrl672.seq - Viral sequence entries, part 672.
9456. gbvrl673.seq - Viral sequence entries, part 673.
9457. gbvrl674.seq - Viral sequence entries, part 674.
9458. gbvrl675.seq - Viral sequence entries, part 675.
9459. gbvrl676.seq - Viral sequence entries, part 676.
9460. gbvrl677.seq - Viral sequence entries, part 677.
9461. gbvrl678.seq - Viral sequence entries, part 678.
9462. gbvrl679.seq - Viral sequence entries, part 679.
9463. gbvrl68.seq - Viral sequence entries, part 68.
9464. gbvrl680.seq - Viral sequence entries, part 680.
9465. gbvrl681.seq - Viral sequence entries, part 681.
9466. gbvrl682.seq - Viral sequence entries, part 682.
9467. gbvrl683.seq - Viral sequence entries, part 683.
9468. gbvrl684.seq - Viral sequence entries, part 684.
9469. gbvrl685.seq - Viral sequence entries, part 685.
9470. gbvrl686.seq - Viral sequence entries, part 686.
9471. gbvrl687.seq - Viral sequence entries, part 687.
9472. gbvrl688.seq - Viral sequence entries, part 688.
9473. gbvrl689.seq - Viral sequence entries, part 689.
9474. gbvrl69.seq - Viral sequence entries, part 69.
9475. gbvrl690.seq - Viral sequence entries, part 690.
9476. gbvrl691.seq - Viral sequence entries, part 691.
9477. gbvrl692.seq - Viral sequence entries, part 692.
9478. gbvrl693.seq - Viral sequence entries, part 693.
9479. gbvrl694.seq - Viral sequence entries, part 694.
9480. gbvrl695.seq - Viral sequence entries, part 695.
9481. gbvrl696.seq - Viral sequence entries, part 696.
9482. gbvrl697.seq - Viral sequence entries, part 697.
9483. gbvrl698.seq - Viral sequence entries, part 698.
9484. gbvrl699.seq - Viral sequence entries, part 699.
9485. gbvrl7.seq - Viral sequence entries, part 7.
9486. gbvrl70.seq - Viral sequence entries, part 70.
9487. gbvrl700.seq - Viral sequence entries, part 700.
9488. gbvrl701.seq - Viral sequence entries, part 701.
9489. gbvrl702.seq - Viral sequence entries, part 702.
9490. gbvrl703.seq - Viral sequence entries, part 703.
9491. gbvrl704.seq - Viral sequence entries, part 704.
9492. gbvrl705.seq - Viral sequence entries, part 705.
9493. gbvrl706.seq - Viral sequence entries, part 706.
9494. gbvrl707.seq - Viral sequence entries, part 707.
9495. gbvrl708.seq - Viral sequence entries, part 708.
9496. gbvrl709.seq - Viral sequence entries, part 709.
9497. gbvrl71.seq - Viral sequence entries, part 71.
9498. gbvrl710.seq - Viral sequence entries, part 710.
9499. gbvrl711.seq - Viral sequence entries, part 711.
9500. gbvrl712.seq - Viral sequence entries, part 712.
9501. gbvrl713.seq - Viral sequence entries, part 713.
9502. gbvrl714.seq - Viral sequence entries, part 714.
9503. gbvrl715.seq - Viral sequence entries, part 715.
9504. gbvrl716.seq - Viral sequence entries, part 716.
9505. gbvrl717.seq - Viral sequence entries, part 717.
9506. gbvrl718.seq - Viral sequence entries, part 718.
9507. gbvrl719.seq - Viral sequence entries, part 719.
9508. gbvrl72.seq - Viral sequence entries, part 72.
9509. gbvrl720.seq - Viral sequence entries, part 720.
9510. gbvrl721.seq - Viral sequence entries, part 721.
9511. gbvrl722.seq - Viral sequence entries, part 722.
9512. gbvrl723.seq - Viral sequence entries, part 723.
9513. gbvrl724.seq - Viral sequence entries, part 724.
9514. gbvrl725.seq - Viral sequence entries, part 725.
9515. gbvrl726.seq - Viral sequence entries, part 726.
9516. gbvrl727.seq - Viral sequence entries, part 727.
9517. gbvrl728.seq - Viral sequence entries, part 728.
9518. gbvrl729.seq - Viral sequence entries, part 729.
9519. gbvrl73.seq - Viral sequence entries, part 73.
9520. gbvrl730.seq - Viral sequence entries, part 730.
9521. gbvrl731.seq - Viral sequence entries, part 731.
9522. gbvrl732.seq - Viral sequence entries, part 732.
9523. gbvrl733.seq - Viral sequence entries, part 733.
9524. gbvrl734.seq - Viral sequence entries, part 734.
9525. gbvrl735.seq - Viral sequence entries, part 735.
9526. gbvrl736.seq - Viral sequence entries, part 736.
9527. gbvrl737.seq - Viral sequence entries, part 737.
9528. gbvrl738.seq - Viral sequence entries, part 738.
9529. gbvrl739.seq - Viral sequence entries, part 739.
9530. gbvrl74.seq - Viral sequence entries, part 74.
9531. gbvrl740.seq - Viral sequence entries, part 740.
9532. gbvrl741.seq - Viral sequence entries, part 741.
9533. gbvrl742.seq - Viral sequence entries, part 742.
9534. gbvrl743.seq - Viral sequence entries, part 743.
9535. gbvrl744.seq - Viral sequence entries, part 744.
9536. gbvrl745.seq - Viral sequence entries, part 745.
9537. gbvrl746.seq - Viral sequence entries, part 746.
9538. gbvrl747.seq - Viral sequence entries, part 747.
9539. gbvrl748.seq - Viral sequence entries, part 748.
9540. gbvrl749.seq - Viral sequence entries, part 749.
9541. gbvrl75.seq - Viral sequence entries, part 75.
9542. gbvrl750.seq - Viral sequence entries, part 750.
9543. gbvrl751.seq - Viral sequence entries, part 751.
9544. gbvrl752.seq - Viral sequence entries, part 752.
9545. gbvrl753.seq - Viral sequence entries, part 753.
9546. gbvrl754.seq - Viral sequence entries, part 754.
9547. gbvrl755.seq - Viral sequence entries, part 755.
9548. gbvrl756.seq - Viral sequence entries, part 756.
9549. gbvrl757.seq - Viral sequence entries, part 757.
9550. gbvrl758.seq - Viral sequence entries, part 758.
9551. gbvrl759.seq - Viral sequence entries, part 759.
9552. gbvrl76.seq - Viral sequence entries, part 76.
9553. gbvrl760.seq - Viral sequence entries, part 760.
9554. gbvrl761.seq - Viral sequence entries, part 761.
9555. gbvrl762.seq - Viral sequence entries, part 762.
9556. gbvrl763.seq - Viral sequence entries, part 763.
9557. gbvrl764.seq - Viral sequence entries, part 764.
9558. gbvrl765.seq - Viral sequence entries, part 765.
9559. gbvrl766.seq - Viral sequence entries, part 766.
9560. gbvrl767.seq - Viral sequence entries, part 767.
9561. gbvrl768.seq - Viral sequence entries, part 768.
9562. gbvrl769.seq - Viral sequence entries, part 769.
9563. gbvrl77.seq - Viral sequence entries, part 77.
9564. gbvrl770.seq - Viral sequence entries, part 770.
9565. gbvrl771.seq - Viral sequence entries, part 771.
9566. gbvrl772.seq - Viral sequence entries, part 772.
9567. gbvrl773.seq - Viral sequence entries, part 773.
9568. gbvrl774.seq - Viral sequence entries, part 774.
9569. gbvrl775.seq - Viral sequence entries, part 775.
9570. gbvrl776.seq - Viral sequence entries, part 776.
9571. gbvrl777.seq - Viral sequence entries, part 777.
9572. gbvrl778.seq - Viral sequence entries, part 778.
9573. gbvrl779.seq - Viral sequence entries, part 779.
9574. gbvrl78.seq - Viral sequence entries, part 78.
9575. gbvrl780.seq - Viral sequence entries, part 780.
9576. gbvrl781.seq - Viral sequence entries, part 781.
9577. gbvrl782.seq - Viral sequence entries, part 782.
9578. gbvrl783.seq - Viral sequence entries, part 783.
9579. gbvrl784.seq - Viral sequence entries, part 784.
9580. gbvrl785.seq - Viral sequence entries, part 785.
9581. gbvrl786.seq - Viral sequence entries, part 786.
9582. gbvrl787.seq - Viral sequence entries, part 787.
9583. gbvrl788.seq - Viral sequence entries, part 788.
9584. gbvrl789.seq - Viral sequence entries, part 789.
9585. gbvrl79.seq - Viral sequence entries, part 79.
9586. gbvrl790.seq - Viral sequence entries, part 790.
9587. gbvrl791.seq - Viral sequence entries, part 791.
9588. gbvrl792.seq - Viral sequence entries, part 792.
9589. gbvrl793.seq - Viral sequence entries, part 793.
9590. gbvrl794.seq - Viral sequence entries, part 794.
9591. gbvrl795.seq - Viral sequence entries, part 795.
9592. gbvrl796.seq - Viral sequence entries, part 796.
9593. gbvrl797.seq - Viral sequence entries, part 797.
9594. gbvrl798.seq - Viral sequence entries, part 798.
9595. gbvrl799.seq - Viral sequence entries, part 799.
9596. gbvrl8.seq - Viral sequence entries, part 8.
9597. gbvrl80.seq - Viral sequence entries, part 80.
9598. gbvrl800.seq - Viral sequence entries, part 800.
9599. gbvrl801.seq - Viral sequence entries, part 801.
9600. gbvrl802.seq - Viral sequence entries, part 802.
9601. gbvrl803.seq - Viral sequence entries, part 803.
9602. gbvrl804.seq - Viral sequence entries, part 804.
9603. gbvrl805.seq - Viral sequence entries, part 805.
9604. gbvrl806.seq - Viral sequence entries, part 806.
9605. gbvrl807.seq - Viral sequence entries, part 807.
9606. gbvrl808.seq - Viral sequence entries, part 808.
9607. gbvrl809.seq - Viral sequence entries, part 809.
9608. gbvrl81.seq - Viral sequence entries, part 81.
9609. gbvrl810.seq - Viral sequence entries, part 810.
9610. gbvrl811.seq - Viral sequence entries, part 811.
9611. gbvrl812.seq - Viral sequence entries, part 812.
9612. gbvrl813.seq - Viral sequence entries, part 813.
9613. gbvrl814.seq - Viral sequence entries, part 814.
9614. gbvrl815.seq - Viral sequence entries, part 815.
9615. gbvrl816.seq - Viral sequence entries, part 816.
9616. gbvrl817.seq - Viral sequence entries, part 817.
9617. gbvrl818.seq - Viral sequence entries, part 818.
9618. gbvrl819.seq - Viral sequence entries, part 819.
9619. gbvrl82.seq - Viral sequence entries, part 82.
9620. gbvrl820.seq - Viral sequence entries, part 820.
9621. gbvrl821.seq - Viral sequence entries, part 821.
9622. gbvrl822.seq - Viral sequence entries, part 822.
9623. gbvrl823.seq - Viral sequence entries, part 823.
9624. gbvrl824.seq - Viral sequence entries, part 824.
9625. gbvrl825.seq - Viral sequence entries, part 825.
9626. gbvrl826.seq - Viral sequence entries, part 826.
9627. gbvrl827.seq - Viral sequence entries, part 827.
9628. gbvrl828.seq - Viral sequence entries, part 828.
9629. gbvrl829.seq - Viral sequence entries, part 829.
9630. gbvrl83.seq - Viral sequence entries, part 83.
9631. gbvrl830.seq - Viral sequence entries, part 830.
9632. gbvrl831.seq - Viral sequence entries, part 831.
9633. gbvrl832.seq - Viral sequence entries, part 832.
9634. gbvrl833.seq - Viral sequence entries, part 833.
9635. gbvrl834.seq - Viral sequence entries, part 834.
9636. gbvrl835.seq - Viral sequence entries, part 835.
9637. gbvrl836.seq - Viral sequence entries, part 836.
9638. gbvrl837.seq - Viral sequence entries, part 837.
9639. gbvrl838.seq - Viral sequence entries, part 838.
9640. gbvrl839.seq - Viral sequence entries, part 839.
9641. gbvrl84.seq - Viral sequence entries, part 84.
9642. gbvrl840.seq - Viral sequence entries, part 840.
9643. gbvrl841.seq - Viral sequence entries, part 841.
9644. gbvrl842.seq - Viral sequence entries, part 842.
9645. gbvrl843.seq - Viral sequence entries, part 843.
9646. gbvrl844.seq - Viral sequence entries, part 844.
9647. gbvrl845.seq - Viral sequence entries, part 845.
9648. gbvrl846.seq - Viral sequence entries, part 846.
9649. gbvrl847.seq - Viral sequence entries, part 847.
9650. gbvrl848.seq - Viral sequence entries, part 848.
9651. gbvrl849.seq - Viral sequence entries, part 849.
9652. gbvrl85.seq - Viral sequence entries, part 85.
9653. gbvrl850.seq - Viral sequence entries, part 850.
9654. gbvrl851.seq - Viral sequence entries, part 851.
9655. gbvrl852.seq - Viral sequence entries, part 852.
9656. gbvrl853.seq - Viral sequence entries, part 853.
9657. gbvrl854.seq - Viral sequence entries, part 854.
9658. gbvrl855.seq - Viral sequence entries, part 855.
9659. gbvrl856.seq - Viral sequence entries, part 856.
9660. gbvrl857.seq - Viral sequence entries, part 857.
9661. gbvrl858.seq - Viral sequence entries, part 858.
9662. gbvrl859.seq - Viral sequence entries, part 859.
9663. gbvrl86.seq - Viral sequence entries, part 86.
9664. gbvrl860.seq - Viral sequence entries, part 860.
9665. gbvrl861.seq - Viral sequence entries, part 861.
9666. gbvrl862.seq - Viral sequence entries, part 862.
9667. gbvrl863.seq - Viral sequence entries, part 863.
9668. gbvrl864.seq - Viral sequence entries, part 864.
9669. gbvrl865.seq - Viral sequence entries, part 865.
9670. gbvrl866.seq - Viral sequence entries, part 866.
9671. gbvrl867.seq - Viral sequence entries, part 867.
9672. gbvrl868.seq - Viral sequence entries, part 868.
9673. gbvrl869.seq - Viral sequence entries, part 869.
9674. gbvrl87.seq - Viral sequence entries, part 87.
9675. gbvrl870.seq - Viral sequence entries, part 870.
9676. gbvrl871.seq - Viral sequence entries, part 871.
9677. gbvrl872.seq - Viral sequence entries, part 872.
9678. gbvrl873.seq - Viral sequence entries, part 873.
9679. gbvrl874.seq - Viral sequence entries, part 874.
9680. gbvrl875.seq - Viral sequence entries, part 875.
9681. gbvrl876.seq - Viral sequence entries, part 876.
9682. gbvrl877.seq - Viral sequence entries, part 877.
9683. gbvrl878.seq - Viral sequence entries, part 878.
9684. gbvrl879.seq - Viral sequence entries, part 879.
9685. gbvrl88.seq - Viral sequence entries, part 88.
9686. gbvrl880.seq - Viral sequence entries, part 880.
9687. gbvrl881.seq - Viral sequence entries, part 881.
9688. gbvrl882.seq - Viral sequence entries, part 882.
9689. gbvrl883.seq - Viral sequence entries, part 883.
9690. gbvrl884.seq - Viral sequence entries, part 884.
9691. gbvrl885.seq - Viral sequence entries, part 885.
9692. gbvrl886.seq - Viral sequence entries, part 886.
9693. gbvrl887.seq - Viral sequence entries, part 887.
9694. gbvrl888.seq - Viral sequence entries, part 888.
9695. gbvrl889.seq - Viral sequence entries, part 889.
9696. gbvrl89.seq - Viral sequence entries, part 89.
9697. gbvrl890.seq - Viral sequence entries, part 890.
9698. gbvrl891.seq - Viral sequence entries, part 891.
9699. gbvrl892.seq - Viral sequence entries, part 892.
9700. gbvrl893.seq - Viral sequence entries, part 893.
9701. gbvrl894.seq - Viral sequence entries, part 894.
9702. gbvrl895.seq - Viral sequence entries, part 895.
9703. gbvrl896.seq - Viral sequence entries, part 896.
9704. gbvrl897.seq - Viral sequence entries, part 897.
9705. gbvrl898.seq - Viral sequence entries, part 898.
9706. gbvrl899.seq - Viral sequence entries, part 899.
9707. gbvrl9.seq - Viral sequence entries, part 9.
9708. gbvrl90.seq - Viral sequence entries, part 90.
9709. gbvrl900.seq - Viral sequence entries, part 900.
9710. gbvrl901.seq - Viral sequence entries, part 901.
9711. gbvrl902.seq - Viral sequence entries, part 902.
9712. gbvrl903.seq - Viral sequence entries, part 903.
9713. gbvrl904.seq - Viral sequence entries, part 904.
9714. gbvrl905.seq - Viral sequence entries, part 905.
9715. gbvrl906.seq - Viral sequence entries, part 906.
9716. gbvrl907.seq - Viral sequence entries, part 907.
9717. gbvrl908.seq - Viral sequence entries, part 908.
9718. gbvrl909.seq - Viral sequence entries, part 909.
9719. gbvrl91.seq - Viral sequence entries, part 91.
9720. gbvrl910.seq - Viral sequence entries, part 910.
9721. gbvrl911.seq - Viral sequence entries, part 911.
9722. gbvrl912.seq - Viral sequence entries, part 912.
9723. gbvrl913.seq - Viral sequence entries, part 913.
9724. gbvrl914.seq - Viral sequence entries, part 914.
9725. gbvrl915.seq - Viral sequence entries, part 915.
9726. gbvrl916.seq - Viral sequence entries, part 916.
9727. gbvrl917.seq - Viral sequence entries, part 917.
9728. gbvrl918.seq - Viral sequence entries, part 918.
9729. gbvrl919.seq - Viral sequence entries, part 919.
9730. gbvrl92.seq - Viral sequence entries, part 92.
9731. gbvrl920.seq - Viral sequence entries, part 920.
9732. gbvrl921.seq - Viral sequence entries, part 921.
9733. gbvrl922.seq - Viral sequence entries, part 922.
9734. gbvrl923.seq - Viral sequence entries, part 923.
9735. gbvrl924.seq - Viral sequence entries, part 924.
9736. gbvrl925.seq - Viral sequence entries, part 925.
9737. gbvrl926.seq - Viral sequence entries, part 926.
9738. gbvrl927.seq - Viral sequence entries, part 927.
9739. gbvrl928.seq - Viral sequence entries, part 928.
9740. gbvrl929.seq - Viral sequence entries, part 929.
9741. gbvrl93.seq - Viral sequence entries, part 93.
9742. gbvrl930.seq - Viral sequence entries, part 930.
9743. gbvrl931.seq - Viral sequence entries, part 931.
9744. gbvrl932.seq - Viral sequence entries, part 932.
9745. gbvrl933.seq - Viral sequence entries, part 933.
9746. gbvrl934.seq - Viral sequence entries, part 934.
9747. gbvrl935.seq - Viral sequence entries, part 935.
9748. gbvrl936.seq - Viral sequence entries, part 936.
9749. gbvrl937.seq - Viral sequence entries, part 937.
9750. gbvrl938.seq - Viral sequence entries, part 938.
9751. gbvrl939.seq - Viral sequence entries, part 939.
9752. gbvrl94.seq - Viral sequence entries, part 94.
9753. gbvrl940.seq - Viral sequence entries, part 940.
9754. gbvrl941.seq - Viral sequence entries, part 941.
9755. gbvrl942.seq - Viral sequence entries, part 942.
9756. gbvrl943.seq - Viral sequence entries, part 943.
9757. gbvrl944.seq - Viral sequence entries, part 944.
9758. gbvrl945.seq - Viral sequence entries, part 945.
9759. gbvrl946.seq - Viral sequence entries, part 946.
9760. gbvrl947.seq - Viral sequence entries, part 947.
9761. gbvrl948.seq - Viral sequence entries, part 948.
9762. gbvrl949.seq - Viral sequence entries, part 949.
9763. gbvrl95.seq - Viral sequence entries, part 95.
9764. gbvrl950.seq - Viral sequence entries, part 950.
9765. gbvrl951.seq - Viral sequence entries, part 951.
9766. gbvrl952.seq - Viral sequence entries, part 952.
9767. gbvrl953.seq - Viral sequence entries, part 953.
9768. gbvrl954.seq - Viral sequence entries, part 954.
9769. gbvrl955.seq - Viral sequence entries, part 955.
9770. gbvrl956.seq - Viral sequence entries, part 956.
9771. gbvrl957.seq - Viral sequence entries, part 957.
9772. gbvrl958.seq - Viral sequence entries, part 958.
9773. gbvrl959.seq - Viral sequence entries, part 959.
9774. gbvrl96.seq - Viral sequence entries, part 96.
9775. gbvrl960.seq - Viral sequence entries, part 960.
9776. gbvrl961.seq - Viral sequence entries, part 961.
9777. gbvrl962.seq - Viral sequence entries, part 962.
9778. gbvrl963.seq - Viral sequence entries, part 963.
9779. gbvrl964.seq - Viral sequence entries, part 964.
9780. gbvrl965.seq - Viral sequence entries, part 965.
9781. gbvrl966.seq - Viral sequence entries, part 966.
9782. gbvrl967.seq - Viral sequence entries, part 967.
9783. gbvrl968.seq - Viral sequence entries, part 968.
9784. gbvrl969.seq - Viral sequence entries, part 969.
9785. gbvrl97.seq - Viral sequence entries, part 97.
9786. gbvrl970.seq - Viral sequence entries, part 970.
9787. gbvrl971.seq - Viral sequence entries, part 971.
9788. gbvrl972.seq - Viral sequence entries, part 972.
9789. gbvrl973.seq - Viral sequence entries, part 973.
9790. gbvrl974.seq - Viral sequence entries, part 974.
9791. gbvrl975.seq - Viral sequence entries, part 975.
9792. gbvrl976.seq - Viral sequence entries, part 976.
9793. gbvrl977.seq - Viral sequence entries, part 977.
9794. gbvrl978.seq - Viral sequence entries, part 978.
9795. gbvrl979.seq - Viral sequence entries, part 979.
9796. gbvrl98.seq - Viral sequence entries, part 98.
9797. gbvrl980.seq - Viral sequence entries, part 980.
9798. gbvrl981.seq - Viral sequence entries, part 981.
9799. gbvrl982.seq - Viral sequence entries, part 982.
9800. gbvrl983.seq - Viral sequence entries, part 983.
9801. gbvrl984.seq - Viral sequence entries, part 984.
9802. gbvrl985.seq - Viral sequence entries, part 985.
9803. gbvrl986.seq - Viral sequence entries, part 986.
9804. gbvrl987.seq - Viral sequence entries, part 987.
9805. gbvrl988.seq - Viral sequence entries, part 988.
9806. gbvrl989.seq - Viral sequence entries, part 989.
9807. gbvrl99.seq - Viral sequence entries, part 99.
9808. gbvrl990.seq - Viral sequence entries, part 990.
9809. gbvrl991.seq - Viral sequence entries, part 991.
9810. gbvrl992.seq - Viral sequence entries, part 992.
9811. gbvrl993.seq - Viral sequence entries, part 993.
9812. gbvrl994.seq - Viral sequence entries, part 994.
9813. gbvrl995.seq - Viral sequence entries, part 995.
9814. gbvrl996.seq - Viral sequence entries, part 996.
9815. gbvrl997.seq - Viral sequence entries, part 997.
9816. gbvrl998.seq - Viral sequence entries, part 998.
9817. gbvrl999.seq - Viral sequence entries, part 999.
9818. gbvrt1.seq - Other vertebrate sequence entries, part 1.
9819. gbvrt10.seq - Other vertebrate sequence entries, part 10.
9820. gbvrt100.seq - Other vertebrate sequence entries, part 100.
9821. gbvrt101.seq - Other vertebrate sequence entries, part 101.
9822. gbvrt102.seq - Other vertebrate sequence entries, part 102.
9823. gbvrt103.seq - Other vertebrate sequence entries, part 103.
9824. gbvrt104.seq - Other vertebrate sequence entries, part 104.
9825. gbvrt105.seq - Other vertebrate sequence entries, part 105.
9826. gbvrt106.seq - Other vertebrate sequence entries, part 106.
9827. gbvrt107.seq - Other vertebrate sequence entries, part 107.
9828. gbvrt108.seq - Other vertebrate sequence entries, part 108.
9829. gbvrt109.seq - Other vertebrate sequence entries, part 109.
9830. gbvrt11.seq - Other vertebrate sequence entries, part 11.
9831. gbvrt110.seq - Other vertebrate sequence entries, part 110.
9832. gbvrt111.seq - Other vertebrate sequence entries, part 111.
9833. gbvrt112.seq - Other vertebrate sequence entries, part 112.
9834. gbvrt113.seq - Other vertebrate sequence entries, part 113.
9835. gbvrt114.seq - Other vertebrate sequence entries, part 114.
9836. gbvrt115.seq - Other vertebrate sequence entries, part 115.
9837. gbvrt116.seq - Other vertebrate sequence entries, part 116.
9838. gbvrt117.seq - Other vertebrate sequence entries, part 117.
9839. gbvrt118.seq - Other vertebrate sequence entries, part 118.
9840. gbvrt119.seq - Other vertebrate sequence entries, part 119.
9841. gbvrt12.seq - Other vertebrate sequence entries, part 12.
9842. gbvrt120.seq - Other vertebrate sequence entries, part 120.
9843. gbvrt121.seq - Other vertebrate sequence entries, part 121.
9844. gbvrt122.seq - Other vertebrate sequence entries, part 122.
9845. gbvrt123.seq - Other vertebrate sequence entries, part 123.
9846. gbvrt124.seq - Other vertebrate sequence entries, part 124.
9847. gbvrt125.seq - Other vertebrate sequence entries, part 125.
9848. gbvrt126.seq - Other vertebrate sequence entries, part 126.
9849. gbvrt127.seq - Other vertebrate sequence entries, part 127.
9850. gbvrt128.seq - Other vertebrate sequence entries, part 128.
9851. gbvrt129.seq - Other vertebrate sequence entries, part 129.
9852. gbvrt13.seq - Other vertebrate sequence entries, part 13.
9853. gbvrt130.seq - Other vertebrate sequence entries, part 130.
9854. gbvrt131.seq - Other vertebrate sequence entries, part 131.
9855. gbvrt132.seq - Other vertebrate sequence entries, part 132.
9856. gbvrt133.seq - Other vertebrate sequence entries, part 133.
9857. gbvrt134.seq - Other vertebrate sequence entries, part 134.
9858. gbvrt135.seq - Other vertebrate sequence entries, part 135.
9859. gbvrt136.seq - Other vertebrate sequence entries, part 136.
9860. gbvrt137.seq - Other vertebrate sequence entries, part 137.
9861. gbvrt138.seq - Other vertebrate sequence entries, part 138.
9862. gbvrt139.seq - Other vertebrate sequence entries, part 139.
9863. gbvrt14.seq - Other vertebrate sequence entries, part 14.
9864. gbvrt140.seq - Other vertebrate sequence entries, part 140.
9865. gbvrt141.seq - Other vertebrate sequence entries, part 141.
9866. gbvrt142.seq - Other vertebrate sequence entries, part 142.
9867. gbvrt143.seq - Other vertebrate sequence entries, part 143.
9868. gbvrt144.seq - Other vertebrate sequence entries, part 144.
9869. gbvrt145.seq - Other vertebrate sequence entries, part 145.
9870. gbvrt146.seq - Other vertebrate sequence entries, part 146.
9871. gbvrt147.seq - Other vertebrate sequence entries, part 147.
9872. gbvrt148.seq - Other vertebrate sequence entries, part 148.
9873. gbvrt149.seq - Other vertebrate sequence entries, part 149.
9874. gbvrt15.seq - Other vertebrate sequence entries, part 15.
9875. gbvrt150.seq - Other vertebrate sequence entries, part 150.
9876. gbvrt151.seq - Other vertebrate sequence entries, part 151.
9877. gbvrt152.seq - Other vertebrate sequence entries, part 152.
9878. gbvrt153.seq - Other vertebrate sequence entries, part 153.
9879. gbvrt154.seq - Other vertebrate sequence entries, part 154.
9880. gbvrt155.seq - Other vertebrate sequence entries, part 155.
9881. gbvrt156.seq - Other vertebrate sequence entries, part 156.
9882. gbvrt157.seq - Other vertebrate sequence entries, part 157.
9883. gbvrt158.seq - Other vertebrate sequence entries, part 158.
9884. gbvrt159.seq - Other vertebrate sequence entries, part 159.
9885. gbvrt16.seq - Other vertebrate sequence entries, part 16.
9886. gbvrt160.seq - Other vertebrate sequence entries, part 160.
9887. gbvrt161.seq - Other vertebrate sequence entries, part 161.
9888. gbvrt162.seq - Other vertebrate sequence entries, part 162.
9889. gbvrt163.seq - Other vertebrate sequence entries, part 163.
9890. gbvrt164.seq - Other vertebrate sequence entries, part 164.
9891. gbvrt165.seq - Other vertebrate sequence entries, part 165.
9892. gbvrt166.seq - Other vertebrate sequence entries, part 166.
9893. gbvrt167.seq - Other vertebrate sequence entries, part 167.
9894. gbvrt168.seq - Other vertebrate sequence entries, part 168.
9895. gbvrt169.seq - Other vertebrate sequence entries, part 169.
9896. gbvrt17.seq - Other vertebrate sequence entries, part 17.
9897. gbvrt170.seq - Other vertebrate sequence entries, part 170.
9898. gbvrt171.seq - Other vertebrate sequence entries, part 171.
9899. gbvrt172.seq - Other vertebrate sequence entries, part 172.
9900. gbvrt173.seq - Other vertebrate sequence entries, part 173.
9901. gbvrt174.seq - Other vertebrate sequence entries, part 174.
9902. gbvrt175.seq - Other vertebrate sequence entries, part 175.
9903. gbvrt176.seq - Other vertebrate sequence entries, part 176.
9904. gbvrt177.seq - Other vertebrate sequence entries, part 177.
9905. gbvrt178.seq - Other vertebrate sequence entries, part 178.
9906. gbvrt179.seq - Other vertebrate sequence entries, part 179.
9907. gbvrt18.seq - Other vertebrate sequence entries, part 18.
9908. gbvrt180.seq - Other vertebrate sequence entries, part 180.
9909. gbvrt181.seq - Other vertebrate sequence entries, part 181.
9910. gbvrt182.seq - Other vertebrate sequence entries, part 182.
9911. gbvrt183.seq - Other vertebrate sequence entries, part 183.
9912. gbvrt184.seq - Other vertebrate sequence entries, part 184.
9913. gbvrt185.seq - Other vertebrate sequence entries, part 185.
9914. gbvrt186.seq - Other vertebrate sequence entries, part 186.
9915. gbvrt187.seq - Other vertebrate sequence entries, part 187.
9916. gbvrt188.seq - Other vertebrate sequence entries, part 188.
9917. gbvrt189.seq - Other vertebrate sequence entries, part 189.
9918. gbvrt19.seq - Other vertebrate sequence entries, part 19.
9919. gbvrt190.seq - Other vertebrate sequence entries, part 190.
9920. gbvrt191.seq - Other vertebrate sequence entries, part 191.
9921. gbvrt192.seq - Other vertebrate sequence entries, part 192.
9922. gbvrt193.seq - Other vertebrate sequence entries, part 193.
9923. gbvrt194.seq - Other vertebrate sequence entries, part 194.
9924. gbvrt195.seq - Other vertebrate sequence entries, part 195.
9925. gbvrt196.seq - Other vertebrate sequence entries, part 196.
9926. gbvrt197.seq - Other vertebrate sequence entries, part 197.
9927. gbvrt198.seq - Other vertebrate sequence entries, part 198.
9928. gbvrt199.seq - Other vertebrate sequence entries, part 199.
9929. gbvrt2.seq - Other vertebrate sequence entries, part 2.
9930. gbvrt20.seq - Other vertebrate sequence entries, part 20.
9931. gbvrt200.seq - Other vertebrate sequence entries, part 200.
9932. gbvrt201.seq - Other vertebrate sequence entries, part 201.
9933. gbvrt202.seq - Other vertebrate sequence entries, part 202.
9934. gbvrt203.seq - Other vertebrate sequence entries, part 203.
9935. gbvrt204.seq - Other vertebrate sequence entries, part 204.
9936. gbvrt205.seq - Other vertebrate sequence entries, part 205.
9937. gbvrt206.seq - Other vertebrate sequence entries, part 206.
9938. gbvrt207.seq - Other vertebrate sequence entries, part 207.
9939. gbvrt208.seq - Other vertebrate sequence entries, part 208.
9940. gbvrt209.seq - Other vertebrate sequence entries, part 209.
9941. gbvrt21.seq - Other vertebrate sequence entries, part 21.
9942. gbvrt210.seq - Other vertebrate sequence entries, part 210.
9943. gbvrt211.seq - Other vertebrate sequence entries, part 211.
9944. gbvrt212.seq - Other vertebrate sequence entries, part 212.
9945. gbvrt213.seq - Other vertebrate sequence entries, part 213.
9946. gbvrt214.seq - Other vertebrate sequence entries, part 214.
9947. gbvrt215.seq - Other vertebrate sequence entries, part 215.
9948. gbvrt216.seq - Other vertebrate sequence entries, part 216.
9949. gbvrt217.seq - Other vertebrate sequence entries, part 217.
9950. gbvrt218.seq - Other vertebrate sequence entries, part 218.
9951. gbvrt219.seq - Other vertebrate sequence entries, part 219.
9952. gbvrt22.seq - Other vertebrate sequence entries, part 22.
9953. gbvrt220.seq - Other vertebrate sequence entries, part 220.
9954. gbvrt221.seq - Other vertebrate sequence entries, part 221.
9955. gbvrt222.seq - Other vertebrate sequence entries, part 222.
9956. gbvrt223.seq - Other vertebrate sequence entries, part 223.
9957. gbvrt224.seq - Other vertebrate sequence entries, part 224.
9958. gbvrt225.seq - Other vertebrate sequence entries, part 225.
9959. gbvrt226.seq - Other vertebrate sequence entries, part 226.
9960. gbvrt227.seq - Other vertebrate sequence entries, part 227.
9961. gbvrt228.seq - Other vertebrate sequence entries, part 228.
9962. gbvrt229.seq - Other vertebrate sequence entries, part 229.
9963. gbvrt23.seq - Other vertebrate sequence entries, part 23.
9964. gbvrt230.seq - Other vertebrate sequence entries, part 230.
9965. gbvrt231.seq - Other vertebrate sequence entries, part 231.
9966. gbvrt232.seq - Other vertebrate sequence entries, part 232.
9967. gbvrt233.seq - Other vertebrate sequence entries, part 233.
9968. gbvrt234.seq - Other vertebrate sequence entries, part 234.
9969. gbvrt235.seq - Other vertebrate sequence entries, part 235.
9970. gbvrt236.seq - Other vertebrate sequence entries, part 236.
9971. gbvrt237.seq - Other vertebrate sequence entries, part 237.
9972. gbvrt238.seq - Other vertebrate sequence entries, part 238.
9973. gbvrt239.seq - Other vertebrate sequence entries, part 239.
9974. gbvrt24.seq - Other vertebrate sequence entries, part 24.
9975. gbvrt240.seq - Other vertebrate sequence entries, part 240.
9976. gbvrt241.seq - Other vertebrate sequence entries, part 241.
9977. gbvrt242.seq - Other vertebrate sequence entries, part 242.
9978. gbvrt243.seq - Other vertebrate sequence entries, part 243.
9979. gbvrt244.seq - Other vertebrate sequence entries, part 244.
9980. gbvrt245.seq - Other vertebrate sequence entries, part 245.
9981. gbvrt246.seq - Other vertebrate sequence entries, part 246.
9982. gbvrt247.seq - Other vertebrate sequence entries, part 247.
9983. gbvrt248.seq - Other vertebrate sequence entries, part 248.
9984. gbvrt249.seq - Other vertebrate sequence entries, part 249.
9985. gbvrt25.seq - Other vertebrate sequence entries, part 25.
9986. gbvrt250.seq - Other vertebrate sequence entries, part 250.
9987. gbvrt251.seq - Other vertebrate sequence entries, part 251.
9988. gbvrt252.seq - Other vertebrate sequence entries, part 252.
9989. gbvrt253.seq - Other vertebrate sequence entries, part 253.
9990. gbvrt254.seq - Other vertebrate sequence entries, part 254.
9991. gbvrt255.seq - Other vertebrate sequence entries, part 255.
9992. gbvrt256.seq - Other vertebrate sequence entries, part 256.
9993. gbvrt257.seq - Other vertebrate sequence entries, part 257.
9994. gbvrt258.seq - Other vertebrate sequence entries, part 258.
9995. gbvrt259.seq - Other vertebrate sequence entries, part 259.
9996. gbvrt26.seq - Other vertebrate sequence entries, part 26.
9997. gbvrt260.seq - Other vertebrate sequence entries, part 260.
9998. gbvrt261.seq - Other vertebrate sequence entries, part 261.
9999. gbvrt262.seq - Other vertebrate sequence entries, part 262.
10000. gbvrt263.seq - Other vertebrate sequence entries, part 263.
10001. gbvrt264.seq - Other vertebrate sequence entries, part 264.
10002. gbvrt265.seq - Other vertebrate sequence entries, part 265.
10003. gbvrt266.seq - Other vertebrate sequence entries, part 266.
10004. gbvrt267.seq - Other vertebrate sequence entries, part 267.
10005. gbvrt268.seq - Other vertebrate sequence entries, part 268.
10006. gbvrt269.seq - Other vertebrate sequence entries, part 269.
10007. gbvrt27.seq - Other vertebrate sequence entries, part 27.
10008. gbvrt270.seq - Other vertebrate sequence entries, part 270.
10009. gbvrt271.seq - Other vertebrate sequence entries, part 271.
10010. gbvrt272.seq - Other vertebrate sequence entries, part 272.
10011. gbvrt273.seq - Other vertebrate sequence entries, part 273.
10012. gbvrt274.seq - Other vertebrate sequence entries, part 274.
10013. gbvrt275.seq - Other vertebrate sequence entries, part 275.
10014. gbvrt276.seq - Other vertebrate sequence entries, part 276.
10015. gbvrt277.seq - Other vertebrate sequence entries, part 277.
10016. gbvrt278.seq - Other vertebrate sequence entries, part 278.
10017. gbvrt279.seq - Other vertebrate sequence entries, part 279.
10018. gbvrt28.seq - Other vertebrate sequence entries, part 28.
10019. gbvrt280.seq - Other vertebrate sequence entries, part 280.
10020. gbvrt281.seq - Other vertebrate sequence entries, part 281.
10021. gbvrt282.seq - Other vertebrate sequence entries, part 282.
10022. gbvrt283.seq - Other vertebrate sequence entries, part 283.
10023. gbvrt284.seq - Other vertebrate sequence entries, part 284.
10024. gbvrt285.seq - Other vertebrate sequence entries, part 285.
10025. gbvrt286.seq - Other vertebrate sequence entries, part 286.
10026. gbvrt287.seq - Other vertebrate sequence entries, part 287.
10027. gbvrt288.seq - Other vertebrate sequence entries, part 288.
10028. gbvrt289.seq - Other vertebrate sequence entries, part 289.
10029. gbvrt29.seq - Other vertebrate sequence entries, part 29.
10030. gbvrt290.seq - Other vertebrate sequence entries, part 290.
10031. gbvrt291.seq - Other vertebrate sequence entries, part 291.
10032. gbvrt292.seq - Other vertebrate sequence entries, part 292.
10033. gbvrt293.seq - Other vertebrate sequence entries, part 293.
10034. gbvrt294.seq - Other vertebrate sequence entries, part 294.
10035. gbvrt295.seq - Other vertebrate sequence entries, part 295.
10036. gbvrt296.seq - Other vertebrate sequence entries, part 296.
10037. gbvrt297.seq - Other vertebrate sequence entries, part 297.
10038. gbvrt298.seq - Other vertebrate sequence entries, part 298.
10039. gbvrt299.seq - Other vertebrate sequence entries, part 299.
10040. gbvrt3.seq - Other vertebrate sequence entries, part 3.
10041. gbvrt30.seq - Other vertebrate sequence entries, part 30.
10042. gbvrt300.seq - Other vertebrate sequence entries, part 300.
10043. gbvrt301.seq - Other vertebrate sequence entries, part 301.
10044. gbvrt302.seq - Other vertebrate sequence entries, part 302.
10045. gbvrt303.seq - Other vertebrate sequence entries, part 303.
10046. gbvrt304.seq - Other vertebrate sequence entries, part 304.
10047. gbvrt305.seq - Other vertebrate sequence entries, part 305.
10048. gbvrt306.seq - Other vertebrate sequence entries, part 306.
10049. gbvrt307.seq - Other vertebrate sequence entries, part 307.
10050. gbvrt308.seq - Other vertebrate sequence entries, part 308.
10051. gbvrt309.seq - Other vertebrate sequence entries, part 309.
10052. gbvrt31.seq - Other vertebrate sequence entries, part 31.
10053. gbvrt310.seq - Other vertebrate sequence entries, part 310.
10054. gbvrt311.seq - Other vertebrate sequence entries, part 311.
10055. gbvrt312.seq - Other vertebrate sequence entries, part 312.
10056. gbvrt313.seq - Other vertebrate sequence entries, part 313.
10057. gbvrt314.seq - Other vertebrate sequence entries, part 314.
10058. gbvrt315.seq - Other vertebrate sequence entries, part 315.
10059. gbvrt316.seq - Other vertebrate sequence entries, part 316.
10060. gbvrt317.seq - Other vertebrate sequence entries, part 317.
10061. gbvrt318.seq - Other vertebrate sequence entries, part 318.
10062. gbvrt319.seq - Other vertebrate sequence entries, part 319.
10063. gbvrt32.seq - Other vertebrate sequence entries, part 32.
10064. gbvrt320.seq - Other vertebrate sequence entries, part 320.
10065. gbvrt321.seq - Other vertebrate sequence entries, part 321.
10066. gbvrt322.seq - Other vertebrate sequence entries, part 322.
10067. gbvrt323.seq - Other vertebrate sequence entries, part 323.
10068. gbvrt324.seq - Other vertebrate sequence entries, part 324.
10069. gbvrt325.seq - Other vertebrate sequence entries, part 325.
10070. gbvrt326.seq - Other vertebrate sequence entries, part 326.
10071. gbvrt327.seq - Other vertebrate sequence entries, part 327.
10072. gbvrt328.seq - Other vertebrate sequence entries, part 328.
10073. gbvrt329.seq - Other vertebrate sequence entries, part 329.
10074. gbvrt33.seq - Other vertebrate sequence entries, part 33.
10075. gbvrt330.seq - Other vertebrate sequence entries, part 330.
10076. gbvrt331.seq - Other vertebrate sequence entries, part 331.
10077. gbvrt332.seq - Other vertebrate sequence entries, part 332.
10078. gbvrt333.seq - Other vertebrate sequence entries, part 333.
10079. gbvrt334.seq - Other vertebrate sequence entries, part 334.
10080. gbvrt335.seq - Other vertebrate sequence entries, part 335.
10081. gbvrt336.seq - Other vertebrate sequence entries, part 336.
10082. gbvrt337.seq - Other vertebrate sequence entries, part 337.
10083. gbvrt338.seq - Other vertebrate sequence entries, part 338.
10084. gbvrt339.seq - Other vertebrate sequence entries, part 339.
10085. gbvrt34.seq - Other vertebrate sequence entries, part 34.
10086. gbvrt340.seq - Other vertebrate sequence entries, part 340.
10087. gbvrt341.seq - Other vertebrate sequence entries, part 341.
10088. gbvrt342.seq - Other vertebrate sequence entries, part 342.
10089. gbvrt343.seq - Other vertebrate sequence entries, part 343.
10090. gbvrt344.seq - Other vertebrate sequence entries, part 344.
10091. gbvrt345.seq - Other vertebrate sequence entries, part 345.
10092. gbvrt346.seq - Other vertebrate sequence entries, part 346.
10093. gbvrt347.seq - Other vertebrate sequence entries, part 347.
10094. gbvrt348.seq - Other vertebrate sequence entries, part 348.
10095. gbvrt349.seq - Other vertebrate sequence entries, part 349.
10096. gbvrt35.seq - Other vertebrate sequence entries, part 35.
10097. gbvrt350.seq - Other vertebrate sequence entries, part 350.
10098. gbvrt351.seq - Other vertebrate sequence entries, part 351.
10099. gbvrt352.seq - Other vertebrate sequence entries, part 352.
10100. gbvrt353.seq - Other vertebrate sequence entries, part 353.
10101. gbvrt354.seq - Other vertebrate sequence entries, part 354.
10102. gbvrt355.seq - Other vertebrate sequence entries, part 355.
10103. gbvrt356.seq - Other vertebrate sequence entries, part 356.
10104. gbvrt357.seq - Other vertebrate sequence entries, part 357.
10105. gbvrt358.seq - Other vertebrate sequence entries, part 358.
10106. gbvrt359.seq - Other vertebrate sequence entries, part 359.
10107. gbvrt36.seq - Other vertebrate sequence entries, part 36.
10108. gbvrt360.seq - Other vertebrate sequence entries, part 360.
10109. gbvrt361.seq - Other vertebrate sequence entries, part 361.
10110. gbvrt362.seq - Other vertebrate sequence entries, part 362.
10111. gbvrt363.seq - Other vertebrate sequence entries, part 363.
10112. gbvrt364.seq - Other vertebrate sequence entries, part 364.
10113. gbvrt365.seq - Other vertebrate sequence entries, part 365.
10114. gbvrt366.seq - Other vertebrate sequence entries, part 366.
10115. gbvrt367.seq - Other vertebrate sequence entries, part 367.
10116. gbvrt368.seq - Other vertebrate sequence entries, part 368.
10117. gbvrt369.seq - Other vertebrate sequence entries, part 369.
10118. gbvrt37.seq - Other vertebrate sequence entries, part 37.
10119. gbvrt370.seq - Other vertebrate sequence entries, part 370.
10120. gbvrt371.seq - Other vertebrate sequence entries, part 371.
10121. gbvrt372.seq - Other vertebrate sequence entries, part 372.
10122. gbvrt373.seq - Other vertebrate sequence entries, part 373.
10123. gbvrt374.seq - Other vertebrate sequence entries, part 374.
10124. gbvrt375.seq - Other vertebrate sequence entries, part 375.
10125. gbvrt376.seq - Other vertebrate sequence entries, part 376.
10126. gbvrt377.seq - Other vertebrate sequence entries, part 377.
10127. gbvrt378.seq - Other vertebrate sequence entries, part 378.
10128. gbvrt379.seq - Other vertebrate sequence entries, part 379.
10129. gbvrt38.seq - Other vertebrate sequence entries, part 38.
10130. gbvrt380.seq - Other vertebrate sequence entries, part 380.
10131. gbvrt381.seq - Other vertebrate sequence entries, part 381.
10132. gbvrt382.seq - Other vertebrate sequence entries, part 382.
10133. gbvrt383.seq - Other vertebrate sequence entries, part 383.
10134. gbvrt384.seq - Other vertebrate sequence entries, part 384.
10135. gbvrt385.seq - Other vertebrate sequence entries, part 385.
10136. gbvrt386.seq - Other vertebrate sequence entries, part 386.
10137. gbvrt387.seq - Other vertebrate sequence entries, part 387.
10138. gbvrt388.seq - Other vertebrate sequence entries, part 388.
10139. gbvrt389.seq - Other vertebrate sequence entries, part 389.
10140. gbvrt39.seq - Other vertebrate sequence entries, part 39.
10141. gbvrt390.seq - Other vertebrate sequence entries, part 390.
10142. gbvrt391.seq - Other vertebrate sequence entries, part 391.
10143. gbvrt392.seq - Other vertebrate sequence entries, part 392.
10144. gbvrt393.seq - Other vertebrate sequence entries, part 393.
10145. gbvrt394.seq - Other vertebrate sequence entries, part 394.
10146. gbvrt395.seq - Other vertebrate sequence entries, part 395.
10147. gbvrt396.seq - Other vertebrate sequence entries, part 396.
10148. gbvrt397.seq - Other vertebrate sequence entries, part 397.
10149. gbvrt398.seq - Other vertebrate sequence entries, part 398.
10150. gbvrt399.seq - Other vertebrate sequence entries, part 399.
10151. gbvrt4.seq - Other vertebrate sequence entries, part 4.
10152. gbvrt40.seq - Other vertebrate sequence entries, part 40.
10153. gbvrt400.seq - Other vertebrate sequence entries, part 400.
10154. gbvrt401.seq - Other vertebrate sequence entries, part 401.
10155. gbvrt402.seq - Other vertebrate sequence entries, part 402.
10156. gbvrt403.seq - Other vertebrate sequence entries, part 403.
10157. gbvrt404.seq - Other vertebrate sequence entries, part 404.
10158. gbvrt405.seq - Other vertebrate sequence entries, part 405.
10159. gbvrt406.seq - Other vertebrate sequence entries, part 406.
10160. gbvrt407.seq - Other vertebrate sequence entries, part 407.
10161. gbvrt408.seq - Other vertebrate sequence entries, part 408.
10162. gbvrt409.seq - Other vertebrate sequence entries, part 409.
10163. gbvrt41.seq - Other vertebrate sequence entries, part 41.
10164. gbvrt410.seq - Other vertebrate sequence entries, part 410.
10165. gbvrt411.seq - Other vertebrate sequence entries, part 411.
10166. gbvrt412.seq - Other vertebrate sequence entries, part 412.
10167. gbvrt413.seq - Other vertebrate sequence entries, part 413.
10168. gbvrt414.seq - Other vertebrate sequence entries, part 414.
10169. gbvrt415.seq - Other vertebrate sequence entries, part 415.
10170. gbvrt416.seq - Other vertebrate sequence entries, part 416.
10171. gbvrt417.seq - Other vertebrate sequence entries, part 417.
10172. gbvrt418.seq - Other vertebrate sequence entries, part 418.
10173. gbvrt419.seq - Other vertebrate sequence entries, part 419.
10174. gbvrt42.seq - Other vertebrate sequence entries, part 42.
10175. gbvrt420.seq - Other vertebrate sequence entries, part 420.
10176. gbvrt421.seq - Other vertebrate sequence entries, part 421.
10177. gbvrt422.seq - Other vertebrate sequence entries, part 422.
10178. gbvrt423.seq - Other vertebrate sequence entries, part 423.
10179. gbvrt424.seq - Other vertebrate sequence entries, part 424.
10180. gbvrt425.seq - Other vertebrate sequence entries, part 425.
10181. gbvrt426.seq - Other vertebrate sequence entries, part 426.
10182. gbvrt427.seq - Other vertebrate sequence entries, part 427.
10183. gbvrt428.seq - Other vertebrate sequence entries, part 428.
10184. gbvrt429.seq - Other vertebrate sequence entries, part 429.
10185. gbvrt43.seq - Other vertebrate sequence entries, part 43.
10186. gbvrt430.seq - Other vertebrate sequence entries, part 430.
10187. gbvrt431.seq - Other vertebrate sequence entries, part 431.
10188. gbvrt432.seq - Other vertebrate sequence entries, part 432.
10189. gbvrt433.seq - Other vertebrate sequence entries, part 433.
10190. gbvrt434.seq - Other vertebrate sequence entries, part 434.
10191. gbvrt435.seq - Other vertebrate sequence entries, part 435.
10192. gbvrt436.seq - Other vertebrate sequence entries, part 436.
10193. gbvrt437.seq - Other vertebrate sequence entries, part 437.
10194. gbvrt438.seq - Other vertebrate sequence entries, part 438.
10195. gbvrt439.seq - Other vertebrate sequence entries, part 439.
10196. gbvrt44.seq - Other vertebrate sequence entries, part 44.
10197. gbvrt440.seq - Other vertebrate sequence entries, part 440.
10198. gbvrt441.seq - Other vertebrate sequence entries, part 441.
10199. gbvrt442.seq - Other vertebrate sequence entries, part 442.
10200. gbvrt443.seq - Other vertebrate sequence entries, part 443.
10201. gbvrt444.seq - Other vertebrate sequence entries, part 444.
10202. gbvrt445.seq - Other vertebrate sequence entries, part 445.
10203. gbvrt446.seq - Other vertebrate sequence entries, part 446.
10204. gbvrt447.seq - Other vertebrate sequence entries, part 447.
10205. gbvrt448.seq - Other vertebrate sequence entries, part 448.
10206. gbvrt449.seq - Other vertebrate sequence entries, part 449.
10207. gbvrt45.seq - Other vertebrate sequence entries, part 45.
10208. gbvrt450.seq - Other vertebrate sequence entries, part 450.
10209. gbvrt451.seq - Other vertebrate sequence entries, part 451.
10210. gbvrt452.seq - Other vertebrate sequence entries, part 452.
10211. gbvrt453.seq - Other vertebrate sequence entries, part 453.
10212. gbvrt454.seq - Other vertebrate sequence entries, part 454.
10213. gbvrt455.seq - Other vertebrate sequence entries, part 455.
10214. gbvrt456.seq - Other vertebrate sequence entries, part 456.
10215. gbvrt457.seq - Other vertebrate sequence entries, part 457.
10216. gbvrt458.seq - Other vertebrate sequence entries, part 458.
10217. gbvrt459.seq - Other vertebrate sequence entries, part 459.
10218. gbvrt46.seq - Other vertebrate sequence entries, part 46.
10219. gbvrt460.seq - Other vertebrate sequence entries, part 460.
10220. gbvrt461.seq - Other vertebrate sequence entries, part 461.
10221. gbvrt462.seq - Other vertebrate sequence entries, part 462.
10222. gbvrt463.seq - Other vertebrate sequence entries, part 463.
10223. gbvrt464.seq - Other vertebrate sequence entries, part 464.
10224. gbvrt465.seq - Other vertebrate sequence entries, part 465.
10225. gbvrt466.seq - Other vertebrate sequence entries, part 466.
10226. gbvrt467.seq - Other vertebrate sequence entries, part 467.
10227. gbvrt468.seq - Other vertebrate sequence entries, part 468.
10228. gbvrt469.seq - Other vertebrate sequence entries, part 469.
10229. gbvrt47.seq - Other vertebrate sequence entries, part 47.
10230. gbvrt470.seq - Other vertebrate sequence entries, part 470.
10231. gbvrt471.seq - Other vertebrate sequence entries, part 471.
10232. gbvrt472.seq - Other vertebrate sequence entries, part 472.
10233. gbvrt473.seq - Other vertebrate sequence entries, part 473.
10234. gbvrt474.seq - Other vertebrate sequence entries, part 474.
10235. gbvrt475.seq - Other vertebrate sequence entries, part 475.
10236. gbvrt476.seq - Other vertebrate sequence entries, part 476.
10237. gbvrt477.seq - Other vertebrate sequence entries, part 477.
10238. gbvrt478.seq - Other vertebrate sequence entries, part 478.
10239. gbvrt479.seq - Other vertebrate sequence entries, part 479.
10240. gbvrt48.seq - Other vertebrate sequence entries, part 48.
10241. gbvrt480.seq - Other vertebrate sequence entries, part 480.
10242. gbvrt481.seq - Other vertebrate sequence entries, part 481.
10243. gbvrt482.seq - Other vertebrate sequence entries, part 482.
10244. gbvrt483.seq - Other vertebrate sequence entries, part 483.
10245. gbvrt484.seq - Other vertebrate sequence entries, part 484.
10246. gbvrt485.seq - Other vertebrate sequence entries, part 485.
10247. gbvrt486.seq - Other vertebrate sequence entries, part 486.
10248. gbvrt487.seq - Other vertebrate sequence entries, part 487.
10249. gbvrt488.seq - Other vertebrate sequence entries, part 488.
10250. gbvrt489.seq - Other vertebrate sequence entries, part 489.
10251. gbvrt49.seq - Other vertebrate sequence entries, part 49.
10252. gbvrt490.seq - Other vertebrate sequence entries, part 490.
10253. gbvrt491.seq - Other vertebrate sequence entries, part 491.
10254. gbvrt492.seq - Other vertebrate sequence entries, part 492.
10255. gbvrt493.seq - Other vertebrate sequence entries, part 493.
10256. gbvrt494.seq - Other vertebrate sequence entries, part 494.
10257. gbvrt495.seq - Other vertebrate sequence entries, part 495.
10258. gbvrt496.seq - Other vertebrate sequence entries, part 496.
10259. gbvrt497.seq - Other vertebrate sequence entries, part 497.
10260. gbvrt498.seq - Other vertebrate sequence entries, part 498.
10261. gbvrt499.seq - Other vertebrate sequence entries, part 499.
10262. gbvrt5.seq - Other vertebrate sequence entries, part 5.
10263. gbvrt50.seq - Other vertebrate sequence entries, part 50.
10264. gbvrt500.seq - Other vertebrate sequence entries, part 500.
10265. gbvrt501.seq - Other vertebrate sequence entries, part 501.
10266. gbvrt502.seq - Other vertebrate sequence entries, part 502.
10267. gbvrt503.seq - Other vertebrate sequence entries, part 503.
10268. gbvrt504.seq - Other vertebrate sequence entries, part 504.
10269. gbvrt505.seq - Other vertebrate sequence entries, part 505.
10270. gbvrt506.seq - Other vertebrate sequence entries, part 506.
10271. gbvrt507.seq - Other vertebrate sequence entries, part 507.
10272. gbvrt508.seq - Other vertebrate sequence entries, part 508.
10273. gbvrt509.seq - Other vertebrate sequence entries, part 509.
10274. gbvrt51.seq - Other vertebrate sequence entries, part 51.
10275. gbvrt510.seq - Other vertebrate sequence entries, part 510.
10276. gbvrt511.seq - Other vertebrate sequence entries, part 511.
10277. gbvrt512.seq - Other vertebrate sequence entries, part 512.
10278. gbvrt513.seq - Other vertebrate sequence entries, part 513.
10279. gbvrt514.seq - Other vertebrate sequence entries, part 514.
10280. gbvrt515.seq - Other vertebrate sequence entries, part 515.
10281. gbvrt516.seq - Other vertebrate sequence entries, part 516.
10282. gbvrt517.seq - Other vertebrate sequence entries, part 517.
10283. gbvrt518.seq - Other vertebrate sequence entries, part 518.
10284. gbvrt519.seq - Other vertebrate sequence entries, part 519.
10285. gbvrt52.seq - Other vertebrate sequence entries, part 52.
10286. gbvrt520.seq - Other vertebrate sequence entries, part 520.
10287. gbvrt521.seq - Other vertebrate sequence entries, part 521.
10288. gbvrt522.seq - Other vertebrate sequence entries, part 522.
10289. gbvrt523.seq - Other vertebrate sequence entries, part 523.
10290. gbvrt524.seq - Other vertebrate sequence entries, part 524.
10291. gbvrt525.seq - Other vertebrate sequence entries, part 525.
10292. gbvrt526.seq - Other vertebrate sequence entries, part 526.
10293. gbvrt527.seq - Other vertebrate sequence entries, part 527.
10294. gbvrt528.seq - Other vertebrate sequence entries, part 528.
10295. gbvrt529.seq - Other vertebrate sequence entries, part 529.
10296. gbvrt53.seq - Other vertebrate sequence entries, part 53.
10297. gbvrt530.seq - Other vertebrate sequence entries, part 530.
10298. gbvrt531.seq - Other vertebrate sequence entries, part 531.
10299. gbvrt532.seq - Other vertebrate sequence entries, part 532.
10300. gbvrt533.seq - Other vertebrate sequence entries, part 533.
10301. gbvrt534.seq - Other vertebrate sequence entries, part 534.
10302. gbvrt535.seq - Other vertebrate sequence entries, part 535.
10303. gbvrt536.seq - Other vertebrate sequence entries, part 536.
10304. gbvrt537.seq - Other vertebrate sequence entries, part 537.
10305. gbvrt538.seq - Other vertebrate sequence entries, part 538.
10306. gbvrt539.seq - Other vertebrate sequence entries, part 539.
10307. gbvrt54.seq - Other vertebrate sequence entries, part 54.
10308. gbvrt540.seq - Other vertebrate sequence entries, part 540.
10309. gbvrt541.seq - Other vertebrate sequence entries, part 541.
10310. gbvrt542.seq - Other vertebrate sequence entries, part 542.
10311. gbvrt543.seq - Other vertebrate sequence entries, part 543.
10312. gbvrt544.seq - Other vertebrate sequence entries, part 544.
10313. gbvrt545.seq - Other vertebrate sequence entries, part 545.
10314. gbvrt546.seq - Other vertebrate sequence entries, part 546.
10315. gbvrt547.seq - Other vertebrate sequence entries, part 547.
10316. gbvrt548.seq - Other vertebrate sequence entries, part 548.
10317. gbvrt549.seq - Other vertebrate sequence entries, part 549.
10318. gbvrt55.seq - Other vertebrate sequence entries, part 55.
10319. gbvrt550.seq - Other vertebrate sequence entries, part 550.
10320. gbvrt551.seq - Other vertebrate sequence entries, part 551.
10321. gbvrt552.seq - Other vertebrate sequence entries, part 552.
10322. gbvrt553.seq - Other vertebrate sequence entries, part 553.
10323. gbvrt554.seq - Other vertebrate sequence entries, part 554.
10324. gbvrt555.seq - Other vertebrate sequence entries, part 555.
10325. gbvrt556.seq - Other vertebrate sequence entries, part 556.
10326. gbvrt557.seq - Other vertebrate sequence entries, part 557.
10327. gbvrt558.seq - Other vertebrate sequence entries, part 558.
10328. gbvrt559.seq - Other vertebrate sequence entries, part 559.
10329. gbvrt56.seq - Other vertebrate sequence entries, part 56.
10330. gbvrt560.seq - Other vertebrate sequence entries, part 560.
10331. gbvrt561.seq - Other vertebrate sequence entries, part 561.
10332. gbvrt562.seq - Other vertebrate sequence entries, part 562.
10333. gbvrt563.seq - Other vertebrate sequence entries, part 563.
10334. gbvrt564.seq - Other vertebrate sequence entries, part 564.
10335. gbvrt565.seq - Other vertebrate sequence entries, part 565.
10336. gbvrt566.seq - Other vertebrate sequence entries, part 566.
10337. gbvrt567.seq - Other vertebrate sequence entries, part 567.
10338. gbvrt568.seq - Other vertebrate sequence entries, part 568.
10339. gbvrt569.seq - Other vertebrate sequence entries, part 569.
10340. gbvrt57.seq - Other vertebrate sequence entries, part 57.
10341. gbvrt570.seq - Other vertebrate sequence entries, part 570.
10342. gbvrt571.seq - Other vertebrate sequence entries, part 571.
10343. gbvrt572.seq - Other vertebrate sequence entries, part 572.
10344. gbvrt573.seq - Other vertebrate sequence entries, part 573.
10345. gbvrt574.seq - Other vertebrate sequence entries, part 574.
10346. gbvrt575.seq - Other vertebrate sequence entries, part 575.
10347. gbvrt58.seq - Other vertebrate sequence entries, part 58.
10348. gbvrt59.seq - Other vertebrate sequence entries, part 59.
10349. gbvrt6.seq - Other vertebrate sequence entries, part 6.
10350. gbvrt60.seq - Other vertebrate sequence entries, part 60.
10351. gbvrt61.seq - Other vertebrate sequence entries, part 61.
10352. gbvrt62.seq - Other vertebrate sequence entries, part 62.
10353. gbvrt63.seq - Other vertebrate sequence entries, part 63.
10354. gbvrt64.seq - Other vertebrate sequence entries, part 64.
10355. gbvrt65.seq - Other vertebrate sequence entries, part 65.
10356. gbvrt66.seq - Other vertebrate sequence entries, part 66.
10357. gbvrt67.seq - Other vertebrate sequence entries, part 67.
10358. gbvrt68.seq - Other vertebrate sequence entries, part 68.
10359. gbvrt69.seq - Other vertebrate sequence entries, part 69.
10360. gbvrt7.seq - Other vertebrate sequence entries, part 7.
10361. gbvrt70.seq - Other vertebrate sequence entries, part 70.
10362. gbvrt71.seq - Other vertebrate sequence entries, part 71.
10363. gbvrt72.seq - Other vertebrate sequence entries, part 72.
10364. gbvrt73.seq - Other vertebrate sequence entries, part 73.
10365. gbvrt74.seq - Other vertebrate sequence entries, part 74.
10366. gbvrt75.seq - Other vertebrate sequence entries, part 75.
10367. gbvrt76.seq - Other vertebrate sequence entries, part 76.
10368. gbvrt77.seq - Other vertebrate sequence entries, part 77.
10369. gbvrt78.seq - Other vertebrate sequence entries, part 78.
10370. gbvrt79.seq - Other vertebrate sequence entries, part 79.
10371. gbvrt8.seq - Other vertebrate sequence entries, part 8.
10372. gbvrt80.seq - Other vertebrate sequence entries, part 80.
10373. gbvrt81.seq - Other vertebrate sequence entries, part 81.
10374. gbvrt82.seq - Other vertebrate sequence entries, part 82.
10375. gbvrt83.seq - Other vertebrate sequence entries, part 83.
10376. gbvrt84.seq - Other vertebrate sequence entries, part 84.
10377. gbvrt85.seq - Other vertebrate sequence entries, part 85.
10378. gbvrt86.seq - Other vertebrate sequence entries, part 86.
10379. gbvrt87.seq - Other vertebrate sequence entries, part 87.
10380. gbvrt88.seq - Other vertebrate sequence entries, part 88.
10381. gbvrt89.seq - Other vertebrate sequence entries, part 89.
10382. gbvrt9.seq - Other vertebrate sequence entries, part 9.
10383. gbvrt90.seq - Other vertebrate sequence entries, part 90.
10384. gbvrt91.seq - Other vertebrate sequence entries, part 91.
10385. gbvrt92.seq - Other vertebrate sequence entries, part 92.
10386. gbvrt93.seq - Other vertebrate sequence entries, part 93.
10387. gbvrt94.seq - Other vertebrate sequence entries, part 94.
10388. gbvrt95.seq - Other vertebrate sequence entries, part 95.
10389. gbvrt96.seq - Other vertebrate sequence entries, part 96.
10390. gbvrt97.seq - Other vertebrate sequence entries, part 97.
10391. gbvrt98.seq - Other vertebrate sequence entries, part 98.
10392. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 260.0 flatfiles require roughly 5020 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
496287178 gbbct1.seq
494252307 gbbct10.seq
497985566 gbbct100.seq
496362812 gbbct1000.se
499965956 gbbct1001.se
241784160 gbbct1002.se
487481885 gbbct1003.se
499907021 gbbct1004.se
490920292 gbbct1005.se
494565727 gbbct1006.se
307922837 gbbct1007.se
496864586 gbbct1008.se
497451348 gbbct1009.se
498936992 gbbct101.seq
499705657 gbbct1010.se
497304323 gbbct1011.se
489071996 gbbct1012.se
402245324 gbbct1013.se
485295587 gbbct1014.se
497957254 gbbct1015.se
488962001 gbbct1016.se
496580925 gbbct1017.se
278702105 gbbct1018.se
498287581 gbbct1019.se
306897259 gbbct102.seq
496413920 gbbct1020.se
486315901 gbbct1021.se
497952546 gbbct1022.se
490823685 gbbct1023.se
498864556 gbbct1024.se
498569119 gbbct1025.se
497446501 gbbct1026.se
497992940 gbbct1027.se
138760526 gbbct1028.se
494052501 gbbct1029.se
491474486 gbbct103.seq
486687699 gbbct1030.se
499789086 gbbct1031.se
487141164 gbbct1032.se
408413372 gbbct1033.se
488880735 gbbct1034.se
499347266 gbbct1035.se
494529449 gbbct1036.se
491610200 gbbct1037.se
490721932 gbbct1038.se
86529018 gbbct1039.se
494310694 gbbct104.seq
498567123 gbbct1040.se
495529311 gbbct1041.se
489903020 gbbct1042.se
495913819 gbbct1043.se
497489030 gbbct1044.se
103025934 gbbct1045.se
490096670 gbbct1046.se
493769967 gbbct1047.se
498703344 gbbct1048.se
487853604 gbbct1049.se
495814844 gbbct105.seq
442248924 gbbct1050.se
498316914 gbbct1051.se
488080043 gbbct1052.se
496859443 gbbct1053.se
492354879 gbbct1054.se
499504210 gbbct1055.se
497732328 gbbct1056.se
496412589 gbbct1057.se
344196866 gbbct1058.se
493330442 gbbct1059.se
498718759 gbbct106.seq
485808258 gbbct1060.se
489129281 gbbct1061.se
494731790 gbbct1062.se
244810971 gbbct1063.se
498720082 gbbct1064.se
498375695 gbbct1065.se
496798838 gbbct1066.se
488158907 gbbct1067.se
480710236 gbbct1068.se
88915438 gbbct1069.se
499103885 gbbct107.seq
488813276 gbbct1070.se
498905763 gbbct1071.se
496043153 gbbct1072.se
487953041 gbbct1073.se
497348333 gbbct1074.se
459587986 gbbct1075.se
497065104 gbbct1076.se
496207830 gbbct1077.se
497091224 gbbct1078.se
493317438 gbbct1079.se
261686739 gbbct108.seq
225373769 gbbct1080.se
489889416 gbbct1081.se
488595894 gbbct1082.se
492097019 gbbct1083.se
499016286 gbbct1084.se
493001251 gbbct1085.se
497021233 gbbct1086.se
75341392 gbbct1087.se
492195634 gbbct1088.se
495418776 gbbct1089.se
498131355 gbbct109.seq
497607552 gbbct1090.se
488845674 gbbct1091.se
49634820 gbbct1092.se
484950746 gbbct1093.se
493849892 gbbct1094.se
494652382 gbbct1095.se
495532726 gbbct1096.se
494378942 gbbct1097.se
498130260 gbbct1098.se
149325507 gbbct1099.se
488021801 gbbct11.seq
499519799 gbbct110.seq
305005116 gbbct1100.se
6891549 gbbct1101.se
14165728 gbbct1102.se
22799278 gbbct1103.se
44501788 gbbct1104.se
86616522 gbbct1105.se
168554519 gbbct1106.se
499997623 gbbct1107.se
492552739 gbbct1108.se
498179051 gbbct1109.se
498963367 gbbct111.seq
499251255 gbbct1110.se
498134778 gbbct1111.se
499998525 gbbct1112.se
131049345 gbbct1113.se
499998971 gbbct1114.se
492626536 gbbct1115.se
494514889 gbbct1116.se
500000181 gbbct1117.se
208846697 gbbct1118.se
499998855 gbbct1119.se
488108619 gbbct112.seq
290665907 gbbct1120.se
499999440 gbbct1121.se
85450285 gbbct1122.se
499999527 gbbct1123.se
125443734 gbbct1124.se
499998544 gbbct1125.se
43687538 gbbct1126.se
148196213 gbbct1127.se
499601204 gbbct1128.se
496959806 gbbct1129.se
397950750 gbbct113.seq
130886279 gbbct1130.se
497082557 gbbct1131.se
489911678 gbbct1132.se
494010738 gbbct1133.se
497933088 gbbct1134.se
497254623 gbbct1135.se
488464410 gbbct1136.se
305471126 gbbct1137.se
495496664 gbbct1138.se
498006029 gbbct1139.se
498261630 gbbct114.seq
498179394 gbbct1140.se
168612728 gbbct1141.se
472461650 gbbct1142.se
498353095 gbbct1143.se
494354834 gbbct1144.se
496897920 gbbct1145.se
150527887 gbbct1146.se
487524356 gbbct1147.se
490669386 gbbct1148.se
493112739 gbbct1149.se
492775885 gbbct115.seq
322802376 gbbct1150.se
498499362 gbbct1151.se
498686725 gbbct1152.se
496133880 gbbct1153.se
499010889 gbbct1154.se
91015538 gbbct1155.se
496306865 gbbct1156.se
497542063 gbbct1157.se
499041476 gbbct1158.se
243471493 gbbct1159.se
495523584 gbbct116.seq
492628077 gbbct1160.se
496920917 gbbct1161.se
498726034 gbbct1162.se
498558295 gbbct1163.se
105681277 gbbct1164.se
499379475 gbbct1165.se
499045569 gbbct1166.se
496138259 gbbct1167.se
480917975 gbbct1168.se
51247899 gbbct1169.se
300972567 gbbct117.seq
107895686 gbbct1170.se
499937592 gbbct1171.se
499998388 gbbct1172.se
420981112 gbbct1173.se
499997337 gbbct1174.se
499998352 gbbct1175.se
499999552 gbbct1176.se
499952650 gbbct1177.se
495898806 gbbct1178.se
297551787 gbbct1179.se
491271704 gbbct118.seq
496928169 gbbct1180.se
498809575 gbbct1181.se
497701955 gbbct1182.se
497288384 gbbct1183.se
497076187 gbbct1184.se
490313192 gbbct1185.se
147313851 gbbct1186.se
498338739 gbbct1187.se
498433841 gbbct1188.se
495474043 gbbct1189.se
498541367 gbbct119.seq
497231916 gbbct1190.se
122463870 gbbct1191.se
499023843 gbbct1192.se
498317346 gbbct1193.se
497455603 gbbct1194.se
441278764 gbbct1195.se
495797802 gbbct1196.se
499268668 gbbct1197.se
498072813 gbbct1198.se
497105749 gbbct1199.se
497611603 gbbct12.seq
498012873 gbbct120.seq
499992029 gbbct1200.se
16749202 gbbct1201.se
92795209 gbbct121.seq
489628699 gbbct122.seq
499324337 gbbct123.seq
494929667 gbbct124.seq
265604294 gbbct125.seq
499874269 gbbct126.seq
499262998 gbbct127.seq
499292951 gbbct128.seq
491408959 gbbct129.seq
53797929 gbbct13.seq
13752576 gbbct130.seq
493589580 gbbct131.seq
494743921 gbbct132.seq
495417049 gbbct133.seq
491069774 gbbct134.seq
195549944 gbbct135.seq
494137417 gbbct136.seq
492532726 gbbct137.seq
495041732 gbbct138.seq
487010439 gbbct139.seq
491782812 gbbct14.seq
24639450 gbbct140.seq
499011110 gbbct141.seq
494100520 gbbct142.seq
498830195 gbbct143.seq
333294047 gbbct144.seq
490710505 gbbct145.seq
498618665 gbbct146.seq
488692906 gbbct147.seq
494287785 gbbct148.seq
18986455 gbbct149.seq
498493275 gbbct15.seq
495983596 gbbct150.seq
489371941 gbbct151.seq
487156770 gbbct152.seq
496236620 gbbct153.seq
497104744 gbbct154.seq
488626990 gbbct155.seq
425698525 gbbct156.seq
498289543 gbbct157.seq
489448480 gbbct158.seq
499735002 gbbct159.seq
495092987 gbbct16.seq
461302583 gbbct160.seq
495776225 gbbct161.seq
493829919 gbbct162.seq
491661553 gbbct163.seq
498685718 gbbct164.seq
499806129 gbbct165.seq
147979379 gbbct166.seq
497197592 gbbct167.seq
494838837 gbbct168.seq
493252162 gbbct169.seq
494426713 gbbct17.seq
494938087 gbbct170.seq
404787642 gbbct171.seq
489367719 gbbct172.seq
490447415 gbbct173.seq
488202438 gbbct174.seq
496590169 gbbct175.seq
497571141 gbbct176.seq
443840966 gbbct177.seq
497283776 gbbct178.seq
494967884 gbbct179.seq
128500945 gbbct18.seq
487708276 gbbct180.seq
498243616 gbbct181.seq
495949065 gbbct182.seq
498199776 gbbct183.seq
192990964 gbbct184.seq
494757634 gbbct185.seq
491514316 gbbct186.seq
499168986 gbbct187.seq
486267941 gbbct188.seq
497456534 gbbct189.seq
494541260 gbbct19.seq
491062217 gbbct190.seq
495175628 gbbct191.seq
498913494 gbbct192.seq
23086746 gbbct193.seq
493968442 gbbct194.seq
480244396 gbbct195.seq
494911427 gbbct196.seq
495985799 gbbct197.seq
204649716 gbbct198.seq
493675946 gbbct199.seq
496211451 gbbct2.seq
496123444 gbbct20.seq
491173651 gbbct200.seq
499375502 gbbct201.seq
273476043 gbbct202.seq
495005792 gbbct203.seq
495932946 gbbct204.seq
489790171 gbbct205.seq
303707270 gbbct206.seq
499227728 gbbct207.seq
499997437 gbbct208.seq
495765211 gbbct209.seq
490072401 gbbct21.seq
496021892 gbbct210.seq
78326746 gbbct211.seq
498037177 gbbct212.seq
499411133 gbbct213.seq
492695635 gbbct214.seq
498018382 gbbct215.seq
490659501 gbbct216.seq
223651027 gbbct217.seq
498767453 gbbct218.seq
497238762 gbbct219.seq
499143021 gbbct22.seq
494572644 gbbct220.seq
497330404 gbbct221.seq
275862677 gbbct222.seq
495095493 gbbct223.seq
495971852 gbbct224.seq
496465144 gbbct225.seq
499477316 gbbct226.seq
258503230 gbbct227.seq
499818455 gbbct228.seq
497426013 gbbct229.seq
147824787 gbbct23.seq
497029407 gbbct230.seq
497534555 gbbct231.seq
440229874 gbbct232.seq
499335074 gbbct233.seq
499195099 gbbct234.seq
491642061 gbbct235.seq
492380565 gbbct236.seq
499897679 gbbct237.seq
493329011 gbbct238.seq
411207392 gbbct239.seq
492482066 gbbct24.seq
497109684 gbbct240.seq
493797293 gbbct241.seq
496714946 gbbct242.seq
378276833 gbbct243.seq
484833418 gbbct244.seq
495933660 gbbct245.seq
496841580 gbbct246.seq
499799747 gbbct247.seq
241101627 gbbct248.seq
494770130 gbbct249.seq
490124704 gbbct25.seq
490933060 gbbct250.seq
491178266 gbbct251.seq
207236540 gbbct252.seq
493892730 gbbct253.seq
496233174 gbbct254.seq
499658653 gbbct255.seq
495112805 gbbct256.seq
184138816 gbbct257.seq
494063188 gbbct258.seq
488281809 gbbct259.seq
498215012 gbbct26.seq
489824741 gbbct260.seq
488530738 gbbct261.seq
157432032 gbbct262.seq
483160900 gbbct263.seq
493212976 gbbct264.seq
489922760 gbbct265.seq
495741984 gbbct266.seq
65305285 gbbct267.seq
492193971 gbbct268.seq
487559489 gbbct269.seq
492065538 gbbct27.seq
492444592 gbbct270.seq
467376654 gbbct271.seq
498159122 gbbct272.seq
490705586 gbbct273.seq
496101837 gbbct274.seq
494853089 gbbct275.seq
496630896 gbbct276.seq
145951585 gbbct277.seq
492031399 gbbct278.seq
498469135 gbbct279.seq
484403607 gbbct28.seq
484960266 gbbct280.seq
462509816 gbbct281.seq
497610739 gbbct282.seq
496248013 gbbct283.seq
496576110 gbbct284.seq
492200324 gbbct285.seq
79411871 gbbct286.seq
496061758 gbbct287.seq
492890776 gbbct288.seq
496405538 gbbct289.seq
60915698 gbbct29.seq
492437035 gbbct290.seq
491980814 gbbct291.seq
499779547 gbbct292.seq
493162881 gbbct293.seq
301876942 gbbct294.seq
499672832 gbbct295.seq
493482197 gbbct296.seq
491572664 gbbct297.seq
414251019 gbbct298.seq
497188760 gbbct299.seq
306982367 gbbct3.seq
490496973 gbbct30.seq
496648115 gbbct300.seq
496913431 gbbct301.seq
468997161 gbbct302.seq
495339097 gbbct303.seq
499422165 gbbct304.seq
499643473 gbbct305.seq
499684846 gbbct306.seq
41768798 gbbct307.seq
496934774 gbbct308.seq
495160495 gbbct309.seq
493807118 gbbct31.seq
499828705 gbbct310.seq
494345275 gbbct311.seq
96357788 gbbct312.seq
498905811 gbbct313.seq
490840163 gbbct314.seq
495726928 gbbct315.seq
488834247 gbbct316.seq
489385997 gbbct317.seq
489621383 gbbct318.seq
394578864 gbbct319.seq
480651846 gbbct32.seq
492233252 gbbct320.seq
490787305 gbbct321.seq
493826897 gbbct322.seq
499495355 gbbct323.seq
419419915 gbbct324.seq
493089434 gbbct325.seq
494047950 gbbct326.seq
489966771 gbbct327.seq
493459402 gbbct328.seq
449948014 gbbct329.seq
497456823 gbbct33.seq
498703691 gbbct330.seq
497743974 gbbct331.seq
489574438 gbbct332.seq
495982538 gbbct333.seq
498393188 gbbct334.seq
23849985 gbbct335.seq
498785988 gbbct336.seq
497116267 gbbct337.seq
497441863 gbbct338.seq
497888957 gbbct339.seq
156444864 gbbct34.seq
404226261 gbbct340.seq
491217162 gbbct341.seq
490815943 gbbct342.seq
491231601 gbbct343.seq
495603079 gbbct344.seq
499559349 gbbct345.seq
172565099 gbbct346.seq
495566496 gbbct347.seq
494438770 gbbct348.seq
495091042 gbbct349.seq
489377681 gbbct35.seq
498263560 gbbct350.seq
263588689 gbbct351.seq
498444518 gbbct352.seq
488346394 gbbct353.seq
490826009 gbbct354.seq
490002121 gbbct355.seq
498584108 gbbct356.seq
34513818 gbbct357.seq
494686646 gbbct358.seq
492315257 gbbct359.seq
493023040 gbbct36.seq
497177727 gbbct360.seq
498199987 gbbct361.seq
496450834 gbbct362.seq
499463057 gbbct363.seq
496402256 gbbct364.seq
380192201 gbbct365.seq
497476174 gbbct366.seq
497184589 gbbct367.seq
490324957 gbbct368.seq
499750408 gbbct369.seq
491085315 gbbct37.seq
494815524 gbbct370.seq
494368852 gbbct371.seq
296175547 gbbct372.seq
499934220 gbbct373.seq
494918479 gbbct374.seq
499105302 gbbct375.seq
488455811 gbbct376.seq
497844006 gbbct377.seq
63763834 gbbct378.seq
499660347 gbbct379.seq
499929213 gbbct38.seq
492399147 gbbct380.seq
494459355 gbbct381.seq
499024271 gbbct382.seq
499090333 gbbct383.seq
499519156 gbbct384.seq
498494475 gbbct385.seq
44978842 gbbct386.seq
496486900 gbbct387.seq
499584365 gbbct388.seq
493277883 gbbct389.seq
458147042 gbbct39.seq
498905688 gbbct390.seq
239477237 gbbct391.seq
498729336 gbbct392.seq
490199199 gbbct393.seq
491454197 gbbct394.seq
499237446 gbbct395.seq
169554493 gbbct396.seq
497759841 gbbct397.seq
496982014 gbbct398.seq
492202185 gbbct399.seq
394766098 gbbct4.seq
486859082 gbbct40.seq
496555435 gbbct400.seq
497898531 gbbct401.seq
488975488 gbbct402.seq
499658208 gbbct403.seq
252733250 gbbct404.seq
497028059 gbbct405.seq
495273099 gbbct406.seq
487707838 gbbct407.seq
490129774 gbbct408.seq
492973420 gbbct409.seq
493062757 gbbct41.seq
497851540 gbbct410.seq
488688528 gbbct411.seq
55716177 gbbct412.seq
489741626 gbbct413.seq
489855464 gbbct414.seq
487046945 gbbct415.seq
487809563 gbbct416.seq
489424912 gbbct417.seq
285123482 gbbct418.seq
496006336 gbbct419.seq
497593190 gbbct42.seq
499738879 gbbct420.seq
498949655 gbbct421.seq
499696916 gbbct422.seq
499675367 gbbct423.seq
493594960 gbbct424.seq
281241371 gbbct425.seq
492474819 gbbct426.seq
493348301 gbbct427.seq
499433263 gbbct428.seq
499804088 gbbct429.seq
497599246 gbbct43.seq
497607962 gbbct430.seq
493329202 gbbct431.seq
489095235 gbbct432.seq
218287198 gbbct433.seq
497624057 gbbct434.seq
499092545 gbbct435.seq
495168521 gbbct436.seq
498412076 gbbct437.seq
494851599 gbbct438.seq
97103164 gbbct439.seq
150691069 gbbct44.seq
498860397 gbbct440.seq
497205565 gbbct441.seq
499844044 gbbct442.seq
496022913 gbbct443.seq
472540173 gbbct444.seq
498899686 gbbct445.seq
494286487 gbbct446.seq
496090339 gbbct447.seq
496388697 gbbct448.seq
308316949 gbbct449.seq
499427339 gbbct45.seq
495477408 gbbct450.seq
492644393 gbbct451.seq
497637802 gbbct452.seq
486496075 gbbct453.seq
411107174 gbbct454.seq
492341559 gbbct455.seq
496407771 gbbct456.seq
499836431 gbbct457.seq
499613578 gbbct458.seq
177084086 gbbct459.seq
489001679 gbbct46.seq
494159514 gbbct460.seq
494447782 gbbct461.seq
493701383 gbbct462.seq
499969675 gbbct463.seq
27014882 gbbct464.seq
493433738 gbbct465.seq
492700729 gbbct466.seq
497334211 gbbct467.seq
497146734 gbbct468.seq
497594418 gbbct469.seq
493930026 gbbct47.seq
328581942 gbbct470.seq
498313678 gbbct471.seq
498681410 gbbct472.seq
499281238 gbbct473.seq
489146170 gbbct474.seq
496938156 gbbct475.seq
497700245 gbbct476.seq
326142728 gbbct477.seq
497824575 gbbct478.seq
492957955 gbbct479.seq
422791690 gbbct48.seq
499833240 gbbct480.seq
493523696 gbbct481.seq
86825136 gbbct482.seq
485664252 gbbct483.seq
492762413 gbbct484.seq
493976820 gbbct485.seq
498624920 gbbct486.seq
495051074 gbbct487.seq
487461729 gbbct488.seq
498156344 gbbct489.seq
487126791 gbbct49.seq
496028769 gbbct490.seq
491749735 gbbct491.seq
498276907 gbbct492.seq
242945388 gbbct493.seq
488399361 gbbct494.seq
497609771 gbbct495.seq
493602123 gbbct496.seq
499477169 gbbct497.seq
490837891 gbbct498.seq
457708752 gbbct499.seq
440881567 gbbct5.seq
497002990 gbbct50.seq
494383928 gbbct500.seq
493402330 gbbct501.seq
495774412 gbbct502.seq
498340162 gbbct503.seq
225257265 gbbct504.seq
499854501 gbbct505.seq
493894094 gbbct506.seq
494717321 gbbct507.seq
494636787 gbbct508.seq
66755510 gbbct509.seq
494993905 gbbct51.seq
499644992 gbbct510.seq
495494012 gbbct511.seq
496185227 gbbct512.seq
498591418 gbbct513.seq
207264163 gbbct514.seq
490781428 gbbct515.seq
491825514 gbbct516.seq
497965134 gbbct517.seq
493465756 gbbct518.seq
495756445 gbbct519.seq
496658325 gbbct52.seq
489031514 gbbct520.seq
324241305 gbbct521.seq
496815387 gbbct522.seq
495894844 gbbct523.seq
496919257 gbbct524.seq
498915366 gbbct525.seq
490956192 gbbct526.seq
487289412 gbbct527.seq
499232993 gbbct528.seq
20072397 gbbct529.seq
355502793 gbbct53.seq
499107724 gbbct530.seq
498327939 gbbct531.seq
487513843 gbbct532.seq
499771125 gbbct533.seq
180056506 gbbct534.seq
495729672 gbbct535.seq
499956642 gbbct536.seq
491684752 gbbct537.seq
499940634 gbbct538.seq
178743780 gbbct539.seq
493214445 gbbct54.seq
489613825 gbbct540.seq
496013526 gbbct541.seq
497792053 gbbct542.seq
492186264 gbbct543.seq
493342388 gbbct544.seq
497350442 gbbct545.seq
489375163 gbbct546.seq
200235524 gbbct547.seq
498069933 gbbct548.seq
491392893 gbbct549.seq
489295405 gbbct55.seq
493157818 gbbct550.seq
490957679 gbbct551.seq
495408257 gbbct552.seq
487407958 gbbct553.seq
79579587 gbbct554.seq
498600338 gbbct555.seq
499966991 gbbct556.seq
498301065 gbbct557.seq
489056192 gbbct558.seq
497247109 gbbct559.seq
492859989 gbbct56.seq
182974922 gbbct560.seq
499605229 gbbct561.seq
498413363 gbbct562.seq
494321141 gbbct563.seq
488737962 gbbct564.seq
493654397 gbbct565.seq
492441672 gbbct566.seq
227319570 gbbct567.seq
489360452 gbbct568.seq
496232132 gbbct569.seq
496347182 gbbct57.seq
499644047 gbbct570.seq
499053621 gbbct571.seq
347744399 gbbct572.seq
497665012 gbbct573.seq
498846279 gbbct574.seq
496910394 gbbct575.seq
497597366 gbbct576.seq
490846807 gbbct577.seq
441215744 gbbct578.seq
499933080 gbbct579.seq
497764657 gbbct58.seq
492754222 gbbct580.seq
490407083 gbbct581.seq
497293274 gbbct582.seq
496382627 gbbct583.seq
65191689 gbbct584.seq
492186833 gbbct585.seq
494015530 gbbct586.seq
496612101 gbbct587.seq
499928513 gbbct588.seq
499346460 gbbct589.seq
499974435 gbbct59.seq
84038456 gbbct590.seq
498299546 gbbct591.seq
497665812 gbbct592.seq
495789156 gbbct593.seq
498920659 gbbct594.seq
490859835 gbbct595.seq
497455540 gbbct596.seq
291276486 gbbct597.seq
499291931 gbbct598.seq
496184725 gbbct599.seq
102349966 gbbct6.seq
251724694 gbbct60.seq
497684555 gbbct600.seq
494237521 gbbct601.seq
493055862 gbbct602.seq
370271790 gbbct603.seq
496709072 gbbct604.seq
497463400 gbbct605.seq
497716036 gbbct606.seq
499783508 gbbct607.seq
498704319 gbbct608.seq
493521081 gbbct609.seq
21423513 gbbct61.seq
412974908 gbbct610.seq
498977008 gbbct611.seq
489139156 gbbct612.seq
498929930 gbbct613.seq
496323535 gbbct614.seq
493188592 gbbct615.seq
331826220 gbbct616.seq
495637102 gbbct617.seq
497904827 gbbct618.seq
497941545 gbbct619.seq
38673495 gbbct62.seq
496364847 gbbct620.seq
299920780 gbbct621.seq
494009530 gbbct622.seq
494634341 gbbct623.seq
493680575 gbbct624.seq
495249687 gbbct625.seq
336973710 gbbct626.seq
490780930 gbbct627.seq
491958315 gbbct628.seq
493755472 gbbct629.seq
499581734 gbbct63.seq
496675611 gbbct630.seq
8691501 gbbct631.seq
489363579 gbbct632.seq
498539049 gbbct633.seq
495886964 gbbct634.seq
498572123 gbbct635.seq
118171825 gbbct636.seq
498744177 gbbct637.seq
496347095 gbbct638.seq
497967870 gbbct639.seq
484470178 gbbct64.seq
499466505 gbbct640.seq
151864087 gbbct641.seq
499234904 gbbct642.seq
497360436 gbbct643.seq
498571346 gbbct644.seq
494200871 gbbct645.seq
498167631 gbbct646.seq
115652733 gbbct647.seq
499500345 gbbct648.seq
499024240 gbbct649.seq
495470178 gbbct65.seq
498504839 gbbct650.seq
492505677 gbbct651.seq
435599661 gbbct652.seq
496593582 gbbct653.seq
489654969 gbbct654.seq
495682691 gbbct655.seq
496837809 gbbct656.seq
499832379 gbbct657.seq
257450135 gbbct658.seq
489897285 gbbct659.seq
480119351 gbbct66.seq
487794703 gbbct660.seq
490412388 gbbct661.seq
498964778 gbbct662.seq
86369099 gbbct663.seq
498236694 gbbct664.seq
499932377 gbbct665.seq
495968096 gbbct666.seq
498905950 gbbct667.seq
490031347 gbbct668.seq
53951819 gbbct669.seq
499782379 gbbct67.seq
492741697 gbbct670.seq
494948998 gbbct671.seq
496173329 gbbct672.seq
497056597 gbbct673.seq
492511718 gbbct674.seq
190304579 gbbct675.seq
486682807 gbbct676.seq
499351047 gbbct677.seq
488816854 gbbct678.seq
495179308 gbbct679.seq
499379755 gbbct68.seq
86022844 gbbct680.seq
492651932 gbbct681.seq
490980118 gbbct682.seq
489246739 gbbct683.seq
499239895 gbbct684.seq
373665763 gbbct685.seq
484560036 gbbct686.seq
496483779 gbbct687.seq
499170141 gbbct688.seq
499849805 gbbct689.seq
496319170 gbbct69.seq
496930689 gbbct690.seq
77480547 gbbct691.seq
490730264 gbbct692.seq
484804752 gbbct693.seq
495815674 gbbct694.seq
494968964 gbbct695.seq
499117399 gbbct696.seq
470832214 gbbct697.seq
498585011 gbbct698.seq
490185585 gbbct699.seq
282572292 gbbct7.seq
493547495 gbbct70.seq
496766470 gbbct700.seq
493633651 gbbct701.seq
448568712 gbbct702.seq
495687276 gbbct703.seq
499162833 gbbct704.seq
497361325 gbbct705.seq
485427063 gbbct706.seq
496502443 gbbct707.seq
494013928 gbbct708.seq
498751351 gbbct709.seq
496583296 gbbct71.seq
134600985 gbbct710.seq
489500728 gbbct711.seq
499402390 gbbct712.seq
491721551 gbbct713.seq
491499364 gbbct714.seq
497510258 gbbct715.seq
149306247 gbbct716.seq
489374489 gbbct717.seq
497451108 gbbct718.seq
496794678 gbbct719.seq
328859600 gbbct72.seq
493494360 gbbct720.seq
384421334 gbbct721.seq
497700125 gbbct722.seq
488532823 gbbct723.seq
492470395 gbbct724.seq
499420581 gbbct725.seq
490827314 gbbct726.seq
494681775 gbbct727.seq
403377416 gbbct728.seq
499130334 gbbct729.seq
496359235 gbbct73.seq
496018987 gbbct730.seq
497460894 gbbct731.seq
498976892 gbbct732.seq
200306245 gbbct733.seq
495669263 gbbct734.seq
496736764 gbbct735.seq
499472704 gbbct736.seq
496906539 gbbct737.seq
265602948 gbbct738.seq
489239513 gbbct739.seq
491310628 gbbct74.seq
495250207 gbbct740.seq
496364572 gbbct741.seq
498966707 gbbct742.seq
498472004 gbbct743.seq
491679988 gbbct744.seq
210465085 gbbct745.seq
497477929 gbbct746.seq
499954401 gbbct747.seq
498848686 gbbct748.seq
494646909 gbbct749.seq
499897138 gbbct75.seq
488220514 gbbct750.seq
489101643 gbbct751.seq
496928116 gbbct752.seq
499598277 gbbct753.seq
498953975 gbbct754.seq
495530526 gbbct755.seq
264656125 gbbct756.seq
498403720 gbbct757.seq
485253711 gbbct758.seq
499082940 gbbct759.seq
492176878 gbbct76.seq
499996563 gbbct760.seq
258554892 gbbct761.seq
493217012 gbbct762.seq
499473395 gbbct763.seq
497057366 gbbct764.seq
498074131 gbbct765.seq
492582914 gbbct766.seq
485827167 gbbct767.seq
61156121 gbbct768.seq
497138841 gbbct769.seq
495817498 gbbct77.seq
491235808 gbbct770.seq
498455829 gbbct771.seq
489185447 gbbct772.seq
492644404 gbbct773.seq
498753393 gbbct774.seq
488711749 gbbct775.seq
131231612 gbbct776.seq
492675721 gbbct777.seq
496014682 gbbct778.seq
496634437 gbbct779.seq
356563135 gbbct78.seq
499730148 gbbct780.seq
499290021 gbbct781.seq
498135561 gbbct782.seq
6896993 gbbct783.seq
493723515 gbbct784.seq
489427729 gbbct785.seq
493543573 gbbct786.seq
499904919 gbbct787.seq
492366323 gbbct788.seq
147332336 gbbct789.seq
499974953 gbbct79.seq
493624806 gbbct790.seq
499752905 gbbct791.seq
499573689 gbbct792.seq
497909072 gbbct793.seq
492955232 gbbct794.seq
372003106 gbbct795.seq
494266921 gbbct796.seq
499880264 gbbct797.seq
496540368 gbbct798.seq
488887473 gbbct799.seq
493067249 gbbct8.seq
492293309 gbbct80.seq
498831883 gbbct800.seq
494409623 gbbct801.seq
251776526 gbbct802.seq
497781045 gbbct803.seq
488676605 gbbct804.seq
498176921 gbbct805.seq
498718872 gbbct806.seq
165471252 gbbct807.seq
475198041 gbbct808.seq
489749636 gbbct809.seq
489450351 gbbct81.seq
499221798 gbbct810.seq
498397855 gbbct811.seq
113736284 gbbct812.seq
495181148 gbbct813.seq
499983744 gbbct814.seq
499737988 gbbct815.seq
494858412 gbbct816.seq
144089808 gbbct817.seq
491812002 gbbct818.seq
499996546 gbbct819.seq
497371935 gbbct82.seq
497819843 gbbct820.seq
494535725 gbbct821.seq
492708370 gbbct822.seq
168444592 gbbct823.seq
488652334 gbbct824.seq
488114212 gbbct825.seq
498658746 gbbct826.seq
496790303 gbbct827.seq
473913324 gbbct828.seq
497613273 gbbct829.seq
499930544 gbbct83.seq
489472553 gbbct830.seq
490799102 gbbct831.seq
499850096 gbbct832.seq
493503004 gbbct833.seq
496618856 gbbct834.seq
9377846 gbbct835.seq
499345558 gbbct836.seq
499169539 gbbct837.seq
478043660 gbbct838.seq
497899771 gbbct839.seq
495180718 gbbct84.seq
483516074 gbbct840.seq
472253235 gbbct841.seq
480467059 gbbct842.seq
484659763 gbbct843.seq
485732304 gbbct844.seq
488085463 gbbct845.seq
345073306 gbbct846.seq
485348019 gbbct847.seq
482138135 gbbct848.seq
497085295 gbbct849.seq
112142549 gbbct85.seq
484782978 gbbct850.seq
489619570 gbbct851.seq
44519635 gbbct852.seq
491997638 gbbct853.seq
486894684 gbbct854.seq
481252476 gbbct855.seq
495800065 gbbct856.seq
484019833 gbbct857.seq
77685133 gbbct858.seq
486231313 gbbct859.seq
498097197 gbbct86.seq
496223081 gbbct860.seq
491580839 gbbct861.seq
491405829 gbbct862.seq
82425700 gbbct863.seq
499290430 gbbct864.seq
496846111 gbbct865.seq
490674568 gbbct866.seq
481905885 gbbct867.seq
99618161 gbbct868.seq
493058565 gbbct869.seq
499071341 gbbct87.seq
491515521 gbbct870.seq
489464345 gbbct871.seq
495754091 gbbct872.seq
498217145 gbbct873.seq
365656348 gbbct874.seq
491116523 gbbct875.seq
482359949 gbbct876.seq
488081602 gbbct877.seq
493545463 gbbct878.seq
497142631 gbbct879.seq
496564072 gbbct88.seq
179858777 gbbct880.seq
487663562 gbbct881.seq
495543766 gbbct882.seq
498277753 gbbct883.seq
493023124 gbbct884.seq
392707600 gbbct885.seq
488631829 gbbct886.seq
496429393 gbbct887.seq
497402677 gbbct888.seq
494685238 gbbct889.seq
497568359 gbbct89.seq
496880322 gbbct890.seq
117662656 gbbct891.seq
493018997 gbbct892.seq
496817458 gbbct893.seq
493468147 gbbct894.seq
491334180 gbbct895.seq
480233722 gbbct896.seq
175201164 gbbct897.seq
497451646 gbbct898.seq
498955346 gbbct899.seq
493342275 gbbct9.seq
499752716 gbbct90.seq
497327305 gbbct900.seq
491770543 gbbct901.seq
66799543 gbbct902.seq
489461438 gbbct903.seq
494810266 gbbct904.seq
494580291 gbbct905.seq
492413084 gbbct906.seq
106734177 gbbct907.seq
497427384 gbbct908.seq
490667284 gbbct909.seq
490382403 gbbct91.seq
499855884 gbbct910.seq
496890016 gbbct911.seq
493067467 gbbct912.seq
16855374 gbbct913.seq
483835772 gbbct914.seq
499918812 gbbct915.seq
496491202 gbbct916.seq
489675933 gbbct917.seq
492129996 gbbct918.seq
490226088 gbbct919.seq
257412316 gbbct92.seq
159226279 gbbct920.seq
480793665 gbbct921.seq
494983594 gbbct922.seq
485761111 gbbct923.seq
496556611 gbbct924.seq
494932487 gbbct925.seq
389974863 gbbct926.seq
489154742 gbbct927.seq
487544278 gbbct928.seq
495478103 gbbct929.seq
499973085 gbbct93.seq
499621470 gbbct930.seq
490914707 gbbct931.seq
171976605 gbbct932.seq
496624355 gbbct933.seq
498116856 gbbct934.seq
491209216 gbbct935.seq
498877765 gbbct936.seq
49427303 gbbct937.seq
497824019 gbbct938.seq
498787105 gbbct939.seq
495194777 gbbct94.seq
498532955 gbbct940.seq
495177466 gbbct941.seq
24930260 gbbct942.seq
497808297 gbbct943.seq
498867072 gbbct944.seq
497996169 gbbct945.seq
495650587 gbbct946.seq
307797559 gbbct947.seq
490110312 gbbct948.seq
496368345 gbbct949.seq
486287664 gbbct95.seq
488326747 gbbct950.seq
493611670 gbbct951.seq
494466968 gbbct952.seq
496923040 gbbct953.seq
498291750 gbbct954.seq
197946855 gbbct955.seq
497030883 gbbct956.seq
488530172 gbbct957.seq
494348783 gbbct958.seq
489732336 gbbct959.seq
493211142 gbbct96.seq
491443011 gbbct960.seq
475734747 gbbct961.seq
499429504 gbbct962.seq
495377414 gbbct963.seq
489344690 gbbct964.seq
497572474 gbbct965.seq
496020298 gbbct966.seq
498682158 gbbct967.seq
216798166 gbbct968.seq
491020643 gbbct969.seq
464468094 gbbct97.seq
499377837 gbbct970.seq
493967837 gbbct971.seq
495491566 gbbct972.seq
494509945 gbbct973.seq
498928512 gbbct974.seq
154447950 gbbct975.seq
496733429 gbbct976.seq
498650266 gbbct977.seq
498957817 gbbct978.seq
498914658 gbbct979.seq
490513463 gbbct98.seq
498072867 gbbct980.seq
116096552 gbbct981.seq
497234214 gbbct982.seq
488987602 gbbct983.seq
499869557 gbbct984.seq
493016900 gbbct985.seq
181046802 gbbct986.seq
491765620 gbbct987.seq
495672444 gbbct988.seq
495410596 gbbct989.seq
489868629 gbbct99.seq
492049196 gbbct990.seq
443120872 gbbct991.seq
498579030 gbbct992.seq
499594457 gbbct993.seq
493899108 gbbct994.seq
496038146 gbbct995.seq
495045229 gbbct996.seq
76329548 gbbct997.seq
497124987 gbbct998.seq
497212639 gbbct999.seq
1768401 gbchg.txt
499771713 gbcon1.seq
499001844 gbcon10.seq
499998115 gbcon100.seq
499998405 gbcon101.seq
266690984 gbcon102.seq
499999116 gbcon103.seq
499996704 gbcon104.seq
169667376 gbcon105.seq
498620364 gbcon106.seq
497628623 gbcon107.seq
499999590 gbcon108.seq
499919512 gbcon109.seq
499833079 gbcon11.seq
278371093 gbcon110.seq
499974307 gbcon111.seq
499999283 gbcon112.seq
303110806 gbcon113.seq
499999395 gbcon114.seq
499998511 gbcon115.seq
132524025 gbcon116.seq
499979980 gbcon117.seq
499999743 gbcon118.seq
499875790 gbcon119.seq
499881160 gbcon12.seq
221510544 gbcon120.seq
499999876 gbcon121.seq
499999395 gbcon122.seq
222253215 gbcon123.seq
45836617 gbcon124.seq
499957250 gbcon125.seq
499997984 gbcon126.seq
329164633 gbcon127.seq
499997617 gbcon128.seq
499998633 gbcon129.seq
498755520 gbcon13.seq
499998997 gbcon130.seq
196731466 gbcon131.seq
500000159 gbcon132.seq
499998737 gbcon133.seq
242676274 gbcon134.seq
499998901 gbcon135.seq
468781384 gbcon136.seq
499998992 gbcon137.seq
500000212 gbcon138.seq
251565376 gbcon139.seq
498692310 gbcon14.seq
500000155 gbcon140.seq
499999225 gbcon141.seq
414982161 gbcon142.seq
499999398 gbcon143.seq
499999246 gbcon144.seq
181331698 gbcon145.seq
499998259 gbcon146.seq
499998534 gbcon147.seq
23267891 gbcon148.seq
499895508 gbcon149.seq
497489461 gbcon15.seq
499998608 gbcon150.seq
410183393 gbcon151.seq
499978406 gbcon152.seq
499952180 gbcon153.seq
378810445 gbcon154.seq
499995981 gbcon155.seq
499995756 gbcon156.seq
265279813 gbcon157.seq
499999292 gbcon158.seq
499998301 gbcon159.seq
170068320 gbcon16.seq
78332616 gbcon160.seq
499997210 gbcon161.seq
499583893 gbcon162.seq
499998422 gbcon163.seq
147114423 gbcon164.seq
499889851 gbcon165.seq
499903152 gbcon166.seq
499931259 gbcon167.seq
336542204 gbcon168.seq
499997937 gbcon169.seq
499788518 gbcon17.seq
499999984 gbcon170.seq
188511440 gbcon171.seq
499998956 gbcon172.seq
499998775 gbcon173.seq
499999277 gbcon174.seq
274183756 gbcon175.seq
499999711 gbcon176.seq
499998667 gbcon177.seq
499614208 gbcon178.seq
499997402 gbcon179.seq
497451497 gbcon18.seq
146645232 gbcon180.seq
499999228 gbcon181.seq
499994813 gbcon182.seq
133042579 gbcon183.seq
499996343 gbcon184.seq
499998857 gbcon185.seq
499997907 gbcon186.seq
297643263 gbcon187.seq
499978865 gbcon188.seq
499999503 gbcon189.seq
496868398 gbcon19.seq
477852492 gbcon190.seq
500000201 gbcon191.seq
499998706 gbcon192.seq
381245142 gbcon193.seq
499991121 gbcon194.seq
499996409 gbcon195.seq
499996232 gbcon196.seq
139305368 gbcon197.seq
499998392 gbcon198.seq
499997881 gbcon199.seq
499999513 gbcon2.seq
498779375 gbcon20.seq
38637152 gbcon200.seq
499998672 gbcon201.seq
499998964 gbcon202.seq
499992879 gbcon203.seq
499999808 gbcon204.seq
499966975 gbcon205.seq
300862133 gbcon206.seq
499999940 gbcon207.seq
484916965 gbcon208.seq
499982897 gbcon209.seq
499965777 gbcon21.seq
499944208 gbcon210.seq
499998274 gbcon211.seq
4350642 gbcon212.seq
499999470 gbcon213.seq
499999019 gbcon214.seq
499997621 gbcon215.seq
13869368 gbcon216.seq
499959905 gbcon217.seq
499978447 gbcon218.seq
499998549 gbcon219.seq
182392487 gbcon22.seq
276951509 gbcon220.seq
499913241 gbcon221.seq
499856376 gbcon222.seq
499998680 gbcon223.seq
244496731 gbcon224.seq
499891387 gbcon225.seq
499999255 gbcon226.seq
499686884 gbcon227.seq
345759611 gbcon228.seq
499678868 gbcon229.seq
499998788 gbcon23.seq
499918621 gbcon230.seq
499999931 gbcon231.seq
150052843 gbcon232.seq
499859365 gbcon233.seq
499997801 gbcon234.seq
499993639 gbcon235.seq
234398663 gbcon236.seq
499995695 gbcon237.seq
499991102 gbcon238.seq
499993687 gbcon239.seq
499998935 gbcon24.seq
285765080 gbcon240.seq
499999534 gbcon25.seq
84517707 gbcon26.seq
499999901 gbcon27.seq
499502844 gbcon28.seq
498858794 gbcon29.seq
499992939 gbcon3.seq
318319660 gbcon30.seq
499998397 gbcon31.seq
135784793 gbcon32.seq
126581434 gbcon33.seq
499919147 gbcon34.seq
499998468 gbcon35.seq
27859502 gbcon36.seq
499999414 gbcon37.seq
499998297 gbcon38.seq
444127134 gbcon39.seq
106579732 gbcon4.seq
499999754 gbcon40.seq
499996186 gbcon41.seq
499996876 gbcon42.seq
43314086 gbcon43.seq
499997302 gbcon44.seq
499996762 gbcon45.seq
278164332 gbcon46.seq
499999359 gbcon47.seq
499996983 gbcon48.seq
271759840 gbcon49.seq
499940282 gbcon5.seq
499993774 gbcon50.seq
499997972 gbcon51.seq
386626626 gbcon52.seq
499998746 gbcon53.seq
499998567 gbcon54.seq
177827600 gbcon55.seq
499999775 gbcon56.seq
499998019 gbcon57.seq
240103744 gbcon58.seq
499999949 gbcon59.seq
494454779 gbcon6.seq
499999067 gbcon60.seq
337031547 gbcon61.seq
499998864 gbcon62.seq
499994811 gbcon63.seq
299682797 gbcon64.seq
500000005 gbcon65.seq
499997545 gbcon66.seq
261117917 gbcon67.seq
499995467 gbcon68.seq
499999403 gbcon69.seq
494751770 gbcon7.seq
188551188 gbcon70.seq
499996910 gbcon71.seq
499996842 gbcon72.seq
365761631 gbcon73.seq
499997884 gbcon74.seq
499996070 gbcon75.seq
387269601 gbcon76.seq
499993101 gbcon77.seq
473419617 gbcon78.seq
174082386 gbcon79.seq
499999724 gbcon8.seq
499962181 gbcon80.seq
23946021 gbcon81.seq
499982982 gbcon82.seq
204700777 gbcon83.seq
199582317 gbcon84.seq
499610606 gbcon85.seq
499993590 gbcon86.seq
339126822 gbcon87.seq
499606703 gbcon88.seq
495956208 gbcon89.seq
61944721 gbcon9.seq
499889199 gbcon90.seq
204922712 gbcon91.seq
499993525 gbcon92.seq
499999357 gbcon93.seq
499974670 gbcon94.seq
167049284 gbcon95.seq
499999630 gbcon96.seq
499999403 gbcon97.seq
134059485 gbcon98.seq
499996152 gbcon99.seq
16279 gbdel.txt
499998336 gbenv1.seq
489563333 gbenv10.seq
496837533 gbenv11.seq
495661050 gbenv12.seq
498193107 gbenv13.seq
499998018 gbenv14.seq
415207859 gbenv15.seq
499998991 gbenv16.seq
499997691 gbenv17.seq
53976913 gbenv18.seq
499999928 gbenv19.seq
499570082 gbenv2.seq
499998163 gbenv20.seq
499999897 gbenv21.seq
499997884 gbenv22.seq
5230238 gbenv23.seq
499999495 gbenv24.seq
499999831 gbenv25.seq
190625300 gbenv26.seq
499987279 gbenv27.seq
499999423 gbenv28.seq
499999611 gbenv29.seq
499622067 gbenv3.seq
84276301 gbenv30.seq
499998813 gbenv31.seq
499999787 gbenv32.seq
177747378 gbenv33.seq
499998371 gbenv34.seq
499999132 gbenv35.seq
499996755 gbenv36.seq
46488038 gbenv37.seq
500000189 gbenv38.seq
499998209 gbenv39.seq
495221181 gbenv4.seq
192975162 gbenv40.seq
499995152 gbenv41.seq
499998856 gbenv42.seq
334992176 gbenv43.seq
499997709 gbenv44.seq
500000214 gbenv45.seq
471575025 gbenv46.seq
499998597 gbenv47.seq
499997752 gbenv48.seq
338689618 gbenv49.seq
498885723 gbenv5.seq
500000064 gbenv50.seq
499999071 gbenv51.seq
394558028 gbenv52.seq
499997922 gbenv53.seq
500000261 gbenv54.seq
345566361 gbenv55.seq
499999591 gbenv56.seq
499998353 gbenv57.seq
238008735 gbenv58.seq
499998783 gbenv59.seq
497050314 gbenv6.seq
500000239 gbenv60.seq
391485704 gbenv61.seq
500000180 gbenv62.seq
499988942 gbenv63.seq
499998776 gbenv64.seq
158405175 gbenv65.seq
499998477 gbenv66.seq
500000223 gbenv67.seq
499998702 gbenv68.seq
226655873 gbenv69.seq
490690364 gbenv7.seq
499999049 gbenv70.seq
499991665 gbenv71.seq
315138336 gbenv72.seq
499999519 gbenv73.seq
499995038 gbenv74.seq
490463446 gbenv75.seq
499996300 gbenv76.seq
496406195 gbenv77.seq
499929977 gbenv78.seq
485709573 gbenv79.seq
150232843 gbenv8.seq
496910936 gbenv80.seq
497684268 gbenv81.seq
496290245 gbenv82.seq
499142611 gbenv83.seq
70467236 gbenv84.seq
499858755 gbenv85.seq
497015988 gbenv86.seq
498288229 gbenv87.seq
499488014 gbenv88.seq
60666188 gbenv89.seq
497122248 gbenv9.seq
490914790 gbenv90.seq
499978784 gbenv91.seq
499888721 gbenv92.seq
496706876 gbenv93.seq
499549122 gbenv94.seq
221729300 gbenv95.seq
499997165 gbest1.seq
499998372 gbest10.seq
35244904 gbest100.seq
500000144 gbest101.seq
499999841 gbest102.seq
499998932 gbest103.seq
499998888 gbest104.seq
27238070 gbest105.seq
499999661 gbest106.seq
499999925 gbest107.seq
499996931 gbest108.seq
499998684 gbest109.seq
499997203 gbest11.seq
9968902 gbest110.seq
499998000 gbest111.seq
499998611 gbest112.seq
499999736 gbest113.seq
499997797 gbest114.seq
21822201 gbest115.seq
500000014 gbest116.seq
499999751 gbest117.seq
499996861 gbest118.seq
18205696 gbest119.seq
475316068 gbest12.seq
499998016 gbest120.seq
499998546 gbest121.seq
499997661 gbest122.seq
69242600 gbest123.seq
499997996 gbest124.seq
499996364 gbest125.seq
223780385 gbest126.seq
499997461 gbest127.seq
499998633 gbest128.seq
195307357 gbest129.seq
499999434 gbest13.seq
499997173 gbest130.seq
499998792 gbest131.seq
499995025 gbest132.seq
499996839 gbest133.seq
85321549 gbest134.seq
499999011 gbest135.seq
500000103 gbest136.seq
499997620 gbest137.seq
499997366 gbest138.seq
104737516 gbest139.seq
249998944 gbest14.seq
499998458 gbest140.seq
499996957 gbest141.seq
499998279 gbest142.seq
499998824 gbest143.seq
29231687 gbest144.seq
499996862 gbest145.seq
499996997 gbest146.seq
499996573 gbest147.seq
499997714 gbest148.seq
31783707 gbest149.seq
499998582 gbest15.seq
499998615 gbest150.seq
500000160 gbest151.seq
499997750 gbest152.seq
324385313 gbest153.seq
499997344 gbest154.seq
499999008 gbest155.seq
499996792 gbest156.seq
499998548 gbest157.seq
26483164 gbest158.seq
500000031 gbest159.seq
499998229 gbest16.seq
499999571 gbest160.seq
499998740 gbest161.seq
499999772 gbest162.seq
11191143 gbest163.seq
499999112 gbest164.seq
499999267 gbest165.seq
499998719 gbest166.seq
499996395 gbest167.seq
86443963 gbest168.seq
500000180 gbest169.seq
421200379 gbest17.seq
499996624 gbest170.seq
499997982 gbest171.seq
499996832 gbest172.seq
120388331 gbest173.seq
499998796 gbest174.seq
499999076 gbest175.seq
500000124 gbest176.seq
500000114 gbest177.seq
65991139 gbest178.seq
499999609 gbest179.seq
499997638 gbest18.seq
403619645 gbest180.seq
500000063 gbest181.seq
500000137 gbest182.seq
499998032 gbest183.seq
499996516 gbest184.seq
42970207 gbest185.seq
499999115 gbest186.seq
499999094 gbest187.seq
499996768 gbest188.seq
499999160 gbest189.seq
499998752 gbest19.seq
42350209 gbest190.seq
499998700 gbest191.seq
499999296 gbest192.seq
499999092 gbest193.seq
500000084 gbest194.seq
11591845 gbest195.seq
499997531 gbest196.seq
499999408 gbest197.seq
499997946 gbest198.seq
499998992 gbest199.seq
499997601 gbest2.seq
262834621 gbest20.seq
28711023 gbest200.seq
499999911 gbest201.seq
499998864 gbest202.seq
500000040 gbest203.seq
500000241 gbest204.seq
34252457 gbest205.seq
13610371 gbest206.seq
500000052 gbest207.seq
499997390 gbest208.seq
328955305 gbest209.seq
499996504 gbest21.seq
499997954 gbest210.seq
500000064 gbest211.seq
321738245 gbest212.seq
499999454 gbest213.seq
499997334 gbest214.seq
267717003 gbest215.seq
499997969 gbest216.seq
499998735 gbest217.seq
270179763 gbest218.seq
499999305 gbest219.seq
499999591 gbest22.seq
499997889 gbest220.seq
499996856 gbest221.seq
499998166 gbest222.seq
52062769 gbest223.seq
499999123 gbest224.seq
499999816 gbest225.seq
499998079 gbest226.seq
499993980 gbest227.seq
47777384 gbest228.seq
499998310 gbest229.seq
244567937 gbest23.seq
499999275 gbest230.seq
176584566 gbest231.seq
500000143 gbest232.seq
499999766 gbest233.seq
499999388 gbest234.seq
478350574 gbest235.seq
499997785 gbest236.seq
499999603 gbest237.seq
499997429 gbest238.seq
462328784 gbest239.seq
499997973 gbest24.seq
499999067 gbest240.seq
499999466 gbest241.seq
499998544 gbest242.seq
495996304 gbest243.seq
499999965 gbest244.seq
499998071 gbest245.seq
499999534 gbest246.seq
499997094 gbest247.seq
25247852 gbest248.seq
499999568 gbest249.seq
500000249 gbest25.seq
499999137 gbest250.seq
497314236 gbest251.seq
499999018 gbest252.seq
499998363 gbest253.seq
499998003 gbest254.seq
499998855 gbest255.seq
21635727 gbest256.seq
499998352 gbest257.seq
499996182 gbest258.seq
499989855 gbest259.seq
499999489 gbest26.seq
499996367 gbest260.seq
76981960 gbest261.seq
499998298 gbest262.seq
499998967 gbest263.seq
499997490 gbest264.seq
499999670 gbest265.seq
15157793 gbest266.seq
499999864 gbest267.seq
499999784 gbest268.seq
499996509 gbest269.seq
500000205 gbest27.seq
500000262 gbest270.seq
61257798 gbest271.seq
499998700 gbest272.seq
499999812 gbest273.seq
499998907 gbest274.seq
122786557 gbest275.seq
499996420 gbest276.seq
499998734 gbest277.seq
499996180 gbest278.seq
499998393 gbest279.seq
49054642 gbest28.seq
54242421 gbest280.seq
499997300 gbest281.seq
499998093 gbest282.seq
499998043 gbest283.seq
499998230 gbest284.seq
57212436 gbest285.seq
499998277 gbest286.seq
499997730 gbest287.seq
499998371 gbest288.seq
499997837 gbest289.seq
499998393 gbest29.seq
12770708 gbest290.seq
500000262 gbest291.seq
499999019 gbest292.seq
499998375 gbest293.seq
499998091 gbest294.seq
25149689 gbest295.seq
499999940 gbest296.seq
499999169 gbest297.seq
485630902 gbest298.seq
499998242 gbest299.seq
499999737 gbest3.seq
499999804 gbest30.seq
499997484 gbest300.seq
499999992 gbest301.seq
499999761 gbest302.seq
5975334 gbest303.seq
499998338 gbest304.seq
499998890 gbest305.seq
499997340 gbest306.seq
499998284 gbest307.seq
8756316 gbest308.seq
499999082 gbest309.seq
499997642 gbest31.seq
499999747 gbest310.seq
499999506 gbest311.seq
425307183 gbest312.seq
499999283 gbest313.seq
499997658 gbest314.seq
499997613 gbest315.seq
500000227 gbest316.seq
1895494 gbest317.seq
499999089 gbest318.seq
499996781 gbest319.seq
487104771 gbest32.seq
469235953 gbest320.seq
499999477 gbest321.seq
499999041 gbest322.seq
499998051 gbest323.seq
499998802 gbest324.seq
40449587 gbest325.seq
499997688 gbest326.seq
499998667 gbest327.seq
499998487 gbest328.seq
494327711 gbest329.seq
499996778 gbest33.seq
499998313 gbest330.seq
499998062 gbest331.seq
499998265 gbest332.seq
499997860 gbest333.seq
57626621 gbest334.seq
500000164 gbest335.seq
500000124 gbest336.seq
499998630 gbest337.seq
469754446 gbest338.seq
499996848 gbest339.seq
499999303 gbest34.seq
499997513 gbest340.seq
499999142 gbest341.seq
499998193 gbest342.seq
19805885 gbest343.seq
499999864 gbest344.seq
493935721 gbest345.seq
499998593 gbest346.seq
499999788 gbest347.seq
499997106 gbest348.seq
500000129 gbest349.seq
500000175 gbest35.seq
7266296 gbest350.seq
499999575 gbest351.seq
499999980 gbest352.seq
499998807 gbest353.seq
445592436 gbest354.seq
499999670 gbest355.seq
499999568 gbest356.seq
500000244 gbest357.seq
385956897 gbest358.seq
499999372 gbest359.seq
465924519 gbest36.seq
500000175 gbest360.seq
499997997 gbest361.seq
499998078 gbest362.seq
23844116 gbest363.seq
499999898 gbest364.seq
499997585 gbest365.seq
500000144 gbest366.seq
499999050 gbest367.seq
61911193 gbest368.seq
166258344 gbest369.seq
499995198 gbest37.seq
499999253 gbest370.seq
499999145 gbest371.seq
499998201 gbest372.seq
499997764 gbest373.seq
88316446 gbest374.seq
499997671 gbest375.seq
499999212 gbest376.seq
499996947 gbest377.seq
499997464 gbest378.seq
167276287 gbest379.seq
499998642 gbest38.seq
499996810 gbest380.seq
499997307 gbest381.seq
499999563 gbest382.seq
499998315 gbest383.seq
156079578 gbest384.seq
499999225 gbest385.seq
500000080 gbest386.seq
499996997 gbest387.seq
496992966 gbest388.seq
499998244 gbest389.seq
499999306 gbest39.seq
499997393 gbest390.seq
499997868 gbest391.seq
68565600 gbest392.seq
499998199 gbest393.seq
499995697 gbest394.seq
499997473 gbest395.seq
499998850 gbest396.seq
84720974 gbest397.seq
499996726 gbest398.seq
499997638 gbest399.seq
434906986 gbest4.seq
499998303 gbest40.seq
499997975 gbest400.seq
499998294 gbest401.seq
88035719 gbest402.seq
499998301 gbest403.seq
499998566 gbest404.seq
499999548 gbest405.seq
499999828 gbest406.seq
49402563 gbest407.seq
499999872 gbest408.seq
499999311 gbest409.seq
191433257 gbest41.seq
499999930 gbest410.seq
499999455 gbest411.seq
89134158 gbest412.seq
499997742 gbest413.seq
499999765 gbest414.seq
499998949 gbest415.seq
499993348 gbest416.seq
124836692 gbest417.seq
500000243 gbest418.seq
328529123 gbest419.seq
499997364 gbest42.seq
499998493 gbest420.seq
500000001 gbest421.seq
499998801 gbest422.seq
499999215 gbest423.seq
60918284 gbest424.seq
499998170 gbest425.seq
499999153 gbest426.seq
499999904 gbest427.seq
410572946 gbest428.seq
499997260 gbest429.seq
499997237 gbest43.seq
499999283 gbest430.seq
335979604 gbest431.seq
499998269 gbest432.seq
500000055 gbest433.seq
261735757 gbest434.seq
499999054 gbest435.seq
499999565 gbest436.seq
457029835 gbest437.seq
499997677 gbest438.seq
499997592 gbest439.seq
499997245 gbest44.seq
305631978 gbest440.seq
499996212 gbest441.seq
499998106 gbest442.seq
336207493 gbest443.seq
499998798 gbest444.seq
499999337 gbest445.seq
188594473 gbest446.seq
499998567 gbest447.seq
499997513 gbest448.seq
120724820 gbest449.seq
499996431 gbest45.seq
499998216 gbest450.seq
499998378 gbest451.seq
144958145 gbest452.seq
499997877 gbest453.seq
499999922 gbest454.seq
146697887 gbest455.seq
499998626 gbest456.seq
499997991 gbest457.seq
499998447 gbest458.seq
499999775 gbest459.seq
189558363 gbest46.seq
801517 gbest460.seq
499999562 gbest461.seq
499998109 gbest462.seq
500000069 gbest463.seq
499999340 gbest464.seq
23703713 gbest465.seq
170019681 gbest466.seq
499998234 gbest467.seq
499997948 gbest468.seq
499998330 gbest469.seq
499997254 gbest47.seq
499998840 gbest470.seq
28589640 gbest471.seq
499999508 gbest472.seq
499999012 gbest473.seq
499997866 gbest474.seq
500000035 gbest475.seq
68554444 gbest476.seq
499998463 gbest477.seq
499997655 gbest478.seq
499999203 gbest479.seq
499997928 gbest48.seq
499998066 gbest480.seq
58925223 gbest481.seq
499999526 gbest482.seq
499998894 gbest483.seq
499996608 gbest484.seq
499998137 gbest485.seq
36903337 gbest486.seq
499997365 gbest487.seq
499998770 gbest488.seq
499999455 gbest489.seq
499998755 gbest49.seq
500000131 gbest490.seq
74359385 gbest491.seq
499999195 gbest492.seq
499999368 gbest493.seq
499998557 gbest494.seq
208394234 gbest495.seq
499996334 gbest496.seq
499998824 gbest497.seq
499999004 gbest498.seq
499997967 gbest499.seq
500000191 gbest5.seq
477040413 gbest50.seq
95452620 gbest500.seq
499998191 gbest501.seq
499999459 gbest502.seq
499996872 gbest503.seq
499999994 gbest504.seq
57685887 gbest505.seq
499995678 gbest506.seq
499998789 gbest507.seq
499999954 gbest508.seq
499998301 gbest509.seq
499999137 gbest51.seq
144692159 gbest510.seq
499998197 gbest511.seq
499999912 gbest512.seq
499997275 gbest513.seq
500000017 gbest514.seq
144813181 gbest515.seq
500000059 gbest516.seq
499998528 gbest517.seq
500000008 gbest518.seq
499998914 gbest519.seq
356399962 gbest52.seq
20850934 gbest520.seq
174271459 gbest521.seq
500000045 gbest522.seq
499996867 gbest523.seq
86408028 gbest524.seq
499998243 gbest525.seq
499999107 gbest526.seq
76884582 gbest527.seq
499999644 gbest528.seq
499999397 gbest529.seq
499997197 gbest53.seq
499998315 gbest530.seq
499996576 gbest531.seq
101183181 gbest532.seq
499998563 gbest533.seq
499999862 gbest534.seq
499998938 gbest535.seq
500000219 gbest536.seq
11156072 gbest537.seq
499998167 gbest538.seq
499998641 gbest539.seq
499998317 gbest54.seq
499997727 gbest540.seq
478138570 gbest541.seq
499999636 gbest542.seq
499997579 gbest543.seq
499999384 gbest544.seq
418383466 gbest545.seq
499999742 gbest546.seq
500000106 gbest547.seq
499999897 gbest548.seq
499998376 gbest549.seq
499998962 gbest55.seq
83233267 gbest550.seq
499999613 gbest551.seq
499998661 gbest552.seq
499999080 gbest553.seq
499997383 gbest554.seq
33029973 gbest555.seq
499996586 gbest556.seq
499998720 gbest557.seq
500000086 gbest558.seq
499997739 gbest559.seq
483809258 gbest56.seq
44574268 gbest560.seq
499996436 gbest561.seq
499999784 gbest562.seq
500000157 gbest563.seq
499999562 gbest564.seq
12075913 gbest565.seq
500000228 gbest566.seq
499998380 gbest567.seq
393295288 gbest568.seq
499999290 gbest569.seq
500000108 gbest57.seq
499997222 gbest570.seq
110561247 gbest571.seq
499998740 gbest572.seq
499998382 gbest573.seq
50523126 gbest574.seq
499999830 gbest575.seq
499997898 gbest576.seq
499999494 gbest577.seq
499998263 gbest578.seq
294341514 gbest579.seq
499997245 gbest58.seq
499998900 gbest59.seq
499998385 gbest6.seq
464412292 gbest60.seq
499998095 gbest61.seq
499998609 gbest62.seq
499996572 gbest63.seq
499999314 gbest64.seq
7852741 gbest65.seq
499996998 gbest66.seq
499998343 gbest67.seq
499997357 gbest68.seq
484334594 gbest69.seq
499998098 gbest7.seq
499999502 gbest70.seq
499998225 gbest71.seq
499999252 gbest72.seq
499999251 gbest73.seq
10307392 gbest74.seq
123414980 gbest75.seq
499999298 gbest76.seq
499998245 gbest77.seq
499998907 gbest78.seq
499999038 gbest79.seq
469427397 gbest8.seq
6590015 gbest80.seq
499998041 gbest81.seq
499995899 gbest82.seq
499996967 gbest83.seq
499999190 gbest84.seq
47161502 gbest85.seq
500000165 gbest86.seq
499998080 gbest87.seq
499999898 gbest88.seq
499998626 gbest89.seq
499998435 gbest9.seq
53869209 gbest90.seq
499998173 gbest91.seq
499999170 gbest92.seq
499996091 gbest93.seq
472256473 gbest94.seq
499999347 gbest95.seq
499999760 gbest96.seq
499996196 gbest97.seq
499998634 gbest98.seq
159223 gbest99.seq
499997694 gbgss1.seq
55764222 gbgss10.seq
499997670 gbgss100.seq
45810173 gbgss101.seq
499998092 gbgss102.seq
499998065 gbgss103.seq
499997907 gbgss104.seq
468721568 gbgss105.seq
499997822 gbgss106.seq
499999105 gbgss107.seq
499998583 gbgss108.seq
499999879 gbgss109.seq
499998984 gbgss11.seq
42543282 gbgss110.seq
499997770 gbgss111.seq
499999222 gbgss112.seq
499999399 gbgss113.seq
319587338 gbgss114.seq
499997568 gbgss115.seq
499999109 gbgss116.seq
499998390 gbgss117.seq
499998207 gbgss118.seq
105488645 gbgss119.seq
499998615 gbgss12.seq
499997351 gbgss120.seq
499997815 gbgss121.seq
499997392 gbgss122.seq
499998819 gbgss123.seq
8930221 gbgss124.seq
499999955 gbgss125.seq
499998440 gbgss126.seq
499999539 gbgss127.seq
451766712 gbgss128.seq
499998361 gbgss129.seq
499999319 gbgss13.seq
499999211 gbgss130.seq
499997711 gbgss131.seq
499998622 gbgss132.seq
29785783 gbgss133.seq
499997877 gbgss134.seq
209679641 gbgss135.seq
500000110 gbgss136.seq
499999602 gbgss137.seq
499997969 gbgss138.seq
500000125 gbgss139.seq
499999792 gbgss14.seq
14831686 gbgss140.seq
499996726 gbgss141.seq
499997951 gbgss142.seq
499999528 gbgss143.seq
499997001 gbgss144.seq
16786266 gbgss145.seq
499997786 gbgss146.seq
499996974 gbgss147.seq
499999546 gbgss148.seq
499996547 gbgss149.seq
4956545 gbgss15.seq
2045398 gbgss150.seq
499997382 gbgss151.seq
499998165 gbgss152.seq
499998480 gbgss153.seq
499997367 gbgss154.seq
6835799 gbgss155.seq
373333029 gbgss156.seq
499998282 gbgss157.seq
500000125 gbgss158.seq
499998390 gbgss159.seq
499998710 gbgss16.seq
456785189 gbgss160.seq
499999169 gbgss161.seq
499999754 gbgss162.seq
499999838 gbgss163.seq
458300845 gbgss164.seq
499997998 gbgss165.seq
499999955 gbgss166.seq
499998714 gbgss167.seq
456858700 gbgss168.seq
499997318 gbgss169.seq
499999297 gbgss17.seq
499999217 gbgss170.seq
500000164 gbgss171.seq
364172270 gbgss172.seq
500000047 gbgss173.seq
500000062 gbgss174.seq
215814169 gbgss175.seq
500000172 gbgss176.seq
499997918 gbgss177.seq
68464120 gbgss178.seq
499999079 gbgss179.seq
499998832 gbgss18.seq
499999336 gbgss180.seq
499998518 gbgss181.seq
499999975 gbgss182.seq
49671428 gbgss183.seq
500000207 gbgss184.seq
499998668 gbgss185.seq
499998448 gbgss186.seq
500000134 gbgss187.seq
41156795 gbgss188.seq
499999015 gbgss189.seq
483129236 gbgss19.seq
499999977 gbgss190.seq
57632314 gbgss191.seq
499998791 gbgss192.seq
499996639 gbgss193.seq
499997685 gbgss194.seq
496087090 gbgss195.seq
499999000 gbgss196.seq
499998052 gbgss197.seq
499999020 gbgss198.seq
499999114 gbgss199.seq
499997209 gbgss2.seq
500000074 gbgss20.seq
56085229 gbgss200.seq
499998432 gbgss201.seq
499997989 gbgss202.seq
499999434 gbgss203.seq
480823653 gbgss204.seq
499999696 gbgss205.seq
499998040 gbgss206.seq
55217889 gbgss207.seq
499999671 gbgss208.seq
499999336 gbgss209.seq
326435210 gbgss21.seq
499999851 gbgss210.seq
483131912 gbgss211.seq
499997831 gbgss212.seq
499997658 gbgss213.seq
499999763 gbgss214.seq
487715331 gbgss215.seq
499998512 gbgss216.seq
499999622 gbgss217.seq
499998482 gbgss218.seq
475206737 gbgss219.seq
499996936 gbgss22.seq
499999842 gbgss220.seq
499997798 gbgss221.seq
499998669 gbgss222.seq
6150907 gbgss223.seq
499999723 gbgss224.seq
499999684 gbgss225.seq
499998774 gbgss226.seq
264589422 gbgss227.seq
499998669 gbgss228.seq
499997630 gbgss229.seq
499999113 gbgss23.seq
499998484 gbgss230.seq
429774452 gbgss231.seq
499998680 gbgss232.seq
499997883 gbgss233.seq
499999992 gbgss234.seq
471956638 gbgss235.seq
499999119 gbgss236.seq
499999181 gbgss237.seq
499998472 gbgss238.seq
419758648 gbgss239.seq
499998818 gbgss24.seq
499997909 gbgss240.seq
499999623 gbgss241.seq
500000228 gbgss242.seq
499999473 gbgss243.seq
18245173 gbgss244.seq
315572447 gbgss245.seq
499997744 gbgss246.seq
499999389 gbgss247.seq
499998492 gbgss248.seq
467298948 gbgss249.seq
499999064 gbgss25.seq
499998980 gbgss250.seq
499997328 gbgss251.seq
500000000 gbgss252.seq
499997677 gbgss253.seq
36135099 gbgss254.seq
499998608 gbgss255.seq
499999218 gbgss256.seq
499998113 gbgss257.seq
499998912 gbgss258.seq
22042461 gbgss259.seq
49836535 gbgss26.seq
499997682 gbgss260.seq
499997479 gbgss261.seq
499997847 gbgss262.seq
1966395 gbgss263.seq
500000132 gbgss264.seq
499998920 gbgss265.seq
499998061 gbgss266.seq
499491070 gbgss267.seq
499999723 gbgss268.seq
499998484 gbgss269.seq
499996335 gbgss27.seq
476820220 gbgss270.seq
499996842 gbgss28.seq
499997374 gbgss29.seq
499996818 gbgss3.seq
499999793 gbgss30.seq
31342385 gbgss31.seq
499998298 gbgss32.seq
499999440 gbgss33.seq
499997849 gbgss34.seq
475326860 gbgss35.seq
499997988 gbgss36.seq
499998016 gbgss37.seq
499999097 gbgss38.seq
499998525 gbgss39.seq
499999484 gbgss4.seq
12514272 gbgss40.seq
499998794 gbgss41.seq
499997549 gbgss42.seq
168546271 gbgss43.seq
499997525 gbgss44.seq
499997753 gbgss45.seq
499999140 gbgss46.seq
486883580 gbgss47.seq
499998195 gbgss48.seq
499997714 gbgss49.seq
41480505 gbgss5.seq
499997904 gbgss50.seq
443945964 gbgss51.seq
499998446 gbgss52.seq
500000163 gbgss53.seq
499998431 gbgss54.seq
421055741 gbgss55.seq
499998399 gbgss56.seq
499999998 gbgss57.seq
500000139 gbgss58.seq
427952713 gbgss59.seq
499999218 gbgss6.seq
67665344 gbgss60.seq
499997014 gbgss61.seq
499998970 gbgss62.seq
499999072 gbgss63.seq
492396804 gbgss64.seq
499998424 gbgss65.seq
499998563 gbgss66.seq
499998282 gbgss67.seq
499998811 gbgss68.seq
2280772 gbgss69.seq
499997502 gbgss7.seq
500000229 gbgss70.seq
499999619 gbgss71.seq
500000260 gbgss72.seq
419366282 gbgss73.seq
500000010 gbgss74.seq
499997041 gbgss75.seq
499997295 gbgss76.seq
34859199 gbgss77.seq
499997046 gbgss78.seq
499999706 gbgss79.seq
499999574 gbgss8.seq
499999172 gbgss80.seq
492757160 gbgss81.seq
499998518 gbgss82.seq
499998270 gbgss83.seq
499998704 gbgss84.seq
499998845 gbgss85.seq
6746394 gbgss86.seq
499998541 gbgss87.seq
499997719 gbgss88.seq
499999151 gbgss89.seq
499998003 gbgss9.seq
499996902 gbgss90.seq
34174279 gbgss91.seq
499998289 gbgss92.seq
499998886 gbgss93.seq
499998172 gbgss94.seq
465185709 gbgss95.seq
244248654 gbgss96.seq
499999492 gbgss97.seq
499998457 gbgss98.seq
500000176 gbgss99.seq
499999046 gbhtc1.seq
499988632 gbhtc2.seq
499995070 gbhtc3.seq
331492497 gbhtc4.seq
499998726 gbhtc5.seq
440144495 gbhtc6.seq
499997785 gbhtc7.seq
215407243 gbhtc8.seq
499949323 gbhtg1.seq
499980488 gbhtg10.seq
485100216 gbhtg11.seq
499977040 gbhtg12.seq
499847878 gbhtg13.seq
499963905 gbhtg14.seq
499701543 gbhtg15.seq
474637795 gbhtg16.seq
499709797 gbhtg17.seq
499810685 gbhtg18.seq
499965491 gbhtg19.seq
499847286 gbhtg2.seq
499990701 gbhtg20.seq
473198726 gbhtg21.seq
499919006 gbhtg22.seq
499970126 gbhtg23.seq
499100799 gbhtg24.seq
499963059 gbhtg25.seq
484453835 gbhtg26.seq
499962395 gbhtg27.seq
499869207 gbhtg28.seq
268058753 gbhtg29.seq
499869352 gbhtg3.seq
499923133 gbhtg30.seq
499807694 gbhtg31.seq
224934536 gbhtg32.seq
499945664 gbhtg33.seq
499927322 gbhtg34.seq
265477063 gbhtg35.seq
499867320 gbhtg36.seq
499972859 gbhtg37.seq
223152241 gbhtg38.seq
499806763 gbhtg39.seq
499846790 gbhtg4.seq
499975124 gbhtg40.seq
234952969 gbhtg41.seq
499825962 gbhtg42.seq
499886227 gbhtg43.seq
202125817 gbhtg44.seq
499805593 gbhtg45.seq
499927606 gbhtg46.seq
205797278 gbhtg47.seq
499977122 gbhtg48.seq
499932310 gbhtg49.seq
499934597 gbhtg5.seq
193865419 gbhtg50.seq
499930130 gbhtg51.seq
499933430 gbhtg52.seq
161356215 gbhtg53.seq
499991313 gbhtg54.seq
499991025 gbhtg55.seq
252731354 gbhtg56.seq
499944545 gbhtg57.seq
499991760 gbhtg58.seq
499843961 gbhtg59.seq
507366 gbhtg6.seq
167235497 gbhtg60.seq
499935001 gbhtg61.seq
499926029 gbhtg62.seq
499881302 gbhtg63.seq
468570824 gbhtg64.seq
499882387 gbhtg65.seq
499975194 gbhtg66.seq
499952537 gbhtg67.seq
499955759 gbhtg68.seq
499868574 gbhtg69.seq
499821955 gbhtg7.seq
417842665 gbhtg70.seq
499731572 gbhtg71.seq
499823072 gbhtg72.seq
385408676 gbhtg73.seq
499947980 gbhtg74.seq
499966538 gbhtg75.seq
383565105 gbhtg76.seq
499960780 gbhtg77.seq
499985376 gbhtg78.seq
499784030 gbhtg79.seq
499933840 gbhtg8.seq
499757763 gbhtg80.seq
499920642 gbhtg81.seq
308054325 gbhtg82.seq
499899726 gbhtg9.seq
499921375 gbinv1.seq
448191281 gbinv10.seq
498462897 gbinv100.seq
185082059 gbinv1000.se
468046279 gbinv1001.se
494868032 gbinv1002.se
494549891 gbinv1003.se
464492177 gbinv1004.se
479062194 gbinv1005.se
229136179 gbinv1006.se
496620899 gbinv1007.se
489401017 gbinv1008.se
473706350 gbinv1009.se
461069581 gbinv101.seq
492517014 gbinv1010.se
489752525 gbinv1011.se
424310252 gbinv1012.se
299175086 gbinv1013.se
422085853 gbinv1014.se
482496510 gbinv1015.se
365476334 gbinv1016.se
455578184 gbinv1017.se
349492812 gbinv1018.se
476634584 gbinv1019.se
308472235 gbinv102.seq
468337011 gbinv1020.se
479253825 gbinv1021.se
466281232 gbinv1022.se
169424717 gbinv1023.se
491880345 gbinv1024.se
480699422 gbinv1025.se
466860325 gbinv1026.se
499811192 gbinv1027.se
91086877 gbinv1028.se
468973768 gbinv1029.se
476966413 gbinv103.seq
400459426 gbinv1030.se
2729769835 gbinv1031.se
1951209798 gbinv1032.se
1255792906 gbinv1033.se
898357565 gbinv1034.se
708100576 gbinv1035.se
682258938 gbinv1036.se
603731371 gbinv1037.se
441414339 gbinv1038.se
420874955 gbinv1039.se
491653376 gbinv104.seq
364086765 gbinv1040.se
301244939 gbinv1041.se
281934492 gbinv1042.se
496007176 gbinv1043.se
465427121 gbinv1044.se
64629178 gbinv1045.se
464317098 gbinv1046.se
481015217 gbinv1047.se
495520063 gbinv1048.se
304368055 gbinv1049.se
363427026 gbinv105.seq
474561217 gbinv1050.se
485191239 gbinv1051.se
489426703 gbinv1052.se
448136762 gbinv1053.se
470740251 gbinv1054.se
459272447 gbinv1055.se
495221156 gbinv1056.se
293517225 gbinv1057.se
491531607 gbinv1058.se
484466364 gbinv1059.se
350760262 gbinv106.seq
496616157 gbinv1060.se
243887807 gbinv1061.se
442993412 gbinv1062.se
489594973 gbinv1063.se
473669853 gbinv1064.se
317058683 gbinv1065.se
496827832 gbinv1066.se
475806379 gbinv1067.se
483717479 gbinv1068.se
279303308 gbinv1069.se
297540018 gbinv107.seq
442658448 gbinv1070.se
154113444 gbinv1071.se
479808194 gbinv1072.se
344925105 gbinv1073.se
389948491 gbinv1074.se
495757112 gbinv1075.se
486177963 gbinv1076.se
474805896 gbinv1077.se
332242655 gbinv1078.se
470382100 gbinv1079.se
381801556 gbinv108.seq
467266108 gbinv1080.se
443778631 gbinv1081.se
437109989 gbinv1082.se
476924489 gbinv1083.se
491135272 gbinv1084.se
490968147 gbinv1085.se
346229875 gbinv1086.se
496167175 gbinv1087.se
491556023 gbinv1088.se
497588780 gbinv1089.se
379062900 gbinv109.seq
487095100 gbinv1090.se
487204794 gbinv1091.se
476212892 gbinv1092.se
485178393 gbinv1093.se
488738035 gbinv1094.se
156107164 gbinv1095.se
497392167 gbinv1096.se
482749954 gbinv1097.se
496261622 gbinv1098.se
494251519 gbinv1099.se
460975353 gbinv11.seq
334858600 gbinv110.seq
53213160 gbinv1100.se
442918226 gbinv1101.se
496050726 gbinv1102.se
497897538 gbinv1103.se
481565834 gbinv1104.se
75736927 gbinv1105.se
496194879 gbinv1106.se
464036016 gbinv1107.se
428298552 gbinv1108.se
382943702 gbinv1109.se
295805525 gbinv111.seq
379596877 gbinv1110.se
342671608 gbinv1111.se
493967462 gbinv1112.se
478563134 gbinv1113.se
148303346 gbinv1114.se
480732928 gbinv1115.se
469448865 gbinv1116.se
488160790 gbinv1117.se
392890907 gbinv1118.se
481357065 gbinv1119.se
268327299 gbinv112.seq
493413425 gbinv1120.se
487451909 gbinv1121.se
394846711 gbinv1122.se
488239358 gbinv1123.se
483834908 gbinv1124.se
490561398 gbinv1125.se
316655906 gbinv1126.se
464946114 gbinv1127.se
492014258 gbinv1128.se
471770137 gbinv1129.se
240539146 gbinv113.seq
461978252 gbinv1130.se
379959437 gbinv1131.se
408768936 gbinv1132.se
472794626 gbinv1133.se
321062867 gbinv1134.se
353308729 gbinv1135.se
483874842 gbinv1136.se
484350001 gbinv1137.se
489067895 gbinv1138.se
329008329 gbinv1139.se
466336966 gbinv114.seq
476668232 gbinv1140.se
480994325 gbinv1141.se
495891814 gbinv1142.se
483360160 gbinv1143.se
132911965 gbinv1144.se
487210140 gbinv1145.se
448992266 gbinv1146.se
498695833 gbinv1147.se
444078900 gbinv1148.se
215956096 gbinv1149.se
474680766 gbinv115.seq
487810620 gbinv1150.se
482286892 gbinv1151.se
497441252 gbinv1152.se
467821328 gbinv1153.se
154246756 gbinv1154.se
466393483 gbinv1155.se
489416936 gbinv1156.se
498094362 gbinv1157.se
484048889 gbinv1158.se
107559872 gbinv1159.se
466347402 gbinv116.seq
496101873 gbinv1160.se
486677933 gbinv1161.se
491324260 gbinv1162.se
473165407 gbinv1163.se
140712569 gbinv1164.se
498375180 gbinv1165.se
479763923 gbinv1166.se
484976323 gbinv1167.se
482273285 gbinv1168.se
478828590 gbinv1169.se
87043104 gbinv117.seq
491989005 gbinv1170.se
447463190 gbinv1171.se
487986285 gbinv1172.se
346424265 gbinv1173.se
460874738 gbinv1174.se
470352434 gbinv1175.se
496569150 gbinv1176.se
495212210 gbinv1177.se
443889162 gbinv1178.se
496692637 gbinv1179.se
454196228 gbinv118.seq
473301815 gbinv1180.se
493531126 gbinv1181.se
483258684 gbinv1182.se
403143105 gbinv1183.se
492287961 gbinv1184.se
492993389 gbinv1185.se
329034299 gbinv1186.se
461827784 gbinv1187.se
482686927 gbinv1188.se
99362650 gbinv1189.se
437093110 gbinv119.seq
443724048 gbinv1190.se
367763998 gbinv1191.se
353268604 gbinv1192.se
350260612 gbinv1193.se
341599132 gbinv1194.se
461028723 gbinv1195.se
495674250 gbinv1196.se
283813945 gbinv1197.se
495723890 gbinv1198.se
495292964 gbinv1199.se
470405378 gbinv12.seq
477521665 gbinv120.seq
476664181 gbinv1200.se
446428554 gbinv1201.se
382810689 gbinv1202.se
448082904 gbinv1203.se
453192257 gbinv1204.se
484511211 gbinv1205.se
284284487 gbinv1206.se
476862131 gbinv1207.se
464518126 gbinv1208.se
496023268 gbinv1209.se
438315290 gbinv121.seq
484057968 gbinv1210.se
64752815 gbinv1211.se
453621523 gbinv1212.se
477654378 gbinv1213.se
484267949 gbinv1214.se
455437646 gbinv1215.se
89115533 gbinv1216.se
483404516 gbinv1217.se
390899518 gbinv1218.se
452325242 gbinv1219.se
495970164 gbinv122.seq
384613513 gbinv1220.se
229526122 gbinv1221.se
486991783 gbinv1222.se
496712223 gbinv1223.se
435108906 gbinv1224.se
287148864 gbinv1225.se
277496405 gbinv1226.se
488197542 gbinv1227.se
493608297 gbinv1228.se
489917099 gbinv1229.se
494841338 gbinv123.seq
468604289 gbinv1230.se
78075814 gbinv1231.se
463954346 gbinv1232.se
444065721 gbinv1233.se
463448466 gbinv1234.se
479934750 gbinv1235.se
498795321 gbinv1236.se
472901111 gbinv1237.se
163240230 gbinv1238.se
487102736 gbinv1239.se
477525729 gbinv124.seq
492609813 gbinv1240.se
481436962 gbinv1241.se
460938379 gbinv1242.se
478440248 gbinv1243.se
498750906 gbinv1244.se
164930006 gbinv1245.se
492943115 gbinv1246.se
490618893 gbinv1247.se
492915933 gbinv1248.se
480868563 gbinv1249.se
483902052 gbinv125.seq
489548617 gbinv1250.se
493048930 gbinv1251.se
481728782 gbinv1252.se
491049473 gbinv1253.se
497816475 gbinv1254.se
349702816 gbinv1255.se
480059395 gbinv1256.se
384338991 gbinv1257.se
495415147 gbinv1258.se
494914864 gbinv1259.se
499996067 gbinv126.seq
464264813 gbinv1260.se
412697818 gbinv1261.se
493232928 gbinv1262.se
486605755 gbinv1263.se
476585175 gbinv1264.se
199064605 gbinv1265.se
490754089 gbinv1266.se
472244532 gbinv1267.se
489706010 gbinv1268.se
464236921 gbinv1269.se
101805538 gbinv127.seq
467204993 gbinv1270.se
499827123 gbinv1271.se
345613253 gbinv1272.se
483950049 gbinv1273.se
478586227 gbinv1274.se
94225785 gbinv1275.se
472428904 gbinv1276.se
497885447 gbinv1277.se
457902545 gbinv1278.se
498796484 gbinv1279.se
499995747 gbinv128.seq
467125389 gbinv1280.se
497244361 gbinv1281.se
487538660 gbinv1282.se
499913920 gbinv1283.se
406549774 gbinv1284.se
430451685 gbinv1285.se
472260007 gbinv1286.se
475352175 gbinv1287.se
452223380 gbinv1288.se
497325130 gbinv1289.se
406815642 gbinv129.seq
494398316 gbinv1290.se
54910173 gbinv1291.se
492423538 gbinv1292.se
491678341 gbinv1293.se
467975788 gbinv1294.se
477888370 gbinv1295.se
439149787 gbinv1296.se
107820209 gbinv1297.se
491773954 gbinv1298.se
479110373 gbinv1299.se
485779138 gbinv13.seq
497592612 gbinv130.seq
496707613 gbinv1300.se
498528229 gbinv1301.se
462735347 gbinv1302.se
402849455 gbinv1303.se
491032865 gbinv1304.se
476073140 gbinv1305.se
456931139 gbinv1306.se
478083309 gbinv1307.se
457571010 gbinv1308.se
490220501 gbinv1309.se
491627608 gbinv131.seq
26121678 gbinv1310.se
481108642 gbinv1311.se
343565210 gbinv1312.se
496752688 gbinv1313.se
480731694 gbinv1314.se
470531307 gbinv1315.se
483531381 gbinv1316.se
74062948 gbinv1317.se
432713903 gbinv1318.se
469121536 gbinv1319.se
468890974 gbinv132.seq
488318181 gbinv1320.se
457907158 gbinv1321.se
288589895 gbinv1322.se
413758380 gbinv1323.se
227750852 gbinv1324.se
499653408 gbinv1325.se
263948525 gbinv1326.se
490736102 gbinv1327.se
499126557 gbinv1328.se
490773865 gbinv1329.se
480496392 gbinv133.seq
480867825 gbinv1330.se
488870121 gbinv1331.se
158318713 gbinv1332.se
494916186 gbinv1333.se
471135774 gbinv1334.se
484279868 gbinv1335.se
469898457 gbinv1336.se
461055681 gbinv1337.se
273724334 gbinv1338.se
281877207 gbinv1339.se
96954550 gbinv134.seq
479356634 gbinv1340.se
463004791 gbinv1341.se
225686207 gbinv1342.se
489637921 gbinv1343.se
496465279 gbinv1344.se
484561817 gbinv1345.se
477308789 gbinv1346.se
258133115 gbinv1347.se
493072880 gbinv1348.se
490208988 gbinv1349.se
495716317 gbinv135.seq
492809523 gbinv1350.se
474012633 gbinv1351.se
200353570 gbinv1352.se
477986454 gbinv1353.se
491870466 gbinv1354.se
472046257 gbinv1355.se
484787948 gbinv1356.se
240176778 gbinv1357.se
481405748 gbinv1358.se
492731277 gbinv1359.se
459725127 gbinv136.seq
480851291 gbinv1360.se
381859195 gbinv1361.se
479236800 gbinv1362.se
489743792 gbinv1363.se
497574828 gbinv1364.se
381267248 gbinv1365.se
450448665 gbinv1366.se
484530441 gbinv1367.se
394299446 gbinv1368.se
425501799 gbinv1369.se
481987025 gbinv137.seq
115618359 gbinv1370.se
431451977 gbinv1371.se
498054878 gbinv1372.se
479298950 gbinv1373.se
467089340 gbinv1374.se
70651447 gbinv1375.se
278258267 gbinv1376.se
440773903 gbinv1377.se
470493499 gbinv1378.se
476778459 gbinv1379.se
494130819 gbinv138.seq
486736873 gbinv1380.se
223420398 gbinv1381.se
471322661 gbinv1382.se
489692789 gbinv1383.se
493687885 gbinv1384.se
389895514 gbinv1385.se
489638363 gbinv1386.se
35794018 gbinv1387.se
115155809 gbinv1388.se
615537581 gbinv1389.se
170883605 gbinv139.seq
272202298 gbinv1390.se
480149302 gbinv1391.se
476834871 gbinv1392.se
477140077 gbinv1393.se
491640835 gbinv1394.se
403386359 gbinv1395.se
297511488 gbinv1396.se
400332784 gbinv1397.se
498823027 gbinv1398.se
483203009 gbinv1399.se
459258045 gbinv14.seq
473739682 gbinv140.seq
482735960 gbinv1400.se
489718628 gbinv1401.se
494917649 gbinv1402.se
464038514 gbinv1403.se
489339776 gbinv1404.se
491072844 gbinv1405.se
485392941 gbinv1406.se
485744082 gbinv1407.se
436679683 gbinv1408.se
104870652 gbinv1409.se
489734098 gbinv141.seq
487890253 gbinv1410.se
491469693 gbinv1411.se
492207810 gbinv1412.se
277662520 gbinv1413.se
465038797 gbinv1414.se
484906173 gbinv1415.se
455274642 gbinv1416.se
319919307 gbinv1417.se
441284320 gbinv1418.se
415113809 gbinv1419.se
481853020 gbinv142.seq
401299897 gbinv1420.se
395865604 gbinv1421.se
258909090 gbinv1422.se
514655388 gbinv1423.se
393855324 gbinv1424.se
492709181 gbinv1425.se
187722486 gbinv1426.se
316437995 gbinv1427.se
404935920 gbinv1428.se
377659133 gbinv1429.se
480575066 gbinv143.seq
357065535 gbinv1430.se
306211988 gbinv1431.se
475517285 gbinv1432.se
487075677 gbinv1433.se
416387225 gbinv1434.se
134695954 gbinv1435.se
430211421 gbinv1436.se
468408575 gbinv1437.se
436825552 gbinv1438.se
499430139 gbinv1439.se
175803757 gbinv144.seq
151862240 gbinv1440.se
462552718 gbinv1441.se
491611432 gbinv1442.se
498143107 gbinv1443.se
338205053 gbinv1444.se
497160898 gbinv1445.se
493529280 gbinv1446.se
490583969 gbinv1447.se
296798816 gbinv1448.se
327269135 gbinv1449.se
495896562 gbinv145.seq
374578168 gbinv1450.se
464846984 gbinv1451.se
483112113 gbinv1452.se
134997033 gbinv1453.se
435630019 gbinv1454.se
484610659 gbinv1455.se
421495202 gbinv1456.se
397549582 gbinv1457.se
481528936 gbinv1458.se
458589607 gbinv1459.se
496714826 gbinv146.seq
472513592 gbinv1460.se
337603339 gbinv1461.se
484201127 gbinv1462.se
385978713 gbinv1463.se
440431049 gbinv1464.se
460502362 gbinv1465.se
495623919 gbinv1466.se
476021491 gbinv1467.se
461121425 gbinv1468.se
344726041 gbinv1469.se
484083643 gbinv147.seq
460975459 gbinv1470.se
487003903 gbinv1471.se
498520425 gbinv1472.se
418134448 gbinv1473.se
427253029 gbinv1474.se
486412807 gbinv1475.se
383942184 gbinv1476.se
477338574 gbinv1477.se
490073097 gbinv1478.se
478811262 gbinv1479.se
472142529 gbinv148.seq
496060117 gbinv1480.se
340406228 gbinv1481.se
449114541 gbinv1482.se
199251506 gbinv1483.se
221729756 gbinv1484.se
327938029 gbinv1485.se
425282426 gbinv1486.se
313687149 gbinv1487.se
266841778 gbinv1488.se
458869871 gbinv1489.se
487970521 gbinv149.seq
369422706 gbinv1490.se
153606987 gbinv1491.se
472914403 gbinv1492.se
306852781 gbinv1493.se
291548062 gbinv1494.se
272671608 gbinv1495.se
486703218 gbinv1496.se
499913313 gbinv1497.se
491927835 gbinv1498.se
158294388 gbinv1499.se
484230611 gbinv15.seq
473212644 gbinv150.seq
470404301 gbinv1500.se
477785110 gbinv1501.se
401558910 gbinv1502.se
482108666 gbinv1503.se
75176389 gbinv1504.se
466305691 gbinv1505.se
488346628 gbinv1506.se
427690357 gbinv1507.se
413354153 gbinv1508.se
497212607 gbinv1509.se
119585424 gbinv151.seq
400793181 gbinv1510.se
484524034 gbinv1511.se
465540714 gbinv1512.se
498576546 gbinv1513.se
406206788 gbinv1514.se
453652425 gbinv1515.se
457851234 gbinv1516.se
392940138 gbinv1517.se
484114705 gbinv1518.se
485175842 gbinv1519.se
483414568 gbinv152.seq
489823569 gbinv1520.se
493576473 gbinv1521.se
177016892 gbinv1522.se
486849466 gbinv1523.se
480897370 gbinv1524.se
254718644 gbinv1525.se
271476686 gbinv1526.se
459218955 gbinv1527.se
436464597 gbinv1528.se
424836755 gbinv1529.se
490356176 gbinv153.seq
407409473 gbinv1530.se
392557971 gbinv1531.se
374840311 gbinv1532.se
370687455 gbinv1533.se
364209018 gbinv1534.se
356043378 gbinv1535.se
470407388 gbinv1536.se
498144179 gbinv1537.se
440247259 gbinv1538.se
432569025 gbinv1539.se
487648026 gbinv154.seq
473074066 gbinv1540.se
446787735 gbinv1541.se
490046306 gbinv1542.se
458546137 gbinv1543.se
453744056 gbinv1544.se
485719553 gbinv1545.se
470688947 gbinv1546.se
499145969 gbinv1547.se
488679526 gbinv1548.se
383236752 gbinv1549.se
482729414 gbinv155.seq
403063473 gbinv1550.se
491935868 gbinv1551.se
450996388 gbinv1552.se
494574942 gbinv1553.se
190754233 gbinv1554.se
446572734 gbinv1555.se
349707818 gbinv1556.se
498341839 gbinv1557.se
475083978 gbinv1558.se
495586255 gbinv1559.se
499999581 gbinv156.seq
493047765 gbinv1560.se
424336607 gbinv1561.se
445635419 gbinv1562.se
496536598 gbinv1563.se
421970194 gbinv1564.se
304852181 gbinv1565.se
282782605 gbinv1566.se
287459144 gbinv1567.se
292138330 gbinv1568.se
278622574 gbinv1569.se
420970303 gbinv157.seq
464187388 gbinv1570.se
365807256 gbinv1571.se
473318223 gbinv1572.se
397532595 gbinv1573.se
499926253 gbinv1574.se
489834503 gbinv1575.se
494009263 gbinv1576.se
227606738 gbinv1577.se
354335913 gbinv1578.se
405308849 gbinv1579.se
485186926 gbinv158.seq
373295374 gbinv1580.se
461408168 gbinv1581.se
468585870 gbinv1582.se
465615394 gbinv1583.se
478206747 gbinv1584.se
470845488 gbinv1585.se
434630573 gbinv1586.se
449352694 gbinv1587.se
475961503 gbinv1588.se
499526122 gbinv1589.se
497652223 gbinv159.seq
474588030 gbinv1590.se
497424296 gbinv1591.se
495010727 gbinv1592.se
473393329 gbinv1593.se
492895518 gbinv1594.se
433798578 gbinv1595.se
497380186 gbinv1596.se
478698569 gbinv1597.se
493900539 gbinv1598.se
448881029 gbinv1599.se
495961065 gbinv16.seq
492273365 gbinv160.seq
491287252 gbinv1600.se
486729373 gbinv1601.se
490419273 gbinv1602.se
466942698 gbinv1603.se
496628250 gbinv1604.se
415334432 gbinv1605.se
477729034 gbinv1606.se
389608539 gbinv1607.se
447782896 gbinv1608.se
379570416 gbinv1609.se
493650305 gbinv161.seq
168050660 gbinv1610.se
402140341 gbinv1611.se
498521166 gbinv1612.se
487560937 gbinv1613.se
470237421 gbinv1614.se
251883025 gbinv1615.se
450021867 gbinv1616.se
456014148 gbinv1617.se
424453416 gbinv1618.se
489077138 gbinv1619.se
319412812 gbinv162.seq
291935973 gbinv1620.se
447199297 gbinv1621.se
482287346 gbinv1622.se
446762057 gbinv1623.se
478107977 gbinv1624.se
499941570 gbinv1625.se
250754094 gbinv1626.se
426775075 gbinv1627.se
469944018 gbinv1628.se
421658854 gbinv1629.se
495488980 gbinv163.seq
156531103 gbinv1630.se
424023494 gbinv1631.se
458403575 gbinv1632.se
760558437 gbinv1633.se
630932111 gbinv1634.se
348282103 gbinv1635.se
482864667 gbinv1636.se
482420426 gbinv1637.se
481162029 gbinv1638.se
476708177 gbinv1639.se
496723739 gbinv164.seq
478452282 gbinv1640.se
98056964 gbinv1641.se
367764030 gbinv1642.se
492318902 gbinv1643.se
465538889 gbinv1644.se
440087513 gbinv1645.se
402923832 gbinv1646.se
293890829 gbinv1647.se
480424893 gbinv1648.se
487780990 gbinv1649.se
492757168 gbinv165.seq
497662462 gbinv1650.se
493315557 gbinv1651.se
454184050 gbinv1652.se
453672339 gbinv1653.se
477783541 gbinv1654.se
396639389 gbinv1655.se
258248902 gbinv1656.se
457972032 gbinv1657.se
493145244 gbinv1658.se
83808633 gbinv1659.se
483899601 gbinv166.seq
481310336 gbinv1660.se
484438327 gbinv1661.se
431604389 gbinv1662.se
466521191 gbinv1663.se
479481937 gbinv1664.se
203515617 gbinv1665.se
438666095 gbinv1666.se
288710027 gbinv1667.se
587646776 gbinv1668.se
521821380 gbinv1669.se
478256053 gbinv167.seq
488633320 gbinv1670.se
484849194 gbinv1671.se
494691429 gbinv1672.se
84878173 gbinv1673.se
474082897 gbinv1674.se
328282042 gbinv1675.se
429294922 gbinv1676.se
376618222 gbinv1677.se
465450082 gbinv1678.se
191733239 gbinv1679.se
492780857 gbinv168.seq
413988002 gbinv1680.se
346233485 gbinv1681.se
351456130 gbinv1682.se
332888212 gbinv1683.se
344512888 gbinv1684.se
161969290 gbinv1685.se
466172748 gbinv1686.se
443973599 gbinv1687.se
439364738 gbinv1688.se
492660163 gbinv1689.se
499976012 gbinv169.seq
421482701 gbinv1690.se
494043084 gbinv1691.se
349286868 gbinv1692.se
401241900 gbinv1693.se
478917983 gbinv1694.se
476837170 gbinv1695.se
489355798 gbinv1696.se
455471572 gbinv1697.se
498384166 gbinv1698.se
319485498 gbinv1699.se
498728841 gbinv17.seq
498322008 gbinv170.seq
499130515 gbinv1700.se
487864427 gbinv1701.se
493398968 gbinv1702.se
485556197 gbinv1703.se
485364037 gbinv1704.se
484935088 gbinv1705.se
466357014 gbinv1706.se
457733117 gbinv1707.se
392915750 gbinv1708.se
478478032 gbinv1709.se
483551083 gbinv171.seq
393129850 gbinv1710.se
492543588 gbinv1711.se
450108923 gbinv1712.se
351978698 gbinv1713.se
478292534 gbinv1714.se
420767553 gbinv1715.se
481749728 gbinv1716.se
445278271 gbinv1717.se
412662975 gbinv1718.se
387090079 gbinv1719.se
444451723 gbinv172.seq
256908256 gbinv1720.se
469736436 gbinv1721.se
490540910 gbinv1722.se
485878260 gbinv1723.se
465587474 gbinv1724.se
480998150 gbinv1725.se
465832905 gbinv1726.se
485326493 gbinv1727.se
433309101 gbinv1728.se
440675008 gbinv1729.se
483770018 gbinv173.seq
68735845 gbinv1730.se
450845716 gbinv1731.se
313135865 gbinv1732.se
429536528 gbinv1733.se
394632639 gbinv1734.se
476444266 gbinv1735.se
496585001 gbinv1736.se
484815304 gbinv1737.se
498211104 gbinv1738.se
490032585 gbinv1739.se
493576167 gbinv174.seq
88986595 gbinv1740.se
499092910 gbinv1741.se
471084800 gbinv1742.se
479084211 gbinv1743.se
458027456 gbinv1744.se
183437281 gbinv1745.se
489133522 gbinv1746.se
480973066 gbinv1747.se
476620478 gbinv1748.se
484763605 gbinv1749.se
498160027 gbinv175.seq
172605670 gbinv1750.se
476872305 gbinv1751.se
497217757 gbinv1752.se
454084009 gbinv1753.se
490687872 gbinv1754.se
249163765 gbinv1755.se
446287432 gbinv1756.se
480747279 gbinv1757.se
477662208 gbinv1758.se
486024070 gbinv1759.se
461241055 gbinv176.seq
138543432 gbinv1760.se
363404243 gbinv1761.se
440303391 gbinv1762.se
428374310 gbinv1763.se
485262912 gbinv1764.se
313605393 gbinv1765.se
384773620 gbinv1766.se
344575448 gbinv1767.se
302995972 gbinv1768.se
489532826 gbinv1769.se
429126369 gbinv177.seq
205630096 gbinv1770.se
469243590 gbinv1771.se
491841323 gbinv1772.se
478814364 gbinv1773.se
449053948 gbinv1774.se
480874694 gbinv1775.se
305311722 gbinv1776.se
455945961 gbinv1777.se
299250305 gbinv1778.se
480931807 gbinv1779.se
472246082 gbinv178.seq
439984634 gbinv1780.se
406664054 gbinv1781.se
381577942 gbinv1782.se
185200260 gbinv1783.se
349601440 gbinv1784.se
480401561 gbinv1785.se
483626729 gbinv1786.se
247425526 gbinv1787.se
407101180 gbinv1788.se
364334325 gbinv1789.se
487388602 gbinv179.seq
459985559 gbinv1790.se
404003999 gbinv1791.se
268459648 gbinv1792.se
477702099 gbinv1793.se
460168850 gbinv1794.se
478963154 gbinv1795.se
324699595 gbinv1796.se
491566844 gbinv1797.se
484918227 gbinv1798.se
471411039 gbinv1799.se
485356809 gbinv18.seq
488621132 gbinv180.seq
401957469 gbinv1800.se
174828331 gbinv1801.se
456950968 gbinv1802.se
452653049 gbinv1803.se
439521990 gbinv1804.se
469069239 gbinv1805.se
403378951 gbinv1806.se
498968159 gbinv1807.se
489660738 gbinv1808.se
447280245 gbinv1809.se
492386538 gbinv181.seq
491313358 gbinv1810.se
473371583 gbinv1811.se
421938580 gbinv1812.se
461808273 gbinv1813.se
499047170 gbinv1814.se
448428578 gbinv1815.se
478899995 gbinv1816.se
433199933 gbinv1817.se
447202279 gbinv1818.se
499645462 gbinv1819.se
410012642 gbinv182.seq
499728235 gbinv1820.se
281848846 gbinv1821.se
350069691 gbinv1822.se
276080178 gbinv1823.se
249584187 gbinv1824.se
482294957 gbinv1825.se
432625059 gbinv1826.se
390302552 gbinv1827.se
356463371 gbinv1828.se
434548133 gbinv1829.se
489753866 gbinv183.seq
499992092 gbinv1830.se
112301803 gbinv1831.se
498992007 gbinv1832.se
493005878 gbinv1833.se
494399781 gbinv1834.se
463657580 gbinv1835.se
486200575 gbinv1836.se
296149363 gbinv1837.se
404122235 gbinv1838.se
299824557 gbinv1839.se
486908019 gbinv184.seq
289913425 gbinv1840.se
253773333 gbinv1841.se
504406615 gbinv1842.se
502660531 gbinv1843.se
462708296 gbinv1844.se
343800410 gbinv1845.se
304171260 gbinv1846.se
296432606 gbinv1847.se
282298128 gbinv1848.se
281277784 gbinv1849.se
475277294 gbinv185.seq
272065061 gbinv1850.se
264586044 gbinv1851.se
488282800 gbinv1852.se
220144679 gbinv1853.se
416658392 gbinv1854.se
355528545 gbinv1855.se
440867432 gbinv1856.se
406695325 gbinv1857.se
485520087 gbinv1858.se
456871825 gbinv1859.se
499301159 gbinv186.seq
285317935 gbinv1860.se
435573273 gbinv1861.se
495486079 gbinv1862.se
478791254 gbinv1863.se
362223580 gbinv1864.se
463548723 gbinv1865.se
446713082 gbinv1866.se
492755543 gbinv1867.se
479071997 gbinv1868.se
94856663 gbinv1869.se
356777678 gbinv187.seq
487346963 gbinv1870.se
486480531 gbinv1871.se
491518484 gbinv1872.se
499253247 gbinv1873.se
492100745 gbinv1874.se
240584427 gbinv1875.se
473910512 gbinv1876.se
467512893 gbinv1877.se
489494146 gbinv1878.se
432756723 gbinv1879.se
461771503 gbinv188.seq
484035489 gbinv1880.se
490412203 gbinv1881.se
431205884 gbinv1882.se
494114749 gbinv1883.se
449713451 gbinv1884.se
434434579 gbinv1885.se
394577865 gbinv1886.se
374337630 gbinv1887.se
171037229 gbinv1888.se
480706996 gbinv1889.se
479426529 gbinv189.seq
480578541 gbinv1890.se
455876315 gbinv1891.se
479858717 gbinv1892.se
499257335 gbinv1893.se
497855628 gbinv1894.se
27351233 gbinv1895.se
411621973 gbinv1896.se
378984421 gbinv1897.se
459159097 gbinv1898.se
490406125 gbinv1899.se
453160467 gbinv19.seq
494640587 gbinv190.seq
466526746 gbinv1900.se
450347862 gbinv1901.se
371076512 gbinv1902.se
470003998 gbinv1903.se
480725717 gbinv1904.se
495111554 gbinv1905.se
489257512 gbinv1906.se
484731464 gbinv1907.se
458372509 gbinv1908.se
147355819 gbinv1909.se
328489973 gbinv191.seq
474361640 gbinv1910.se
443924586 gbinv1911.se
447614380 gbinv1912.se
476378024 gbinv1913.se
499602750 gbinv1914.se
373191394 gbinv1915.se
383648458 gbinv1916.se
497243375 gbinv1917.se
440587307 gbinv1918.se
467050705 gbinv1919.se
484117251 gbinv192.seq
336898451 gbinv1920.se
440552084 gbinv1921.se
485125937 gbinv1922.se
434540695 gbinv1923.se
349654018 gbinv1924.se
350272897 gbinv1925.se
486089196 gbinv1926.se
167675005 gbinv1927.se
476464424 gbinv1928.se
486534701 gbinv1929.se
499996770 gbinv193.seq
486900331 gbinv1930.se
489674973 gbinv1931.se
277527107 gbinv1932.se
472044955 gbinv1933.se
499227647 gbinv1934.se
246704369 gbinv1935.se
285322994 gbinv1936.se
261613424 gbinv1937.se
499652642 gbinv1938.se
452085451 gbinv1939.se
499998369 gbinv194.seq
404472936 gbinv1940.se
388757396 gbinv1941.se
360024243 gbinv1942.se
346007741 gbinv1943.se
451355949 gbinv1944.se
498149041 gbinv1945.se
435130352 gbinv1946.se
498313048 gbinv1947.se
489839164 gbinv1948.se
494750227 gbinv1949.se
116594649 gbinv195.seq
80427650 gbinv1950.se
483771533 gbinv1951.se
422193854 gbinv1952.se
483507579 gbinv1953.se
488710958 gbinv1954.se
340423353 gbinv1955.se
251026038 gbinv1956.se
421480407 gbinv1957.se
380506998 gbinv1958.se
469295978 gbinv1959.se
499999074 gbinv196.seq
491267604 gbinv1960.se
226895576 gbinv1961.se
401977202 gbinv1962.se
396971438 gbinv1963.se
367984786 gbinv1964.se
340174466 gbinv1965.se
335837652 gbinv1966.se
166168804 gbinv1967.se
467664520 gbinv1968.se
448836068 gbinv1969.se
499997883 gbinv197.seq
406993985 gbinv1970.se
496254260 gbinv1971.se
120918885 gbinv1972.se
468156859 gbinv1973.se
425813495 gbinv1974.se
479520730 gbinv1975.se
472363774 gbinv1976.se
277909672 gbinv1977.se
436991083 gbinv1978.se
482639712 gbinv1979.se
405208730 gbinv198.seq
348873045 gbinv1980.se
440487652 gbinv1981.se
435724062 gbinv1982.se
469805706 gbinv1983.se
479738839 gbinv1984.se
478060773 gbinv1985.se
494922118 gbinv1986.se
235454577 gbinv1987.se
476341765 gbinv1988.se
366934109 gbinv1989.se
499997036 gbinv199.seq
355366231 gbinv1990.se
469519030 gbinv1991.se
483902663 gbinv1992.se
99369574 gbinv1993.se
93113666 gbinv1994.se
422271007 gbinv1995.se
399120203 gbinv1996.se
496728551 gbinv1997.se
499561060 gbinv1998.se
470362613 gbinv1999.se
457496457 gbinv2.seq
497427024 gbinv20.seq
499998228 gbinv200.seq
150185251 gbinv2000.se
685164991 gbinv2001.se
629739282 gbinv2002.se
419098526 gbinv2003.se
389823796 gbinv2004.se
498119988 gbinv2005.se
393720255 gbinv2006.se
471500654 gbinv2007.se
481116573 gbinv2008.se
95705375 gbinv2009.se
181464670 gbinv201.seq
468616569 gbinv2010.se
292241470 gbinv2011.se
290625223 gbinv2012.se
437150325 gbinv2013.se
409335174 gbinv2014.se
303275686 gbinv2015.se
491069326 gbinv2016.se
399314261 gbinv2017.se
475414946 gbinv2018.se
430435061 gbinv2019.se
499997734 gbinv202.seq
467203257 gbinv2020.se
491685198 gbinv2021.se
490122539 gbinv2022.se
443572312 gbinv2023.se
414874046 gbinv2024.se
372396028 gbinv2025.se
495207624 gbinv2026.se
444023668 gbinv2027.se
472068210 gbinv2028.se
472293593 gbinv2029.se
500000133 gbinv203.seq
396294345 gbinv2030.se
458536775 gbinv2031.se
430505491 gbinv2032.se
471312153 gbinv2033.se
478183752 gbinv2034.se
468151023 gbinv2035.se
499390700 gbinv2036.se
193131369 gbinv2037.se
460077026 gbinv2038.se
489489263 gbinv2039.se
125104375 gbinv204.seq
425166824 gbinv2040.se
493385482 gbinv2041.se
488493611 gbinv2042.se
380056149 gbinv2043.se
335743780 gbinv2044.se
472528563 gbinv2045.se
416074978 gbinv2046.se
480828988 gbinv2047.se
428654064 gbinv2048.se
176622680 gbinv2049.se
499998194 gbinv205.seq
447970688 gbinv2050.se
486961944 gbinv2051.se
365582043 gbinv2052.se
400186520 gbinv2053.se
152136774 gbinv2054.se
472134370 gbinv2055.se
389423826 gbinv2056.se
321441155 gbinv2057.se
319780544 gbinv2058.se
474932352 gbinv2059.se
499998698 gbinv206.seq
484567075 gbinv2060.se
478403348 gbinv2061.se
497752321 gbinv2062.se
384248486 gbinv2063.se
487356355 gbinv2064.se
268179846 gbinv2065.se
394121999 gbinv2066.se
389616276 gbinv2067.se
492719310 gbinv2068.se
330165617 gbinv2069.se
151322108 gbinv207.seq
476397436 gbinv2070.se
585505873 gbinv2071.se
542341005 gbinv2072.se
493331060 gbinv2073.se
243355874 gbinv2074.se
483024917 gbinv2075.se
476781937 gbinv2076.se
487274340 gbinv2077.se
486478573 gbinv2078.se
405262036 gbinv2079.se
499997404 gbinv208.seq
96364297 gbinv2080.se
441214482 gbinv2081.se
499281998 gbinv2082.se
485174234 gbinv2083.se
452268479 gbinv2084.se
494685555 gbinv2085.se
480316704 gbinv2086.se
441835336 gbinv2087.se
477607772 gbinv2088.se
487324376 gbinv2089.se
499999137 gbinv209.seq
180631805 gbinv2090.se
489041947 gbinv2091.se
498480584 gbinv2092.se
483924716 gbinv2093.se
472344254 gbinv2094.se
461666211 gbinv2095.se
155235462 gbinv2096.se
478779437 gbinv2097.se
484495136 gbinv2098.se
494398404 gbinv2099.se
476460093 gbinv21.seq
155222552 gbinv210.seq
401955888 gbinv2100.se
484632866 gbinv2101.se
419719218 gbinv2102.se
435624958 gbinv2103.se
468669166 gbinv2104.se
90808886 gbinv2105.se
488197504 gbinv2106.se
446823195 gbinv2107.se
499183385 gbinv2108.se
478594914 gbinv2109.se
499998922 gbinv211.seq
490939464 gbinv2110.se
472135475 gbinv2111.se
484363141 gbinv2112.se
369004656 gbinv2113.se
492288068 gbinv2114.se
485810172 gbinv2115.se
475723818 gbinv2116.se
416034420 gbinv2117.se
459385495 gbinv2118.se
205005967 gbinv2119.se
499999382 gbinv212.seq
471023337 gbinv2120.se
299089605 gbinv2121.se
400971851 gbinv2122.se
339697668 gbinv2123.se
337569217 gbinv2124.se
275391490 gbinv2125.se
486170976 gbinv2126.se
481605244 gbinv2127.se
454398203 gbinv2128.se
492958974 gbinv2129.se
188834254 gbinv213.seq
347880334 gbinv2130.se
445095337 gbinv2131.se
334450818 gbinv2132.se
262742772 gbinv2133.se
447729907 gbinv2134.se
496311336 gbinv2135.se
464938229 gbinv2136.se
494372235 gbinv2137.se
472121956 gbinv2138.se
413672647 gbinv2139.se
499997560 gbinv214.seq
435343439 gbinv2140.se
335449507 gbinv2141.se
329860465 gbinv2142.se
237717680 gbinv2143.se
421224834 gbinv2144.se
312762764 gbinv2145.se
306193421 gbinv2146.se
295210234 gbinv2147.se
473158141 gbinv2148.se
498210290 gbinv2149.se
499999311 gbinv215.seq
488860842 gbinv2150.se
463925560 gbinv2151.se
671628695 gbinv2152.se
499084111 gbinv2153.se
392671020 gbinv2154.se
496375358 gbinv2155.se
295588392 gbinv2156.se
421050588 gbinv2157.se
397951635 gbinv2158.se
499540200 gbinv2159.se
245882870 gbinv216.seq
479607477 gbinv2160.se
112456434 gbinv2161.se
492624739 gbinv2162.se
399527665 gbinv2163.se
376326748 gbinv2164.se
470560734 gbinv2165.se
132600082 gbinv2166.se
422475887 gbinv2167.se
490649761 gbinv2168.se
337601558 gbinv2169.se
499999664 gbinv217.seq
314516388 gbinv2170.se
297308916 gbinv2171.se
292968500 gbinv2172.se
496164735 gbinv2173.se
481491039 gbinv2174.se
495265524 gbinv2175.se
253470716 gbinv2176.se
458530233 gbinv2177.se
487608719 gbinv2178.se
472429782 gbinv2179.se
499999011 gbinv218.seq
389636252 gbinv2180.se
495693435 gbinv2181.se
392052719 gbinv2182.se
264437788 gbinv2183.se
443334489 gbinv2184.se
230043423 gbinv2185.se
269964237 gbinv2186.se
494946146 gbinv2187.se
494490609 gbinv2188.se
495398094 gbinv2189.se
499999910 gbinv219.seq
469215569 gbinv2190.se
455146603 gbinv2191.se
295397747 gbinv2192.se
488413762 gbinv2193.se
487035672 gbinv2194.se
421138557 gbinv2195.se
480606575 gbinv2196.se
423180436 gbinv2197.se
490516344 gbinv2198.se
528217511 gbinv2199.se
439600490 gbinv22.seq
499995944 gbinv220.seq
521533551 gbinv2200.se
474679653 gbinv2201.se
470017923 gbinv2202.se
463630483 gbinv2203.se
447022560 gbinv2204.se
433272140 gbinv2205.se
403621417 gbinv2206.se
371161487 gbinv2207.se
370721975 gbinv2208.se
350699165 gbinv2209.se
172686155 gbinv221.seq
345978572 gbinv2210.se
334192498 gbinv2211.se
302363554 gbinv2212.se
483111071 gbinv2213.se
370391063 gbinv2214.se
462747061 gbinv2215.se
374603467 gbinv2216.se
371684472 gbinv2217.se
367702787 gbinv2218.se
254844076 gbinv2219.se
499999374 gbinv222.seq
447028067 gbinv2220.se
425304745 gbinv2221.se
333352110 gbinv2222.se
274400304 gbinv2223.se
471736787 gbinv2224.se
490609032 gbinv2225.se
39963466 gbinv2226.se
250445442 gbinv2227.se
340936274 gbinv2228.se
331290199 gbinv2229.se
455573372 gbinv223.seq
459338870 gbinv2230.se
398156374 gbinv2231.se
209872305 gbinv2232.se
493727525 gbinv2233.se
234053029 gbinv2234.se
330398798 gbinv2235.se
322152710 gbinv2236.se
438520091 gbinv2237.se
329194366 gbinv2238.se
259765999 gbinv2239.se
289058569 gbinv224.seq
491352505 gbinv2240.se
495997215 gbinv2241.se
453638594 gbinv2242.se
223893231 gbinv2243.se
462328934 gbinv2244.se
47937837 gbinv2245.se
666099951 gbinv2246.se
608322909 gbinv2247.se
606999577 gbinv2248.se
598409357 gbinv2249.se
54983087 gbinv225.seq
554616198 gbinv2250.se
549526793 gbinv2251.se
543397305 gbinv2252.se
493234978 gbinv2253.se
482622307 gbinv2254.se
441160836 gbinv2255.se
409120880 gbinv2256.se
407748242 gbinv2257.se
401098026 gbinv2258.se
381292692 gbinv2259.se
52942591 gbinv226.seq
492620993 gbinv2260.se
209061532 gbinv2261.se
195551873 gbinv2262.se
483933652 gbinv2263.se
448922184 gbinv2264.se
377933642 gbinv2265.se
353832635 gbinv2266.se
466186244 gbinv2267.se
472093739 gbinv2268.se
302044899 gbinv2269.se
157076096 gbinv227.seq
396194374 gbinv2270.se
378718477 gbinv2271.se
350612967 gbinv2272.se
348071696 gbinv2273.se
342986431 gbinv2274.se
499133175 gbinv2275.se
470225049 gbinv2276.se
435027658 gbinv2277.se
420532966 gbinv2278.se
402683464 gbinv2279.se
499999147 gbinv228.seq
384540677 gbinv2280.se
494725877 gbinv2281.se
453956073 gbinv2282.se
204295509 gbinv2283.se
474067646 gbinv2284.se
476639601 gbinv2285.se
484933107 gbinv2286.se
395732392 gbinv2287.se
438890022 gbinv2288.se
456308133 gbinv2289.se
268190266 gbinv229.seq
470537310 gbinv2290.se
482209951 gbinv2291.se
473028372 gbinv2292.se
423354886 gbinv2293.se
486387593 gbinv2294.se
444536472 gbinv2295.se
338942046 gbinv2296.se
253372208 gbinv2297.se
490194682 gbinv2298.se
397571523 gbinv2299.se
173964304 gbinv23.seq
499996088 gbinv230.seq
160017925 gbinv2300.se
444526866 gbinv2301.se
498822648 gbinv2302.se
878734418 gbinv2303.se
874599041 gbinv2304.se
872525000 gbinv2305.se
810605254 gbinv2306.se
791733638 gbinv2307.se
789407437 gbinv2308.se
782472270 gbinv2309.se
499997883 gbinv231.seq
744341862 gbinv2310.se
734535542 gbinv2311.se
723265217 gbinv2312.se
701789494 gbinv2313.se
634436683 gbinv2314.se
597991819 gbinv2315.se
584398302 gbinv2316.se
575496297 gbinv2317.se
20247 gbinv2318.se
481165334 gbinv2319.se
182060786 gbinv232.seq
455732808 gbinv2320.se
485309856 gbinv2321.se
494513726 gbinv2322.se
497663773 gbinv2323.se
382364504 gbinv2324.se
437913419 gbinv2325.se
481538424 gbinv2326.se
246957812 gbinv2327.se
269453322 gbinv2328.se
448776283 gbinv2329.se
499192390 gbinv233.seq
437794803 gbinv2330.se
475781424 gbinv2331.se
486507257 gbinv2332.se
252424559 gbinv2333.se
463198906 gbinv2334.se
484570735 gbinv2335.se
491262429 gbinv2336.se
481748685 gbinv2337.se
439969911 gbinv2338.se
474681061 gbinv2339.se
499771354 gbinv234.seq
496223471 gbinv2340.se
479327549 gbinv2341.se
490980575 gbinv2342.se
401290606 gbinv2343.se
450069903 gbinv2344.se
231800070 gbinv2345.se
466481331 gbinv2346.se
267102427 gbinv2347.se
486393703 gbinv2348.se
493548517 gbinv2349.se
498733787 gbinv235.seq
47011992 gbinv2350.se
477137813 gbinv2351.se
484635703 gbinv2352.se
480774927 gbinv2353.se
383503507 gbinv2354.se
633887367 gbinv2355.se
596035677 gbinv2356.se
453103954 gbinv2357.se
398773887 gbinv2358.se
499266023 gbinv2359.se
135327980 gbinv236.seq
488559276 gbinv2360.se
449420963 gbinv2361.se
244190922 gbinv2362.se
325251055 gbinv2363.se
319761877 gbinv2364.se
303271636 gbinv2365.se
288442013 gbinv2366.se
286359699 gbinv2367.se
274771980 gbinv2368.se
269362148 gbinv2369.se
496659695 gbinv237.seq
269094691 gbinv2370.se
495661466 gbinv2371.se
443298652 gbinv2372.se
434864143 gbinv2373.se
380857489 gbinv2374.se
427749408 gbinv2375.se
482123129 gbinv2376.se
490392359 gbinv2377.se
379537415 gbinv2378.se
359370523 gbinv2379.se
51960557 gbinv238.seq
452003097 gbinv2380.se
424541726 gbinv2381.se
423152550 gbinv2382.se
444327089 gbinv2383.se
499572556 gbinv2384.se
475369530 gbinv2385.se
462235675 gbinv2386.se
90001324 gbinv2387.se
496650137 gbinv2388.se
489821547 gbinv2389.se
466568646 gbinv239.seq
460822299 gbinv2390.se
307445643 gbinv2391.se
380013590 gbinv2392.se
488931197 gbinv2393.se
454367081 gbinv2394.se
349039969 gbinv2395.se
473031888 gbinv2396.se
418801674 gbinv2397.se
498108082 gbinv2398.se
498120349 gbinv2399.se
490451259 gbinv24.seq
479577598 gbinv240.seq
408929343 gbinv2400.se
499630119 gbinv2401.se
384531267 gbinv2402.se
457310693 gbinv2403.se
444277320 gbinv2404.se
471783657 gbinv2405.se
422890466 gbinv2406.se
391304772 gbinv2407.se
477926754 gbinv2408.se
445795962 gbinv2409.se
450560394 gbinv241.seq
151928710 gbinv2410.se
472706293 gbinv2411.se
487216638 gbinv2412.se
253217892 gbinv2413.se
370579793 gbinv2414.se
469571875 gbinv2415.se
130063931 gbinv2416.se
492341075 gbinv2417.se
448952174 gbinv2418.se
494816993 gbinv2419.se
482003105 gbinv242.seq
489097379 gbinv2420.se
380096149 gbinv2421.se
437128933 gbinv2422.se
414796835 gbinv2423.se
485308820 gbinv2424.se
499863087 gbinv2425.se
389548539 gbinv2426.se
483092509 gbinv2427.se
497796128 gbinv2428.se
354964088 gbinv2429.se
121049467 gbinv243.seq
341517141 gbinv2430.se
186308430 gbinv2431.se
455520000 gbinv2432.se
488591295 gbinv2433.se
471889620 gbinv2434.se
468386713 gbinv2435.se
273137680 gbinv2436.se
475682267 gbinv2437.se
489831807 gbinv2438.se
498258838 gbinv2439.se
494590358 gbinv244.seq
435674712 gbinv2440.se
126649563 gbinv2441.se
471916306 gbinv2442.se
419891689 gbinv2443.se
436853704 gbinv2444.se
468729750 gbinv2445.se
258794959 gbinv2446.se
433858233 gbinv2447.se
495102250 gbinv2448.se
472343980 gbinv2449.se
499153393 gbinv245.seq
436807814 gbinv2450.se
497542139 gbinv2451.se
473743854 gbinv2452.se
474406895 gbinv2453.se
488848334 gbinv2454.se
102391847 gbinv2455.se
473839183 gbinv2456.se
492933413 gbinv2457.se
443134261 gbinv2458.se
321025551 gbinv2459.se
499599167 gbinv246.seq
243584430 gbinv2460.se
465907063 gbinv2461.se
381182722 gbinv2462.se
335529634 gbinv2463.se
470572982 gbinv2464.se
482586153 gbinv2465.se
54239318 gbinv2466.se
466687468 gbinv2467.se
463581688 gbinv2468.se
466345250 gbinv2469.se
494052759 gbinv247.seq
461907502 gbinv2470.se
317778784 gbinv2471.se
478443992 gbinv2472.se
292864445 gbinv2473.se
561078574 gbinv2474.se
527425233 gbinv2475.se
480040409 gbinv2476.se
479973044 gbinv2477.se
473597004 gbinv2478.se
469999664 gbinv2479.se
498084896 gbinv248.seq
471372098 gbinv2480.se
481907395 gbinv2481.se
324814919 gbinv2482.se
471748432 gbinv2483.se
362011622 gbinv2484.se
415540099 gbinv2485.se
470695666 gbinv2486.se
491801071 gbinv2487.se
342413604 gbinv2488.se
452407188 gbinv2489.se
493910409 gbinv249.seq
399752974 gbinv2490.se
460141586 gbinv2491.se
465234204 gbinv2492.se
491366078 gbinv2493.se
310042236 gbinv2494.se
443515499 gbinv2495.se
431455593 gbinv2496.se
458608098 gbinv2497.se
489445540 gbinv2498.se
470672667 gbinv2499.se
491062414 gbinv25.seq
305143352 gbinv250.seq
222134283 gbinv2500.se
418383435 gbinv2501.se
489254306 gbinv2502.se
434277187 gbinv2503.se
470762853 gbinv2504.se
289123670 gbinv2505.se
486602298 gbinv2506.se
470151895 gbinv2507.se
378353582 gbinv2508.se
427559841 gbinv2509.se
453013224 gbinv251.seq
485589271 gbinv2510.se
493053369 gbinv2511.se
391309323 gbinv2512.se
468773311 gbinv2513.se
462352263 gbinv2514.se
496508959 gbinv2515.se
484695003 gbinv2516.se
137180299 gbinv2517.se
593390575 gbinv2518.se
598139355 gbinv2519.se
480839077 gbinv252.seq
590227411 gbinv2520.se
586230262 gbinv2521.se
574374521 gbinv2522.se
544350211 gbinv2523.se
521946190 gbinv2524.se
469461153 gbinv2525.se
457537023 gbinv2526.se
374045251 gbinv2527.se
364819928 gbinv2528.se
357491398 gbinv2529.se
375796260 gbinv253.seq
340643640 gbinv2530.se
323564724 gbinv2531.se
499947802 gbinv2532.se
92123890 gbinv2533.se
474020597 gbinv2534.se
480708567 gbinv2535.se
469367579 gbinv2536.se
492815571 gbinv2537.se
92554169 gbinv2538.se
361765937 gbinv2539.se
499933702 gbinv254.seq
465831891 gbinv2540.se
384175099 gbinv2541.se
497041728 gbinv2542.se
453369230 gbinv2543.se
498008699 gbinv2544.se
482798657 gbinv2545.se
124512981 gbinv2546.se
481399774 gbinv2547.se
395198134 gbinv2548.se
423236220 gbinv2549.se
485464339 gbinv255.seq
379497414 gbinv2550.se
498087484 gbinv2551.se
472511978 gbinv2552.se
490949512 gbinv2553.se
483576966 gbinv2554.se
497131956 gbinv2555.se
478877128 gbinv2556.se
488383749 gbinv2557.se
470901313 gbinv2558.se
499661934 gbinv2559.se
485283938 gbinv256.seq
499999299 gbinv2560.se
251793675 gbinv2561.se
498294953 gbinv257.seq
414580638 gbinv258.seq
498679440 gbinv259.seq
470215320 gbinv26.seq
495007238 gbinv260.seq
486086193 gbinv261.seq
483986740 gbinv262.seq
479016567 gbinv263.seq
377180280 gbinv264.seq
491313703 gbinv265.seq
482991950 gbinv266.seq
495169229 gbinv267.seq
493741890 gbinv268.seq
495500028 gbinv269.seq
485523455 gbinv27.seq
371035005 gbinv270.seq
470293000 gbinv271.seq
496253081 gbinv272.seq
496289838 gbinv273.seq
472378022 gbinv274.seq
493450323 gbinv275.seq
418570715 gbinv276.seq
493158119 gbinv277.seq
491119641 gbinv278.seq
465656312 gbinv279.seq
174159504 gbinv28.seq
490891118 gbinv280.seq
459581775 gbinv281.seq
406078142 gbinv282.seq
476900813 gbinv283.seq
481848691 gbinv284.seq
496747716 gbinv285.seq
492742204 gbinv286.seq
496271174 gbinv287.seq
392139815 gbinv288.seq
496951694 gbinv289.seq
486730694 gbinv29.seq
492317100 gbinv290.seq
475961856 gbinv291.seq
498252048 gbinv292.seq
496664764 gbinv293.seq
351267284 gbinv294.seq
454438248 gbinv295.seq
490109816 gbinv296.seq
477836082 gbinv297.seq
497117087 gbinv298.seq
273421111 gbinv299.seq
499999452 gbinv3.seq
495353494 gbinv30.seq
484550538 gbinv300.seq
486204454 gbinv301.seq
489013669 gbinv302.seq
499892182 gbinv303.seq
389960712 gbinv304.seq
230763287 gbinv305.seq
433765668 gbinv306.seq
341801067 gbinv307.seq
488714019 gbinv308.seq
442231654 gbinv309.seq
471931517 gbinv31.seq
498589041 gbinv310.seq
499230488 gbinv311.seq
194405414 gbinv312.seq
499998058 gbinv313.seq
499998364 gbinv314.seq
395726273 gbinv315.seq
499997345 gbinv316.seq
499998631 gbinv317.seq
234518794 gbinv318.seq
499998912 gbinv319.seq
488287283 gbinv32.seq
499997675 gbinv320.seq
289473295 gbinv321.seq
499998904 gbinv322.seq
499997765 gbinv323.seq
395381535 gbinv324.seq
499998475 gbinv325.seq
499999467 gbinv326.seq
499650322 gbinv327.seq
499858364 gbinv328.seq
351644014 gbinv329.seq
494771070 gbinv33.seq
499999353 gbinv330.seq
499954513 gbinv331.seq
394312187 gbinv332.seq
499998973 gbinv333.seq
499768151 gbinv334.seq
499935390 gbinv335.seq
262394318 gbinv336.seq
499489044 gbinv337.seq
499984461 gbinv338.seq
499999178 gbinv339.seq
452242161 gbinv34.seq
219010924 gbinv340.seq
499665286 gbinv341.seq
499954794 gbinv342.seq
499986274 gbinv343.seq
349517342 gbinv344.seq
500000137 gbinv345.seq
499979428 gbinv346.seq
499843177 gbinv347.seq
499948105 gbinv348.seq
500000223 gbinv349.seq
319197815 gbinv35.seq
67122505 gbinv350.seq
499999636 gbinv351.seq
499704487 gbinv352.seq
499897338 gbinv353.seq
499999895 gbinv354.seq
68002970 gbinv355.seq
499977958 gbinv356.seq
499904157 gbinv357.seq
499970007 gbinv358.seq
499999529 gbinv359.seq
305989835 gbinv36.seq
499940074 gbinv360.seq
122380920 gbinv361.seq
500000224 gbinv362.seq
499999552 gbinv363.seq
468683478 gbinv364.seq
499670167 gbinv365.seq
499934229 gbinv366.seq
499999149 gbinv367.seq
90103424 gbinv368.seq
499998050 gbinv369.seq
499448339 gbinv37.seq
499995493 gbinv370.seq
499995997 gbinv371.seq
499995585 gbinv372.seq
499995576 gbinv373.seq
131711062 gbinv374.seq
499993745 gbinv375.seq
499999126 gbinv376.seq
499999718 gbinv377.seq
58189022 gbinv378.seq
500000106 gbinv379.seq
331575916 gbinv38.seq
499974743 gbinv380.seq
497394329 gbinv381.seq
486067837 gbinv382.seq
97512248 gbinv383.seq
481046566 gbinv384.seq
450037592 gbinv385.seq
303709120 gbinv386.seq
293451879 gbinv387.seq
280090292 gbinv388.seq
279807655 gbinv389.seq
409329994 gbinv39.seq
274554291 gbinv390.seq
266890013 gbinv391.seq
491295680 gbinv392.seq
418047621 gbinv393.seq
383074342 gbinv394.seq
489267408 gbinv395.seq
393039463 gbinv396.seq
484538449 gbinv397.seq
482310364 gbinv398.seq
491415359 gbinv399.seq
499495330 gbinv4.seq
337324712 gbinv40.seq
495004950 gbinv400.seq
484038821 gbinv401.seq
495670320 gbinv402.seq
40846857 gbinv403.seq
492571202 gbinv404.seq
490206006 gbinv405.seq
445709424 gbinv406.seq
207302902 gbinv407.seq
370283947 gbinv408.seq
207800719 gbinv409.seq
416903973 gbinv41.seq
403111025 gbinv410.seq
496966413 gbinv411.seq
495208718 gbinv412.seq
486338081 gbinv413.seq
491887863 gbinv414.seq
62682558 gbinv415.seq
487684874 gbinv416.seq
495915356 gbinv417.seq
497117994 gbinv418.seq
485878834 gbinv419.seq
480341756 gbinv42.seq
336958408 gbinv420.seq
470338855 gbinv421.seq
473857916 gbinv422.seq
488417194 gbinv423.seq
472996654 gbinv424.seq
444602917 gbinv425.seq
489109149 gbinv426.seq
489050714 gbinv427.seq
492905647 gbinv428.seq
464574397 gbinv429.seq
470721202 gbinv43.seq
389650543 gbinv430.seq
499026362 gbinv431.seq
459755126 gbinv432.seq
457336321 gbinv433.seq
468059538 gbinv434.seq
487547225 gbinv435.seq
494629437 gbinv436.seq
499368968 gbinv437.seq
425865947 gbinv438.seq
447703471 gbinv439.seq
478013763 gbinv44.seq
471358720 gbinv440.seq
106488590 gbinv441.seq
494438067 gbinv442.seq
499096313 gbinv443.seq
174717833 gbinv444.seq
439432672 gbinv445.seq
315017082 gbinv446.seq
247279447 gbinv447.seq
493106968 gbinv448.seq
482399453 gbinv449.seq
372275396 gbinv45.seq
487563600 gbinv450.seq
495047837 gbinv451.seq
345419513 gbinv452.seq
499133273 gbinv453.seq
496482189 gbinv454.seq
369581646 gbinv455.seq
456145557 gbinv456.seq
200285196 gbinv457.seq
495154413 gbinv458.seq
341654330 gbinv459.seq
473606814 gbinv46.seq
336683654 gbinv460.seq
493060580 gbinv461.seq
107491235 gbinv462.seq
487938647 gbinv463.seq
495763325 gbinv464.seq
481723089 gbinv465.seq
326171717 gbinv466.seq
485891711 gbinv467.seq
492821648 gbinv468.seq
471307712 gbinv469.seq
476845411 gbinv47.seq
311911756 gbinv470.seq
499380148 gbinv471.seq
482084817 gbinv472.seq
479662419 gbinv473.seq
363343706 gbinv474.seq
489746713 gbinv475.seq
499514774 gbinv476.seq
496438512 gbinv477.seq
492580334 gbinv478.seq
486836376 gbinv479.seq
486980011 gbinv48.seq
496615730 gbinv480.seq
482720635 gbinv481.seq
134241704 gbinv482.seq
493089306 gbinv483.seq
490891004 gbinv484.seq
498098866 gbinv485.seq
498391590 gbinv486.seq
493309439 gbinv487.seq
324291471 gbinv488.seq
484493924 gbinv489.seq
160013874 gbinv49.seq
491069771 gbinv490.seq
494055574 gbinv491.seq
235593723 gbinv492.seq
319983008 gbinv493.seq
484241023 gbinv494.seq
216170369 gbinv495.seq
218804026 gbinv496.seq
336455655 gbinv497.seq
297857601 gbinv498.seq
477593708 gbinv499.seq
499748536 gbinv5.seq
493935222 gbinv50.seq
493171167 gbinv500.seq
96653657 gbinv501.seq
401450903 gbinv502.seq
471214414 gbinv503.seq
478230772 gbinv504.seq
481554780 gbinv505.seq
119372855 gbinv506.seq
489114034 gbinv507.seq
418974457 gbinv508.seq
492119058 gbinv509.seq
422099764 gbinv51.seq
488068826 gbinv510.seq
86400276 gbinv511.seq
475977385 gbinv512.seq
479094391 gbinv513.seq
91925882 gbinv514.seq
498866242 gbinv515.seq
475446584 gbinv516.seq
492109157 gbinv517.seq
493644048 gbinv518.seq
450867996 gbinv519.seq
466237117 gbinv52.seq
491759493 gbinv520.seq
84745799 gbinv521.seq
423732674 gbinv522.seq
344360076 gbinv523.seq
487664625 gbinv524.seq
481798553 gbinv525.seq
419437573 gbinv526.seq
447480354 gbinv527.seq
458542150 gbinv528.seq
84187054 gbinv529.seq
490207614 gbinv53.seq
476248749 gbinv530.seq
482272438 gbinv531.seq
498234741 gbinv532.seq
471043224 gbinv533.seq
136592520 gbinv534.seq
495120952 gbinv535.seq
498047113 gbinv536.seq
493290837 gbinv537.seq
467613412 gbinv538.seq
464868282 gbinv539.seq
480431708 gbinv54.seq
485108715 gbinv540.seq
70627368 gbinv541.seq
444909488 gbinv542.seq
457689916 gbinv543.seq
485382078 gbinv544.seq
496105931 gbinv545.seq
484291167 gbinv546.seq
248438198 gbinv547.seq
413526177 gbinv548.seq
438000207 gbinv549.seq
268718981 gbinv55.seq
487748206 gbinv550.seq
497322827 gbinv551.seq
171187065 gbinv552.seq
404122148 gbinv553.seq
358274008 gbinv554.seq
352555230 gbinv555.seq
335719715 gbinv556.seq
334992684 gbinv557.seq
323934868 gbinv558.seq
323397124 gbinv559.seq
391536350 gbinv56.seq
292340545 gbinv560.seq
497373639 gbinv561.seq
451425634 gbinv562.seq
352564218 gbinv563.seq
457737190 gbinv564.seq
480925976 gbinv565.seq
482363288 gbinv566.seq
490058774 gbinv567.seq
457330992 gbinv568.seq
213313220 gbinv569.seq
441369502 gbinv57.seq
475683221 gbinv570.seq
475722382 gbinv571.seq
474820474 gbinv572.seq
463889606 gbinv573.seq
174479470 gbinv574.seq
467301426 gbinv575.seq
487596983 gbinv576.seq
466523941 gbinv577.seq
473849332 gbinv578.seq
271533425 gbinv579.seq
395604817 gbinv58.seq
474315468 gbinv580.seq
422684936 gbinv581.seq
403437207 gbinv582.seq
460401414 gbinv583.seq
495684114 gbinv584.seq
496931437 gbinv585.seq
255707629 gbinv586.seq
488417645 gbinv587.seq
493391118 gbinv588.seq
430721640 gbinv589.seq
484951437 gbinv59.seq
483962961 gbinv590.seq
482614063 gbinv591.seq
466924368 gbinv592.seq
153705523 gbinv593.seq
469807657 gbinv594.seq
497173372 gbinv595.seq
486068129 gbinv596.seq
497761269 gbinv597.seq
483774021 gbinv598.seq
208975227 gbinv599.seq
371668925 gbinv6.seq
431159123 gbinv60.seq
482561048 gbinv600.seq
489387386 gbinv601.seq
174750473 gbinv602.seq
520668510 gbinv603.seq
439679373 gbinv604.seq
76608705 gbinv605.seq
544459581 gbinv606.seq
291577990 gbinv607.seq
499183813 gbinv608.seq
449457434 gbinv609.seq
449767967 gbinv61.seq
403099826 gbinv610.seq
426341523 gbinv611.seq
452289588 gbinv612.seq
332054885 gbinv613.seq
216067261 gbinv614.seq
363589773 gbinv615.seq
349108604 gbinv616.seq
466080734 gbinv617.seq
433540835 gbinv618.seq
325349387 gbinv619.seq
494181807 gbinv62.seq
414135977 gbinv620.seq
443362325 gbinv621.seq
458656169 gbinv622.seq
469667434 gbinv623.seq
275644987 gbinv624.seq
446552014 gbinv625.seq
480169917 gbinv626.seq
474041236 gbinv627.seq
439739785 gbinv628.seq
415879695 gbinv629.seq
497557396 gbinv63.seq
467640439 gbinv630.seq
312202563 gbinv631.seq
476756795 gbinv632.seq
477061626 gbinv633.seq
483683490 gbinv634.seq
495487713 gbinv635.seq
69234679 gbinv636.seq
477792636 gbinv637.seq
492728468 gbinv638.seq
425135691 gbinv639.seq
409223006 gbinv64.seq
353041445 gbinv640.seq
470334960 gbinv641.seq
494601058 gbinv642.seq
481221711 gbinv643.seq
396473476 gbinv644.seq
483642314 gbinv645.seq
482127664 gbinv646.seq
470874419 gbinv647.seq
495029689 gbinv648.seq
99066263 gbinv649.seq
432405101 gbinv65.seq
477955845 gbinv650.seq
452660426 gbinv651.seq
467009813 gbinv652.seq
409211575 gbinv653.seq
281441527 gbinv654.seq
321243822 gbinv655.seq
272762615 gbinv656.seq
459220600 gbinv657.seq
380210496 gbinv658.seq
157861358 gbinv659.seq
302298162 gbinv66.seq
496825048 gbinv660.seq
457058797 gbinv661.seq
475749694 gbinv662.seq
458940745 gbinv663.seq
478290025 gbinv664.seq
201201186 gbinv665.seq
476458619 gbinv666.seq
472367844 gbinv667.seq
491956509 gbinv668.seq
445112980 gbinv669.seq
474204665 gbinv67.seq
478727516 gbinv670.seq
213103145 gbinv671.seq
426002690 gbinv672.seq
491306551 gbinv673.seq
485922068 gbinv674.seq
470775025 gbinv675.seq
259886474 gbinv676.seq
323358243 gbinv677.seq
292361181 gbinv678.seq
472027339 gbinv679.seq
499406905 gbinv68.seq
394618639 gbinv680.seq
498685113 gbinv681.seq
252840705 gbinv682.seq
409818882 gbinv683.seq
483153574 gbinv684.seq
356373819 gbinv685.seq
382117771 gbinv686.seq
414986838 gbinv687.seq
358562967 gbinv688.seq
454612949 gbinv689.seq
493280432 gbinv69.seq
397094236 gbinv690.seq
472022816 gbinv691.seq
375604154 gbinv692.seq
260058125 gbinv693.seq
416870448 gbinv694.seq
337551656 gbinv695.seq
323476118 gbinv696.seq
316192878 gbinv697.seq
483033075 gbinv698.seq
484553056 gbinv699.seq
462608484 gbinv7.seq
319188821 gbinv70.seq
485400895 gbinv700.seq
444237062 gbinv701.seq
115137081 gbinv702.seq
465061268 gbinv703.seq
450665417 gbinv704.seq
495339385 gbinv705.seq
358679242 gbinv706.seq
488909847 gbinv707.seq
494569731 gbinv708.seq
446419168 gbinv709.seq
491655073 gbinv71.seq
393089050 gbinv710.seq
119924885 gbinv711.seq
475723349 gbinv712.seq
418498253 gbinv713.seq
487729463 gbinv714.seq
442064966 gbinv715.seq
459399034 gbinv716.seq
476019529 gbinv717.seq
489445959 gbinv718.seq
488427181 gbinv719.seq
492219703 gbinv72.seq
39113487 gbinv720.seq
478318630 gbinv721.seq
485192704 gbinv722.seq
487924132 gbinv723.seq
367187723 gbinv724.seq
491253033 gbinv725.seq
492099884 gbinv726.seq
492318782 gbinv727.seq
490488560 gbinv728.seq
264709414 gbinv729.seq
480268373 gbinv73.seq
498243322 gbinv730.seq
461893097 gbinv731.seq
479536374 gbinv732.seq
498214872 gbinv733.seq
358503530 gbinv734.seq
497880059 gbinv735.seq
328840422 gbinv736.seq
388768319 gbinv737.seq
497514162 gbinv738.seq
102760609 gbinv739.seq
421068648 gbinv74.seq
424365480 gbinv740.seq
415464839 gbinv741.seq
468645236 gbinv742.seq
491418312 gbinv743.seq
422461178 gbinv744.seq
494059900 gbinv745.seq
492105201 gbinv746.seq
371680457 gbinv747.seq
418666111 gbinv748.seq
385203223 gbinv749.seq
498478577 gbinv75.seq
490161407 gbinv750.seq
462283913 gbinv751.seq
497343220 gbinv752.seq
483358775 gbinv753.seq
419495810 gbinv754.seq
495088992 gbinv755.seq
118039128 gbinv756.seq
460760613 gbinv757.seq
474795905 gbinv758.seq
448271770 gbinv759.seq
489123698 gbinv76.seq
447953092 gbinv760.seq
397698504 gbinv761.seq
412906977 gbinv762.seq
414039055 gbinv763.seq
373499990 gbinv764.seq
352095009 gbinv765.seq
171624580 gbinv766.seq
492880950 gbinv767.seq
496329611 gbinv768.seq
495293458 gbinv769.seq
498905574 gbinv77.seq
326435281 gbinv770.seq
478875133 gbinv771.seq
438224962 gbinv772.seq
474184048 gbinv773.seq
357686295 gbinv774.seq
465465282 gbinv775.seq
485209832 gbinv776.seq
427730310 gbinv777.seq
361113223 gbinv778.seq
482159714 gbinv779.seq
234808936 gbinv78.seq
495382944 gbinv780.seq
299589099 gbinv781.seq
321246481 gbinv782.seq
309309582 gbinv783.seq
488604754 gbinv784.seq
410235494 gbinv785.seq
495922375 gbinv786.seq
434632204 gbinv787.seq
74348655 gbinv788.seq
541537247 gbinv789.seq
466465897 gbinv79.seq
355690685 gbinv790.seq
292909846 gbinv791.seq
463584322 gbinv792.seq
387676008 gbinv793.seq
372674865 gbinv794.seq
485847387 gbinv795.seq
484407673 gbinv796.seq
473708314 gbinv797.seq
352986490 gbinv798.seq
443627527 gbinv799.seq
446653334 gbinv8.seq
473206517 gbinv80.seq
434076487 gbinv800.seq
478667921 gbinv801.seq
488478103 gbinv802.seq
306326401 gbinv803.seq
385565833 gbinv804.seq
482190195 gbinv805.seq
137160705 gbinv806.seq
490300743 gbinv807.seq
419187067 gbinv808.seq
398652960 gbinv809.seq
478992009 gbinv81.seq
436288257 gbinv810.seq
493888501 gbinv811.seq
447343866 gbinv812.seq
496950073 gbinv813.seq
68378185 gbinv814.seq
484369453 gbinv815.seq
474926486 gbinv816.seq
480605871 gbinv817.seq
489403870 gbinv818.seq
489850852 gbinv819.seq
282038790 gbinv82.seq
483923401 gbinv820.seq
195051546 gbinv821.seq
278317571 gbinv822.seq
405202233 gbinv823.seq
481613416 gbinv824.seq
483053144 gbinv825.seq
140617338 gbinv826.seq
480377160 gbinv827.seq
499100085 gbinv828.seq
495490578 gbinv829.seq
478991943 gbinv83.seq
401267230 gbinv830.seq
334138952 gbinv831.seq
475047240 gbinv832.seq
428648405 gbinv833.seq
378490165 gbinv834.seq
487837824 gbinv835.seq
491255029 gbinv836.seq
375538343 gbinv837.seq
353621722 gbinv838.seq
408852378 gbinv839.seq
483677905 gbinv84.seq
494054422 gbinv840.seq
437725967 gbinv841.seq
364183673 gbinv842.seq
466430597 gbinv843.seq
418516710 gbinv844.seq
347070086 gbinv845.seq
481701036 gbinv846.seq
453274315 gbinv847.seq
496564297 gbinv848.seq
467957545 gbinv849.seq
483677903 gbinv85.seq
479873706 gbinv850.seq
479944057 gbinv851.seq
154655407 gbinv852.seq
464570217 gbinv853.seq
498348538 gbinv854.seq
474586953 gbinv855.seq
481881129 gbinv856.seq
132360635 gbinv857.seq
377651382 gbinv858.seq
471908759 gbinv859.seq
309424683 gbinv86.seq
346087536 gbinv860.seq
221434064 gbinv861.seq
312336498 gbinv862.seq
482097150 gbinv863.seq
426274349 gbinv864.seq
491798282 gbinv865.seq
456244166 gbinv866.seq
498886557 gbinv867.seq
413523689 gbinv868.seq
494612233 gbinv869.seq
483677981 gbinv87.seq
269134738 gbinv870.seq
458119773 gbinv871.seq
492920478 gbinv872.seq
331278911 gbinv873.seq
237876308 gbinv874.seq
380568436 gbinv875.seq
323208797 gbinv876.seq
298483269 gbinv877.seq
296444100 gbinv878.seq
461753371 gbinv879.seq
483678137 gbinv88.seq
66028693 gbinv880.seq
499911575 gbinv881.seq
471640101 gbinv882.seq
447745268 gbinv883.seq
441848406 gbinv884.seq
180180054 gbinv885.seq
470673663 gbinv886.seq
492818173 gbinv887.seq
498278063 gbinv888.seq
445601713 gbinv889.seq
478992326 gbinv89.seq
469989934 gbinv890.seq
478205479 gbinv891.seq
459587666 gbinv892.seq
272670030 gbinv893.seq
227990903 gbinv894.seq
413244998 gbinv895.seq
498213748 gbinv896.seq
449979801 gbinv897.seq
461330907 gbinv898.seq
294874575 gbinv899.seq
485749846 gbinv9.seq
271721852 gbinv90.seq
405670616 gbinv900.seq
474471565 gbinv901.seq
439625427 gbinv902.seq
463229555 gbinv903.seq
464851338 gbinv904.seq
455511857 gbinv905.seq
439389009 gbinv906.seq
405283735 gbinv907.seq
419761690 gbinv908.seq
406996610 gbinv909.seq
473206806 gbinv91.seq
442305653 gbinv910.seq
479961209 gbinv911.seq
282852446 gbinv912.seq
494971745 gbinv913.seq
459071349 gbinv914.seq
457510304 gbinv915.seq
482562593 gbinv916.seq
413357535 gbinv917.seq
381806397 gbinv918.seq
357962786 gbinv919.seq
476783192 gbinv92.seq
482830686 gbinv920.seq
494826362 gbinv921.seq
370208813 gbinv922.seq
428586963 gbinv923.seq
123105615 gbinv924.seq
423910707 gbinv925.seq
460666534 gbinv926.seq
432539703 gbinv927.seq
384196500 gbinv928.seq
348330627 gbinv929.seq
479030351 gbinv93.seq
449196792 gbinv930.seq
388541575 gbinv931.seq
386427271 gbinv932.seq
495791066 gbinv933.seq
479478002 gbinv934.seq
80923082 gbinv935.seq
468644389 gbinv936.seq
487921921 gbinv937.seq
470328373 gbinv938.seq
468642645 gbinv939.seq
309386799 gbinv94.seq
411136544 gbinv940.seq
462696619 gbinv941.seq
493415138 gbinv942.seq
499955696 gbinv943.seq
484026075 gbinv944.seq
483632078 gbinv945.seq
496808153 gbinv946.seq
162547431 gbinv947.seq
455355382 gbinv948.seq
452744560 gbinv949.seq
477840597 gbinv95.seq
457356752 gbinv950.seq
492140801 gbinv951.seq
477236440 gbinv952.seq
440746130 gbinv953.seq
201920044 gbinv954.seq
351798642 gbinv955.seq
407318285 gbinv956.seq
497577312 gbinv957.seq
297816794 gbinv958.seq
465053752 gbinv959.seq
487392428 gbinv96.seq
477543055 gbinv960.seq
488522642 gbinv961.seq
485383082 gbinv962.seq
494197670 gbinv963.seq
492976606 gbinv964.seq
491252062 gbinv965.seq
485879488 gbinv966.seq
184862936 gbinv967.seq
490499065 gbinv968.seq
473434617 gbinv969.seq
489703622 gbinv97.seq
491357576 gbinv970.seq
482466282 gbinv971.seq
488062265 gbinv972.seq
207127102 gbinv973.seq
483701457 gbinv974.seq
474847426 gbinv975.seq
392959411 gbinv976.seq
283167653 gbinv977.seq
394326806 gbinv978.seq
386741280 gbinv979.seq
276099327 gbinv98.seq
148537239 gbinv980.seq
412230439 gbinv981.seq
434620162 gbinv982.seq
494101468 gbinv983.seq
494548234 gbinv984.seq
436233527 gbinv985.seq
493245062 gbinv986.seq
474858921 gbinv987.seq
85346444 gbinv988.seq
449524998 gbinv989.seq
494542524 gbinv99.seq
387985633 gbinv990.seq
480105396 gbinv991.seq
468490343 gbinv992.seq
33888816 gbinv993.seq
316525209 gbinv994.seq
491028997 gbinv995.seq
492549691 gbinv996.seq
490858334 gbinv997.seq
480371330 gbinv998.seq
485115876 gbinv999.seq
499998697 gbmam1.seq
82829445 gbmam10.seq
456214450 gbmam100.seq
486132453 gbmam101.seq
483844712 gbmam102.seq
437064425 gbmam103.seq
223540742 gbmam104.seq
451994163 gbmam105.seq
449442494 gbmam106.seq
428332658 gbmam107.seq
499999502 gbmam108.seq
499980805 gbmam109.seq
71289242 gbmam11.seq
304593851 gbmam110.seq
227944315 gbmam111.seq
348089742 gbmam112.seq
373183698 gbmam113.seq
467160879 gbmam114.seq
457054238 gbmam115.seq
483676806 gbmam116.seq
409916232 gbmam117.seq
398303012 gbmam118.seq
346344510 gbmam119.seq
22560541 gbmam12.seq
274828989 gbmam120.seq
266926791 gbmam121.seq
442156622 gbmam122.seq
394957817 gbmam123.seq
359859430 gbmam124.seq
441833973 gbmam125.seq
467878018 gbmam126.seq
460914273 gbmam127.seq
77886542 gbmam128.seq
384335011 gbmam129.seq
1268288 gbmam13.seq
490312196 gbmam130.seq
385325611 gbmam131.seq
473911567 gbmam132.seq
413152711 gbmam133.seq
479361008 gbmam134.seq
435411678 gbmam135.seq
197832427 gbmam136.seq
374823133 gbmam137.seq
463547765 gbmam138.seq
439985383 gbmam139.seq
378312043 gbmam14.seq
408172038 gbmam140.seq
432812311 gbmam141.seq
459597410 gbmam142.seq
495156885 gbmam143.seq
327564081 gbmam144.seq
422791489 gbmam145.seq
491401632 gbmam146.seq
449317136 gbmam147.seq
287465618 gbmam148.seq
394362643 gbmam149.seq
338653928 gbmam15.seq
439407312 gbmam150.seq
453590059 gbmam151.seq
469351291 gbmam152.seq
67527610 gbmam153.seq
483520870 gbmam154.seq
480679033 gbmam155.seq
410124870 gbmam156.seq
460089444 gbmam157.seq
273447476 gbmam158.seq
472899893 gbmam159.seq
477859984 gbmam16.seq
469419756 gbmam160.seq
290267902 gbmam161.seq
453331085 gbmam162.seq
187958881 gbmam163.seq
352138940 gbmam164.seq
440262201 gbmam165.seq
401683994 gbmam166.seq
455777749 gbmam167.seq
465167960 gbmam168.seq
44571261 gbmam169.seq
445458565 gbmam17.seq
449685039 gbmam170.seq
404827665 gbmam171.seq
447228326 gbmam172.seq
494282867 gbmam173.seq
425898549 gbmam174.seq
165392109 gbmam175.seq
457263770 gbmam176.seq
324046918 gbmam177.seq
339102216 gbmam178.seq
323096334 gbmam179.seq
122412952 gbmam18.seq
358506878 gbmam180.seq
422099488 gbmam181.seq
440058971 gbmam182.seq
394948573 gbmam183.seq
469038481 gbmam184.seq
465364880 gbmam185.seq
477461411 gbmam186.seq
236798673 gbmam187.seq
269398733 gbmam188.seq
253603154 gbmam189.seq
451114191 gbmam19.seq
381680709 gbmam190.seq
259094846 gbmam191.seq
433914327 gbmam192.seq
473689213 gbmam193.seq
499762686 gbmam194.seq
225944987 gbmam195.seq
402292620 gbmam196.seq
484267156 gbmam197.seq
422021843 gbmam198.seq
490305734 gbmam199.seq
399299008 gbmam2.seq
418062936 gbmam20.seq
112546871 gbmam200.seq
497927921 gbmam201.seq
377275105 gbmam202.seq
468953574 gbmam203.seq
375382417 gbmam204.seq
479246766 gbmam205.seq
432957019 gbmam206.seq
493590582 gbmam207.seq
329856862 gbmam208.seq
320418665 gbmam209.seq
499818179 gbmam21.seq
267180870 gbmam210.seq
494229345 gbmam211.seq
467852307 gbmam212.seq
169801131 gbmam213.seq
484790256 gbmam214.seq
441563731 gbmam215.seq
488307435 gbmam216.seq
465828461 gbmam217.seq
440072400 gbmam218.seq
498165380 gbmam219.seq
462376348 gbmam22.seq
417880520 gbmam220.seq
476061385 gbmam221.seq
168979186 gbmam222.seq
481542732 gbmam223.seq
477958396 gbmam224.seq
356503297 gbmam225.seq
452219504 gbmam226.seq
373237938 gbmam227.seq
474361951 gbmam228.seq
407382471 gbmam229.seq
370510647 gbmam23.seq
471880001 gbmam230.seq
499955615 gbmam231.seq
446124674 gbmam232.seq
428305446 gbmam233.seq
406513882 gbmam234.seq
496219854 gbmam235.seq
493963774 gbmam236.seq
438934094 gbmam237.seq
296563085 gbmam238.seq
281941182 gbmam239.seq
446296416 gbmam24.seq
456589692 gbmam240.seq
418783593 gbmam241.seq
463645501 gbmam242.seq
439299057 gbmam243.seq
305561734 gbmam244.seq
315163717 gbmam245.seq
291683593 gbmam246.seq
288961940 gbmam247.seq
480494424 gbmam248.seq
453137211 gbmam249.seq
431104435 gbmam25.seq
421005676 gbmam250.seq
485358028 gbmam251.seq
238286100 gbmam252.seq
443551588 gbmam253.seq
363178461 gbmam254.seq
451506905 gbmam255.seq
400618499 gbmam256.seq
471189051 gbmam257.seq
498164186 gbmam258.seq
127842067 gbmam259.seq
480602942 gbmam26.seq
275430940 gbmam260.seq
261153012 gbmam261.seq
490824593 gbmam262.seq
398633269 gbmam263.seq
365676919 gbmam264.seq
478729236 gbmam265.seq
136938945 gbmam266.seq
442775382 gbmam267.seq
235769955 gbmam268.seq
271434665 gbmam269.seq
479109855 gbmam27.seq
255381351 gbmam270.seq
380492415 gbmam271.seq
462311017 gbmam272.seq
435911029 gbmam273.seq
391212544 gbmam274.seq
408481718 gbmam275.seq
490517627 gbmam276.seq
474372493 gbmam277.seq
459939019 gbmam278.seq
375274643 gbmam279.seq
483903273 gbmam28.seq
433175275 gbmam280.seq
383169794 gbmam281.seq
310638549 gbmam282.seq
391024231 gbmam283.seq
360292288 gbmam284.seq
302202861 gbmam285.seq
493123811 gbmam286.seq
468440092 gbmam287.seq
420650184 gbmam288.seq
490687199 gbmam289.seq
483307002 gbmam29.seq
307564779 gbmam290.seq
426556076 gbmam291.seq
499921008 gbmam292.seq
427976025 gbmam293.seq
452148077 gbmam294.seq
470095868 gbmam295.seq
486475037 gbmam296.seq
256030582 gbmam297.seq
254978306 gbmam298.seq
485347432 gbmam299.seq
400559326 gbmam3.seq
48405032 gbmam30.seq
463299961 gbmam300.seq
456738587 gbmam301.seq
188477877 gbmam302.seq
462441807 gbmam303.seq
405696374 gbmam304.seq
488280354 gbmam305.seq
420230809 gbmam306.seq
493008404 gbmam307.seq
435046974 gbmam308.seq
300504156 gbmam309.seq
363174382 gbmam31.seq
362062984 gbmam310.seq
358513709 gbmam311.seq
344701574 gbmam312.seq
407360163 gbmam313.seq
429342664 gbmam314.seq
451585500 gbmam315.seq
444391476 gbmam316.seq
298415105 gbmam317.seq
363275258 gbmam318.seq
446597279 gbmam319.seq
437246747 gbmam32.seq
484756334 gbmam320.seq
398110276 gbmam321.seq
449893723 gbmam322.seq
473241966 gbmam323.seq
389817591 gbmam324.seq
161500863 gbmam325.seq
351809027 gbmam326.seq
349307503 gbmam327.seq
452057460 gbmam328.seq
414881705 gbmam329.seq
470828962 gbmam33.seq
474005078 gbmam330.seq
310825393 gbmam331.seq
431472150 gbmam332.seq
464576323 gbmam333.seq
459778718 gbmam334.seq
423061691 gbmam335.seq
480371902 gbmam336.seq
109233524 gbmam337.seq
438623950 gbmam338.seq
496035115 gbmam339.seq
402408906 gbmam34.seq
448221833 gbmam340.seq
347762434 gbmam341.seq
392469439 gbmam342.seq
296151020 gbmam343.seq
493933290 gbmam344.seq
406976198 gbmam345.seq
469463396 gbmam346.seq
479692863 gbmam347.seq
403970308 gbmam348.seq
199508745 gbmam349.seq
304109928 gbmam35.seq
452443739 gbmam36.seq
451303958 gbmam37.seq
495648598 gbmam38.seq
405636626 gbmam39.seq
477148353 gbmam4.seq
410457734 gbmam40.seq
441553748 gbmam41.seq
367146984 gbmam42.seq
478421809 gbmam43.seq
316388332 gbmam44.seq
352226884 gbmam45.seq
195247700 gbmam46.seq
474022452 gbmam47.seq
378020853 gbmam48.seq
450136561 gbmam49.seq
374653134 gbmam5.seq
450750944 gbmam50.seq
468132660 gbmam51.seq
492835688 gbmam52.seq
75338832 gbmam53.seq
33997165 gbmam54.seq
9943400 gbmam55.seq
43988539 gbmam56.seq
91321391 gbmam57.seq
88809559 gbmam58.seq
6366431 gbmam59.seq
487713568 gbmam6.seq
21008026 gbmam60.seq
449562085 gbmam61.seq
423620797 gbmam62.seq
453840584 gbmam63.seq
491149506 gbmam64.seq
425479852 gbmam65.seq
461110029 gbmam66.seq
385606603 gbmam67.seq
489901313 gbmam68.seq
499997715 gbmam69.seq
401181424 gbmam7.seq
499995027 gbmam70.seq
27620586 gbmam71.seq
907465328 gbmam72.seq
839494897 gbmam73.seq
774395849 gbmam74.seq
588873740 gbmam75.seq
364960392 gbmam76.seq
428298067 gbmam77.seq
283039909 gbmam78.seq
266822134 gbmam79.seq
435129139 gbmam8.seq
255007062 gbmam80.seq
250435267 gbmam81.seq
405637168 gbmam82.seq
372091530 gbmam83.seq
465555642 gbmam84.seq
444923834 gbmam85.seq
341582221 gbmam86.seq
257946240 gbmam87.seq
485829704 gbmam88.seq
486026993 gbmam89.seq
275779576 gbmam9.seq
483298905 gbmam90.seq
494677523 gbmam91.seq
335874920 gbmam92.seq
464872853 gbmam93.seq
468294587 gbmam94.seq
497569809 gbmam95.seq
377746247 gbmam96.seq
460747191 gbmam97.seq
150130543 gbmam98.seq
416665240 gbmam99.seq
30023287 gbnew.txt
499999427 gbpat1.seq
499999978 gbpat10.seq
499999036 gbpat100.seq
499999497 gbpat101.seq
499997525 gbpat102.seq
228719622 gbpat103.seq
500000251 gbpat104.seq
500000174 gbpat105.seq
499999692 gbpat106.seq
335512855 gbpat107.seq
499999284 gbpat108.seq
500000022 gbpat109.seq
499998031 gbpat11.seq
210521873 gbpat110.seq
499927571 gbpat111.seq
499996795 gbpat112.seq
174127807 gbpat113.seq
499999957 gbpat114.seq
499998505 gbpat115.seq
499996232 gbpat116.seq
8746372 gbpat117.seq
499743640 gbpat118.seq
382829482 gbpat119.seq
179029144 gbpat12.seq
499998955 gbpat120.seq
499998461 gbpat121.seq
499992686 gbpat122.seq
499998883 gbpat123.seq
56645800 gbpat124.seq
499990147 gbpat125.seq
499999398 gbpat126.seq
208443590 gbpat127.seq
500000173 gbpat128.seq
499999406 gbpat129.seq
499957808 gbpat13.seq
59355952 gbpat130.seq
499999983 gbpat131.seq
499998258 gbpat132.seq
488850944 gbpat133.seq
499999917 gbpat134.seq
499998978 gbpat135.seq
28285714 gbpat136.seq
499997835 gbpat137.seq
385160778 gbpat138.seq
499999463 gbpat139.seq
499999358 gbpat14.seq
500000185 gbpat140.seq
148512991 gbpat141.seq
499996284 gbpat142.seq
314551576 gbpat143.seq
499988381 gbpat144.seq
499980283 gbpat145.seq
409538104 gbpat146.seq
500000154 gbpat147.seq
499979680 gbpat148.seq
125987771 gbpat149.seq
62760587 gbpat15.seq
499989559 gbpat150.seq
499995316 gbpat151.seq
499998971 gbpat152.seq
499997529 gbpat153.seq
169880503 gbpat154.seq
499999008 gbpat155.seq
426352200 gbpat156.seq
499998947 gbpat157.seq
500000265 gbpat158.seq
499929307 gbpat159.seq
499998252 gbpat16.seq
353565130 gbpat160.seq
499999580 gbpat161.seq
499999590 gbpat162.seq
291237409 gbpat163.seq
499999083 gbpat164.seq
499999384 gbpat165.seq
499999241 gbpat166.seq
102920253 gbpat167.seq
499989522 gbpat168.seq
499993882 gbpat169.seq
499998663 gbpat17.seq
499993951 gbpat170.seq
499999217 gbpat171.seq
301725661 gbpat172.seq
499999491 gbpat173.seq
500000144 gbpat174.seq
499998806 gbpat175.seq
319783012 gbpat176.seq
499603284 gbpat177.seq
499999184 gbpat178.seq
499999721 gbpat179.seq
422099042 gbpat18.seq
13395273 gbpat180.seq
497266519 gbpat181.seq
499999234 gbpat182.seq
499998806 gbpat183.seq
86838131 gbpat184.seq
499934148 gbpat185.seq
499999973 gbpat186.seq
499998197 gbpat187.seq
39745949 gbpat188.seq
499283147 gbpat189.seq
499904776 gbpat19.seq
499998170 gbpat190.seq
499999623 gbpat191.seq
499999456 gbpat192.seq
96585560 gbpat193.seq
499884333 gbpat194.seq
499997561 gbpat195.seq
499999338 gbpat196.seq
499999860 gbpat197.seq
90169392 gbpat198.seq
499993286 gbpat199.seq
499999607 gbpat2.seq
499998676 gbpat20.seq
499994277 gbpat200.seq
499998512 gbpat201.seq
499999301 gbpat202.seq
4092526 gbpat203.seq
499999756 gbpat204.seq
499999459 gbpat205.seq
500000244 gbpat206.seq
478202129 gbpat207.seq
500000054 gbpat208.seq
499999577 gbpat209.seq
499996070 gbpat21.seq
321705067 gbpat210.seq
499991396 gbpat211.seq
499963719 gbpat212.seq
350635988 gbpat213.seq
497506292 gbpat214.seq
499869540 gbpat215.seq
421452571 gbpat216.seq
499425936 gbpat217.seq
499999361 gbpat218.seq
336263474 gbpat219.seq
347874599 gbpat22.seq
499998549 gbpat220.seq
499999453 gbpat221.seq
499999941 gbpat222.seq
361443812 gbpat223.seq
499999662 gbpat224.seq
494515367 gbpat225.seq
341868206 gbpat226.seq
499999744 gbpat227.seq
500000159 gbpat228.seq
366896749 gbpat229.seq
499884764 gbpat23.seq
499999946 gbpat230.seq
499335751 gbpat231.seq
389256092 gbpat232.seq
499996721 gbpat233.seq
500000056 gbpat234.seq
498671374 gbpat235.seq
499998420 gbpat236.seq
499998793 gbpat237.seq
21956630 gbpat238.seq
499999486 gbpat239.seq
499998615 gbpat24.seq
499999238 gbpat240.seq
499998695 gbpat241.seq
499999401 gbpat242.seq
488127386 gbpat243.seq
499999639 gbpat244.seq
499995447 gbpat245.seq
499999277 gbpat246.seq
187738330 gbpat247.seq
500000259 gbpat248.seq
499999191 gbpat249.seq
499663440 gbpat25.seq
481547581 gbpat250.seq
495284053 gbpat251.seq
500000161 gbpat252.seq
389872169 gbpat253.seq
499735576 gbpat254.seq
499999196 gbpat255.seq
435395590 gbpat256.seq
499999403 gbpat257.seq
499998922 gbpat258.seq
107872018 gbpat259.seq
499999702 gbpat26.seq
500000076 gbpat260.seq
500000151 gbpat261.seq
163545570 gbpat262.seq
500000110 gbpat263.seq
498100835 gbpat264.seq
415803653 gbpat265.seq
499996941 gbpat266.seq
499967401 gbpat267.seq
499989737 gbpat268.seq
256724619 gbpat269.seq
166815595 gbpat27.seq
499998387 gbpat28.seq
500000116 gbpat29.seq
61247109 gbpat3.seq
213213665 gbpat30.seq
499999775 gbpat31.seq
406040813 gbpat32.seq
499995159 gbpat33.seq
499999040 gbpat34.seq
126631564 gbpat35.seq
499998921 gbpat36.seq
499998229 gbpat37.seq
499999652 gbpat38.seq
140161176 gbpat39.seq
499999549 gbpat4.seq
499998950 gbpat40.seq
493992256 gbpat41.seq
494767610 gbpat42.seq
500000227 gbpat43.seq
149227782 gbpat44.seq
499999126 gbpat45.seq
499999712 gbpat46.seq
499998576 gbpat47.seq
87882658 gbpat48.seq
499999340 gbpat49.seq
499999606 gbpat5.seq
500000057 gbpat50.seq
499998939 gbpat51.seq
130970228 gbpat52.seq
499999975 gbpat53.seq
499999084 gbpat54.seq
185010162 gbpat55.seq
499999726 gbpat56.seq
499999154 gbpat57.seq
137265710 gbpat58.seq
499998902 gbpat59.seq
419098828 gbpat6.seq
499638184 gbpat60.seq
429858746 gbpat61.seq
499999385 gbpat62.seq
321466580 gbpat63.seq
499999289 gbpat64.seq
500000065 gbpat65.seq
306477406 gbpat66.seq
499999595 gbpat67.seq
499997159 gbpat68.seq
144919043 gbpat69.seq
499999566 gbpat7.seq
499999495 gbpat70.seq
226235202 gbpat71.seq
499942763 gbpat72.seq
500000257 gbpat73.seq
309555677 gbpat74.seq
499990988 gbpat75.seq
499996904 gbpat76.seq
259606120 gbpat77.seq
499998418 gbpat78.seq
499997914 gbpat79.seq
499996100 gbpat8.seq
36785301 gbpat80.seq
500000256 gbpat81.seq
474766116 gbpat82.seq
500000048 gbpat83.seq
331725818 gbpat84.seq
499994985 gbpat85.seq
312350353 gbpat86.seq
499996281 gbpat87.seq
499999395 gbpat88.seq
499999645 gbpat89.seq
317330927 gbpat9.seq
205655503 gbpat90.seq
499999444 gbpat91.seq
455869832 gbpat92.seq
499984753 gbpat93.seq
252316670 gbpat94.seq
499999166 gbpat95.seq
499997646 gbpat96.seq
83005136 gbpat97.seq
499999689 gbpat98.seq
498236426 gbpat99.seq
499917334 gbphg1.seq
499956644 gbphg2.seq
499674268 gbphg3.seq
499992976 gbphg4.seq
499963739 gbphg5.seq
499711831 gbphg6.seq
318551835 gbphg7.seq
499999377 gbpln1.seq
269118160 gbpln10.seq
457901321 gbpln100.seq
961290953 gbpln1000.se
1090804563 gbpln1001.se
813694519 gbpln1002.se
962545329 gbpln1003.se
873725320 gbpln1004.se
673190933 gbpln1005.se
905064827 gbpln1006.se
908590683 gbpln1007.se
742712721 gbpln1008.se
793279947 gbpln1009.se
433637011 gbpln101.seq
934932910 gbpln1010.se
640700841 gbpln1011.se
961568347 gbpln1012.se
952066710 gbpln1013.se
827214106 gbpln1014.se
455119463 gbpln1015.se
225763300 gbpln1016.se
606043563 gbpln1017.se
672463180 gbpln1018.se
670817640 gbpln1019.se
498225039 gbpln102.seq
780744113 gbpln1020.se
709786567 gbpln1021.se
699981617 gbpln1022.se
605149310 gbpln1023.se
587850602 gbpln1024.se
521338175 gbpln1025.se
584041492 gbpln1026.se
586940643 gbpln1027.se
609718060 gbpln1028.se
520752755 gbpln1029.se
107502929 gbpln103.seq
615367060 gbpln1030.se
678802711 gbpln1031.se
605705355 gbpln1032.se
527901084 gbpln1033.se
594666479 gbpln1034.se
615720931 gbpln1035.se
576353842 gbpln1036.se
633125968 gbpln1037.se
548771039 gbpln1038.se
692441981 gbpln1039.se
449964743 gbpln104.seq
738372778 gbpln1040.se
858786664 gbpln1041.se
737516180 gbpln1042.se
745059845 gbpln1043.se
651602931 gbpln1044.se
604402507 gbpln1045.se
664905907 gbpln1046.se
584308834 gbpln1047.se
534160882 gbpln1048.se
630362066 gbpln1049.se
422837726 gbpln105.seq
371796209 gbpln1050.se
630301724 gbpln1051.se
687847933 gbpln1052.se
613107926 gbpln1053.se
667786023 gbpln1054.se
650171878 gbpln1055.se
580307353 gbpln1056.se
567733853 gbpln1057.se
731990321 gbpln1058.se
671427711 gbpln1059.se
383453844 gbpln106.seq
677581066 gbpln1060.se
698173276 gbpln1061.se
745221979 gbpln1062.se
582651725 gbpln1063.se
703621805 gbpln1064.se
577456794 gbpln1065.se
645348756 gbpln1066.se
738102835 gbpln1067.se
718402115 gbpln1068.se
581705856 gbpln1069.se
376172116 gbpln107.seq
731196779 gbpln1070.se
559541978 gbpln1071.se
676833494 gbpln1072.se
5774757 gbpln1073.se
777312365 gbpln1074.se
1006352200 gbpln1075.se
962815280 gbpln1076.se
975138625 gbpln1077.se
906550424 gbpln1078.se
790269620 gbpln1079.se
326317073 gbpln108.seq
956926035 gbpln1080.se
908369815 gbpln1081.se
1035806384 gbpln1082.se
1095241385 gbpln1083.se
889046376 gbpln1084.se
920177987 gbpln1085.se
934896188 gbpln1086.se
972756495 gbpln1087.se
639243889 gbpln1088.se
839211115 gbpln1089.se
320571253 gbpln109.seq
802168718 gbpln1090.se
677231764 gbpln1091.se
740101370 gbpln1092.se
642539819 gbpln1093.se
835613564 gbpln1094.se
284703680 gbpln1095.se
252385106 gbpln1096.se
408962040 gbpln1097.se
329779394 gbpln1098.se
332794405 gbpln1099.se
499923203 gbpln11.seq
286199717 gbpln110.seq
418495190 gbpln1100.se
443558620 gbpln1101.se
449429604 gbpln1102.se
403262217 gbpln1103.se
477398794 gbpln1104.se
434382533 gbpln1105.se
443534394 gbpln1106.se
444327808 gbpln1107.se
486802330 gbpln1108.se
482267024 gbpln1109.se
277716232 gbpln111.seq
434636456 gbpln1110.se
412605138 gbpln1111.se
487251125 gbpln1112.se
475655684 gbpln1113.se
480193091 gbpln1114.se
445118181 gbpln1115.se
94040672 gbpln1116.se
598056432 gbpln1117.se
774899231 gbpln1118.se
723495077 gbpln1119.se
499733064 gbpln112.seq
714415063 gbpln1120.se
677999218 gbpln1121.se
629027474 gbpln1122.se
732833309 gbpln1123.se
468675756 gbpln1124.se
493398868 gbpln1125.se
474782479 gbpln1126.se
380660146 gbpln1127.se
467902933 gbpln1128.se
216458899 gbpln1129.se
79413547 gbpln113.seq
767568441 gbpln1130.se
890586336 gbpln1131.se
628166166 gbpln1132.se
1008494770 gbpln1133.se
987228440 gbpln1134.se
843057146 gbpln1135.se
959088227 gbpln1136.se
1080118900 gbpln1137.se
790032689 gbpln1138.se
943744808 gbpln1139.se
391026516 gbpln114.seq
858758923 gbpln1140.se
664109824 gbpln1141.se
920678548 gbpln1142.se
888501597 gbpln1143.se
739915904 gbpln1144.se
788736236 gbpln1145.se
944601115 gbpln1146.se
621465899 gbpln1147.se
948555731 gbpln1148.se
954911743 gbpln1149.se
362500947 gbpln115.seq
815610131 gbpln1150.se
39280886 gbpln1151.se
752395252 gbpln1152.se
890282442 gbpln1153.se
626588938 gbpln1154.se
1004358314 gbpln1155.se
1028945403 gbpln1156.se
838465031 gbpln1157.se
950517848 gbpln1158.se
1082441571 gbpln1159.se
390024685 gbpln116.seq
789583362 gbpln1160.se
950035126 gbpln1161.se
853507174 gbpln1162.se
659807143 gbpln1163.se
902654822 gbpln1164.se
890952840 gbpln1165.se
721824595 gbpln1166.se
785634143 gbpln1167.se
909002041 gbpln1168.se
625532226 gbpln1169.se
341773035 gbpln117.seq
945667285 gbpln1170.se
953425673 gbpln1171.se
821771932 gbpln1172.se
49706327 gbpln1173.se
685151081 gbpln1174.se
568933209 gbpln1175.se
539200808 gbpln1176.se
586715519 gbpln1177.se
614750081 gbpln1178.se
568071416 gbpln1179.se
199854531 gbpln118.seq
625152560 gbpln1180.se
586214274 gbpln1181.se
746226478 gbpln1182.se
808684470 gbpln1183.se
907082919 gbpln1184.se
776688265 gbpln1185.se
793241327 gbpln1186.se
698857036 gbpln1187.se
613368022 gbpln1188.se
674019106 gbpln1189.se
483137958 gbpln119.seq
609236735 gbpln1190.se
576791005 gbpln1191.se
632369216 gbpln1192.se
377507569 gbpln1193.se
669127828 gbpln1194.se
480140219 gbpln1195.se
475319448 gbpln1196.se
488174600 gbpln1197.se
318504222 gbpln1198.se
198085068 gbpln1199.se
498720815 gbpln12.seq
493810296 gbpln120.seq
752395252 gbpln1200.se
890282442 gbpln1201.se
626588938 gbpln1202.se
1004358314 gbpln1203.se
1028945403 gbpln1204.se
838465031 gbpln1205.se
950517848 gbpln1206.se
1082441571 gbpln1207.se
789583362 gbpln1208.se
950035126 gbpln1209.se
497201313 gbpln121.seq
853507174 gbpln1210.se
659807143 gbpln1211.se
902654822 gbpln1212.se
890952840 gbpln1213.se
721824595 gbpln1214.se
785634143 gbpln1215.se
909002041 gbpln1216.se
625532226 gbpln1217.se
945667285 gbpln1218.se
953425673 gbpln1219.se
262329677 gbpln122.seq
821771932 gbpln1220.se
459041667 gbpln1221.se
304578983 gbpln1222.se
571276484 gbpln1223.se
841140963 gbpln1224.se
813242081 gbpln1225.se
666749684 gbpln1226.se
786164670 gbpln1227.se
685610369 gbpln1228.se
780661607 gbpln1229.se
410692589 gbpln123.seq
20764769 gbpln1230.se
494104735 gbpln1231.se
487719162 gbpln1232.se
475203143 gbpln1233.se
481053138 gbpln1234.se
491971790 gbpln1235.se
174964113 gbpln1236.se
489989534 gbpln1237.se
498671512 gbpln1238.se
498654651 gbpln1239.se
485439355 gbpln124.seq
472130628 gbpln1240.se
484783481 gbpln1241.se
174534000 gbpln1242.se
458581762 gbpln1243.se
487249767 gbpln1244.se
488104602 gbpln1245.se
490993470 gbpln1246.se
458758162 gbpln1247.se
243752045 gbpln1248.se
496284751 gbpln1249.se
339967820 gbpln125.seq
470894249 gbpln1250.se
456702113 gbpln1251.se
468851576 gbpln1252.se
498668450 gbpln1253.se
246543998 gbpln1254.se
403648092 gbpln1255.se
420333785 gbpln1256.se
486138903 gbpln1257.se
461617634 gbpln1258.se
214014145 gbpln1259.se
410604091 gbpln126.seq
461722879 gbpln1260.se
470401116 gbpln1261.se
494676807 gbpln1262.se
492353397 gbpln1263.se
492252570 gbpln1264.se
345527633 gbpln1265.se
463862211 gbpln1266.se
494081914 gbpln1267.se
482259033 gbpln1268.se
440622839 gbpln1269.se
459875355 gbpln127.seq
491838433 gbpln1270.se
412558016 gbpln1271.se
201913689 gbpln1272.se
437115790 gbpln1273.se
441097064 gbpln1274.se
442410423 gbpln1275.se
451274488 gbpln1276.se
251536188 gbpln1277.se
422420084 gbpln1278.se
498624032 gbpln1279.se
499126764 gbpln128.seq
493876654 gbpln1280.se
461367203 gbpln1281.se
368984003 gbpln1282.se
327296104 gbpln1283.se
393553638 gbpln1284.se
494499660 gbpln1285.se
339690898 gbpln1286.se
442962794 gbpln1287.se
443202510 gbpln1288.se
473793657 gbpln1289.se
182005254 gbpln129.seq
487062259 gbpln1290.se
402248903 gbpln1291.se
441515110 gbpln1292.se
497650728 gbpln1293.se
425883871 gbpln1294.se
363732401 gbpln1295.se
454836169 gbpln1296.se
473634452 gbpln1297.se
202150508 gbpln1298.se
470919442 gbpln1299.se
470019057 gbpln13.seq
498973295 gbpln130.seq
485212352 gbpln1300.se
473559497 gbpln1301.se
436659501 gbpln1302.se
334662259 gbpln1303.se
1096228946 gbpln1304.se
1065747702 gbpln1305.se
978382754 gbpln1306.se
970377846 gbpln1307.se
932157798 gbpln1308.se
878151181 gbpln1309.se
472540038 gbpln131.seq
874085482 gbpln1310.se
829265283 gbpln1311.se
863296713 gbpln1312.se
823515697 gbpln1313.se
815413879 gbpln1314.se
693494316 gbpln1315.se
690790562 gbpln1316.se
669344399 gbpln1317.se
682118426 gbpln1318.se
617460029 gbpln1319.se
453105795 gbpln132.seq
613278884 gbpln1320.se
540591172 gbpln1321.se
1142716 gbpln1322.se
2012725365 gbpln1323.se
2313576157 gbpln1324.se
2199353951 gbpln1325.se
2096617949 gbpln1326.se
2106642321 gbpln1327.se
1745413840 gbpln1328.se
1943630374 gbpln1329.se
445429529 gbpln133.seq
43805282 gbpln1330.se
396348078 gbpln1331.se
656016969 gbpln1332.se
836152674 gbpln1333.se
790234195 gbpln1334.se
768134127 gbpln1335.se
758776841 gbpln1336.se
705400447 gbpln1337.se
794343595 gbpln1338.se
660040390 gbpln1339.se
387853287 gbpln134.seq
839765735 gbpln1340.se
794136796 gbpln1341.se
777214952 gbpln1342.se
750731321 gbpln1343.se
709232633 gbpln1344.se
800824124 gbpln1345.se
653086622 gbpln1346.se
831555005 gbpln1347.se
787385082 gbpln1348.se
774061569 gbpln1349.se
496158204 gbpln135.seq
746196125 gbpln1350.se
697845631 gbpln1351.se
802432660 gbpln1352.se
659592617 gbpln1353.se
837904863 gbpln1354.se
793009109 gbpln1355.se
770582516 gbpln1356.se
754317819 gbpln1357.se
704675048 gbpln1358.se
809917663 gbpln1359.se
498225578 gbpln136.seq
662753085 gbpln1360.se
837974599 gbpln1361.se
802983166 gbpln1362.se
776399715 gbpln1363.se
749269998 gbpln1364.se
702806422 gbpln1365.se
795297690 gbpln1366.se
672385035 gbpln1367.se
841987687 gbpln1368.se
800255274 gbpln1369.se
499068542 gbpln137.seq
776782163 gbpln1370.se
765490378 gbpln1371.se
737409431 gbpln1372.se
809700114 gbpln1373.se
657854557 gbpln1374.se
838067529 gbpln1375.se
794050155 gbpln1376.se
769006557 gbpln1377.se
754403386 gbpln1378.se
702133895 gbpln1379.se
322836027 gbpln138.seq
796622308 gbpln1380.se
659801577 gbpln1381.se
831709070 gbpln1382.se
788018842 gbpln1383.se
776335169 gbpln1384.se
746238486 gbpln1385.se
700989570 gbpln1386.se
807667792 gbpln1387.se
654391424 gbpln1388.se
831948388 gbpln1389.se
489314553 gbpln139.seq
792155198 gbpln1390.se
764395262 gbpln1391.se
746678920 gbpln1392.se
722347699 gbpln1393.se
803791473 gbpln1394.se
653243978 gbpln1395.se
832913531 gbpln1396.se
783381753 gbpln1397.se
777226068 gbpln1398.se
745655004 gbpln1399.se
170607032 gbpln14.seq
486163971 gbpln140.seq
703355435 gbpln1400.se
800066153 gbpln1401.se
659967910 gbpln1402.se
856583956 gbpln1403.se
800941652 gbpln1404.se
764839742 gbpln1405.se
750893358 gbpln1406.se
712544595 gbpln1407.se
794775316 gbpln1408.se
662436378 gbpln1409.se
495247758 gbpln141.seq
838548263 gbpln1410.se
802434969 gbpln1411.se
775426580 gbpln1412.se
752476251 gbpln1413.se
715776003 gbpln1414.se
800430027 gbpln1415.se
656566519 gbpln1416.se
836584181 gbpln1417.se
794556424 gbpln1418.se
763379903 gbpln1419.se
466229178 gbpln142.seq
746277662 gbpln1420.se
726262980 gbpln1421.se
792340702 gbpln1422.se
675115613 gbpln1423.se
841588738 gbpln1424.se
793586134 gbpln1425.se
774193867 gbpln1426.se
770687431 gbpln1427.se
712905176 gbpln1428.se
810458180 gbpln1429.se
493826666 gbpln143.seq
654272797 gbpln1430.se
832767208 gbpln1431.se
787519848 gbpln1432.se
773580779 gbpln1433.se
746701676 gbpln1434.se
707267128 gbpln1435.se
798980729 gbpln1436.se
659896519 gbpln1437.se
836647346 gbpln1438.se
804025439 gbpln1439.se
495604408 gbpln144.seq
780287538 gbpln1440.se
743595303 gbpln1441.se
713315315 gbpln1442.se
803845677 gbpln1443.se
657271061 gbpln1444.se
847868246 gbpln1445.se
799503372 gbpln1446.se
769858206 gbpln1447.se
741623589 gbpln1448.se
709760988 gbpln1449.se
494888145 gbpln145.seq
792929198 gbpln1450.se
655249257 gbpln1451.se
841182041 gbpln1452.se
790643458 gbpln1453.se
771991396 gbpln1454.se
747914331 gbpln1455.se
701991886 gbpln1456.se
799948094 gbpln1457.se
836052023 gbpln1458.se
791807903 gbpln1459.se
496855421 gbpln146.seq
771195581 gbpln1460.se
751946992 gbpln1461.se
700679711 gbpln1462.se
795423860 gbpln1463.se
657438591 gbpln1464.se
666670554 gbpln1465.se
841954477 gbpln1466.se
801058908 gbpln1467.se
777293273 gbpln1468.se
749498940 gbpln1469.se
498616424 gbpln147.seq
736280932 gbpln1470.se
793092204 gbpln1471.se
659821185 gbpln1472.se
836617455 gbpln1473.se
790837080 gbpln1474.se
777459211 gbpln1475.se
747254822 gbpln1476.se
706272554 gbpln1477.se
799311150 gbpln1478.se
655470686 gbpln1479.se
91590399 gbpln148.seq
839842771 gbpln1480.se
793797446 gbpln1481.se
776363695 gbpln1482.se
740130332 gbpln1483.se
716642316 gbpln1484.se
788558880 gbpln1485.se
678011370 gbpln1486.se
845148876 gbpln1487.se
804833075 gbpln1488.se
778470840 gbpln1489.se
485225820 gbpln149.seq
756070229 gbpln1490.se
724936708 gbpln1491.se
811860442 gbpln1492.se
662208657 gbpln1493.se
794180240 gbpln1494.se
774312133 gbpln1495.se
754828857 gbpln1496.se
702475124 gbpln1497.se
835115958 gbpln1498.se
799156315 gbpln1499.se
496189944 gbpln15.seq
474996855 gbpln150.seq
658470916 gbpln1500.se
836718376 gbpln1501.se
801816184 gbpln1502.se
780710757 gbpln1503.se
754364739 gbpln1504.se
733491153 gbpln1505.se
805725430 gbpln1506.se
662648934 gbpln1507.se
835020955 gbpln1508.se
794498288 gbpln1509.se
477161896 gbpln151.seq
775035874 gbpln1510.se
744045587 gbpln1511.se
730876361 gbpln1512.se
803645921 gbpln1513.se
656056550 gbpln1514.se
836763144 gbpln1515.se
794319485 gbpln1516.se
771563218 gbpln1517.se
743186864 gbpln1518.se
699149444 gbpln1519.se
340348460 gbpln152.seq
796083444 gbpln1520.se
665841375 gbpln1521.se
835744193 gbpln1522.se
793808494 gbpln1523.se
775366859 gbpln1524.se
744449290 gbpln1525.se
708201546 gbpln1526.se
799207549 gbpln1527.se
662253837 gbpln1528.se
839340148 gbpln1529.se
484543870 gbpln153.seq
793588555 gbpln1530.se
778845059 gbpln1531.se
755025577 gbpln1532.se
716488813 gbpln1533.se
801939933 gbpln1534.se
658732786 gbpln1535.se
847689175 gbpln1536.se
797030463 gbpln1537.se
776617524 gbpln1538.se
745737830 gbpln1539.se
490914318 gbpln154.seq
704496294 gbpln1540.se
807597004 gbpln1541.se
662054725 gbpln1542.se
834034797 gbpln1543.se
795540701 gbpln1544.se
776376885 gbpln1545.se
750640507 gbpln1546.se
698264887 gbpln1547.se
797586817 gbpln1548.se
660069753 gbpln1549.se
481177815 gbpln155.seq
833009352 gbpln1550.se
797524540 gbpln1551.se
773297930 gbpln1552.se
748668787 gbpln1553.se
702576368 gbpln1554.se
798959670 gbpln1555.se
655233812 gbpln1556.se
830169429 gbpln1557.se
793310457 gbpln1558.se
773560290 gbpln1559.se
496102157 gbpln156.seq
748590167 gbpln1560.se
697641990 gbpln1561.se
792556201 gbpln1562.se
658381368 gbpln1563.se
835938341 gbpln1564.se
795056321 gbpln1565.se
770765157 gbpln1566.se
758436824 gbpln1567.se
717124966 gbpln1568.se
798421217 gbpln1569.se
423060186 gbpln157.seq
668158294 gbpln1570.se
829099164 gbpln1571.se
790989379 gbpln1572.se
773398673 gbpln1573.se
750444053 gbpln1574.se
711602485 gbpln1575.se
797006147 gbpln1576.se
652904161 gbpln1577.se
837413052 gbpln1578.se
790648527 gbpln1579.se
497478474 gbpln158.seq
772176401 gbpln1580.se
747834533 gbpln1581.se
712785774 gbpln1582.se
792713783 gbpln1583.se
663052369 gbpln1584.se
833059054 gbpln1585.se
794545184 gbpln1586.se
774083177 gbpln1587.se
746226026 gbpln1588.se
702720993 gbpln1589.se
435184009 gbpln159.seq
802877509 gbpln1590.se
655682341 gbpln1591.se
835451342 gbpln1592.se
794577233 gbpln1593.se
775251446 gbpln1594.se
745423892 gbpln1595.se
709108135 gbpln1596.se
801224896 gbpln1597.se
662394359 gbpln1598.se
836809812 gbpln1599.se
479250208 gbpln16.seq
460820205 gbpln160.seq
806584862 gbpln1600.se
776084155 gbpln1601.se
742536325 gbpln1602.se
742539602 gbpln1603.se
790043912 gbpln1604.se
658808619 gbpln1605.se
836125457 gbpln1606.se
794049612 gbpln1607.se
769729355 gbpln1608.se
742587081 gbpln1609.se
485737542 gbpln161.seq
727014800 gbpln1610.se
797674105 gbpln1611.se
660687462 gbpln1612.se
840008504 gbpln1613.se
794029694 gbpln1614.se
769623341 gbpln1615.se
748398121 gbpln1616.se
729084759 gbpln1617.se
800520588 gbpln1618.se
656029206 gbpln1619.se
498612562 gbpln162.seq
836931236 gbpln1620.se
792455888 gbpln1621.se
768695354 gbpln1622.se
749845408 gbpln1623.se
701064052 gbpln1624.se
795314881 gbpln1625.se
659612022 gbpln1626.se
835570197 gbpln1627.se
798619346 gbpln1628.se
776375847 gbpln1629.se
485304962 gbpln163.seq
751020200 gbpln1630.se
717192214 gbpln1631.se
803740372 gbpln1632.se
659779517 gbpln1633.se
832456199 gbpln1634.se
793920035 gbpln1635.se
773324985 gbpln1636.se
742351220 gbpln1637.se
701296730 gbpln1638.se
793436257 gbpln1639.se
499875093 gbpln164.seq
665530976 gbpln1640.se
834886228 gbpln1641.se
792465315 gbpln1642.se
766375549 gbpln1643.se
744587278 gbpln1644.se
704762183 gbpln1645.se
794348716 gbpln1646.se
663323329 gbpln1647.se
836173230 gbpln1648.se
792990723 gbpln1649.se
396643341 gbpln165.seq
774691916 gbpln1650.se
742761704 gbpln1651.se
709671068 gbpln1652.se
797342703 gbpln1653.se
711562738 gbpln1654.se
785075543 gbpln1655.se
804070482 gbpln1656.se
777569920 gbpln1657.se
748606451 gbpln1658.se
712552461 gbpln1659.se
174767189 gbpln166.seq
803554148 gbpln1660.se
663200246 gbpln1661.se
830451601 gbpln1662.se
798616435 gbpln1663.se
774880678 gbpln1664.se
741636674 gbpln1665.se
713582127 gbpln1666.se
802021531 gbpln1667.se
658502066 gbpln1668.se
837230145 gbpln1669.se
336937021 gbpln167.seq
796560308 gbpln1670.se
777015504 gbpln1671.se
751686997 gbpln1672.se
703906948 gbpln1673.se
801647364 gbpln1674.se
654064285 gbpln1675.se
838785071 gbpln1676.se
791233293 gbpln1677.se
770014685 gbpln1678.se
746107403 gbpln1679.se
481782456 gbpln168.seq
703906054 gbpln1680.se
795356170 gbpln1681.se
659953546 gbpln1682.se
835677720 gbpln1683.se
793372574 gbpln1684.se
769401747 gbpln1685.se
752854041 gbpln1686.se
703690888 gbpln1687.se
796975856 gbpln1688.se
668337863 gbpln1689.se
432553122 gbpln169.seq
839230685 gbpln1690.se
803963907 gbpln1691.se
778586682 gbpln1692.se
744232293 gbpln1693.se
718898368 gbpln1694.se
798701082 gbpln1695.se
659027881 gbpln1696.se
832496071 gbpln1697.se
797513192 gbpln1698.se
776551156 gbpln1699.se
335223965 gbpln17.seq
462278275 gbpln170.seq
746618245 gbpln1700.se
703227861 gbpln1701.se
798793860 gbpln1702.se
661700145 gbpln1703.se
839860091 gbpln1704.se
789840368 gbpln1705.se
776969912 gbpln1706.se
742781648 gbpln1707.se
707704955 gbpln1708.se
799711544 gbpln1709.se
338514050 gbpln171.seq
214717737 gbpln1710.se
477983665 gbpln1711.se
479133534 gbpln1712.se
489619458 gbpln1713.se
483060400 gbpln1714.se
446936322 gbpln1715.se
207970098 gbpln1716.se
460655312 gbpln1717.se
364708423 gbpln1718.se
339216276 gbpln1719.se
478622058 gbpln172.seq
386345512 gbpln1720.se
311846069 gbpln1721.se
213922978 gbpln1722.se
547084404 gbpln1723.se
299808 gbpln1724.se
575997766 gbpln1725.se
565057145 gbpln1726.se
546636235 gbpln1727.se
480735429 gbpln1728.se
428611956 gbpln1729.se
276524733 gbpln173.seq
399987344 gbpln1730.se
452012654 gbpln1731.se
407833644 gbpln1732.se
98616602 gbpln1733.se
487423636 gbpln1734.se
415841860 gbpln1735.se
659287868 gbpln1736.se
830295693 gbpln1737.se
794035728 gbpln1738.se
766241777 gbpln1739.se
445190576 gbpln174.seq
750933536 gbpln1740.se
701025885 gbpln1741.se
801757538 gbpln1742.se
658504885 gbpln1743.se
800420442 gbpln1744.se
807100878 gbpln1745.se
813165275 gbpln1746.se
763582995 gbpln1747.se
726276065 gbpln1748.se
802736565 gbpln1749.se
357274162 gbpln175.seq
660909128 gbpln1750.se
836403024 gbpln1751.se
797704105 gbpln1752.se
771673145 gbpln1753.se
763841398 gbpln1754.se
725232624 gbpln1755.se
803038467 gbpln1756.se
659962386 gbpln1757.se
835021143 gbpln1758.se
794511021 gbpln1759.se
375890576 gbpln176.seq
765022116 gbpln1760.se
746128141 gbpln1761.se
704302152 gbpln1762.se
788898001 gbpln1763.se
657496944 gbpln1764.se
837987830 gbpln1765.se
795104781 gbpln1766.se
772053911 gbpln1767.se
744822794 gbpln1768.se
709518859 gbpln1769.se
349832882 gbpln177.seq
798243211 gbpln1770.se
454828836 gbpln1771.se
378680463 gbpln1772.se
79782982 gbpln1773.se
610632167 gbpln1774.se
761027417 gbpln1775.se
474894144 gbpln1776.se
820639220 gbpln1777.se
834487583 gbpln1778.se
646503636 gbpln1779.se
336189913 gbpln178.seq
791663935 gbpln1780.se
942730875 gbpln1781.se
611720944 gbpln1782.se
801353716 gbpln1783.se
755984392 gbpln1784.se
515950587 gbpln1785.se
730612021 gbpln1786.se
754956047 gbpln1787.se
552345645 gbpln1788.se
632515095 gbpln1789.se
463740200 gbpln179.seq
756169196 gbpln1790.se
470848206 gbpln1791.se
774219381 gbpln1792.se
818888469 gbpln1793.se
623527102 gbpln1794.se
498525119 gbpln1795.se
482321806 gbpln1796.se
457141996 gbpln1797.se
469346005 gbpln1798.se
323635207 gbpln1799.se
418823303 gbpln18.seq
393476964 gbpln180.seq
498969871 gbpln1800.se
499320075 gbpln1801.se
491583750 gbpln1802.se
487185903 gbpln1803.se
182220271 gbpln1804.se
377272807 gbpln1805.se
626278050 gbpln1806.se
818534977 gbpln1807.se
744338029 gbpln1808.se
840481828 gbpln1809.se
114312500 gbpln181.seq
794009713 gbpln1810.se
688256286 gbpln1811.se
841577973 gbpln1812.se
25762175 gbpln1813.se
665178568 gbpln1814.se
840478319 gbpln1815.se
804862544 gbpln1816.se
775136193 gbpln1817.se
749151155 gbpln1818.se
707736695 gbpln1819.se
430007058 gbpln182.seq
809488365 gbpln1820.se
661228590 gbpln1821.se
836948259 gbpln1822.se
794972859 gbpln1823.se
775455598 gbpln1824.se
752931639 gbpln1825.se
710188072 gbpln1826.se
794996206 gbpln1827.se
656305255 gbpln1828.se
852997313 gbpln1829.se
485882010 gbpln183.seq
798187575 gbpln1830.se
776406263 gbpln1831.se
749661142 gbpln1832.se
708724373 gbpln1833.se
804700406 gbpln1834.se
659125980 gbpln1835.se
833048862 gbpln1836.se
794071582 gbpln1837.se
772684697 gbpln1838.se
754758102 gbpln1839.se
403795990 gbpln184.seq
700069996 gbpln1840.se
793225130 gbpln1841.se
658436221 gbpln1842.se
839152730 gbpln1843.se
798464996 gbpln1844.se
775710033 gbpln1845.se
744924658 gbpln1846.se
719062576 gbpln1847.se
798410686 gbpln1848.se
657106543 gbpln1849.se
451516767 gbpln185.seq
827472017 gbpln1850.se
799696373 gbpln1851.se
771541363 gbpln1852.se
743322371 gbpln1853.se
712776428 gbpln1854.se
793860153 gbpln1855.se
656608371 gbpln1856.se
830011447 gbpln1857.se
803324869 gbpln1858.se
778613518 gbpln1859.se
382592005 gbpln186.seq
757477427 gbpln1860.se
728058413 gbpln1861.se
793687618 gbpln1862.se
666598482 gbpln1863.se
834396522 gbpln1864.se
793156442 gbpln1865.se
771664945 gbpln1866.se
746127866 gbpln1867.se
714848466 gbpln1868.se
809569982 gbpln1869.se
457726110 gbpln187.seq
663177934 gbpln1870.se
831402033 gbpln1871.se
788227480 gbpln1872.se
773608315 gbpln1873.se
756195357 gbpln1874.se
703056123 gbpln1875.se
797970460 gbpln1876.se
659145675 gbpln1877.se
833114761 gbpln1878.se
791988363 gbpln1879.se
493420618 gbpln188.seq
773778680 gbpln1880.se
736302365 gbpln1881.se
703036009 gbpln1882.se
798246923 gbpln1883.se
661431559 gbpln1884.se
832582978 gbpln1885.se
790630518 gbpln1886.se
774554078 gbpln1887.se
746769221 gbpln1888.se
712662432 gbpln1889.se
497715243 gbpln189.seq
792723541 gbpln1890.se
669899614 gbpln1891.se
841885928 gbpln1892.se
814740283 gbpln1893.se
781686950 gbpln1894.se
765848634 gbpln1895.se
704928652 gbpln1896.se
817350531 gbpln1897.se
656762766 gbpln1898.se
836345572 gbpln1899.se
496016838 gbpln19.seq
494847899 gbpln190.seq
803943397 gbpln1900.se
776352617 gbpln1901.se
747411545 gbpln1902.se
714330949 gbpln1903.se
802296973 gbpln1904.se
665963375 gbpln1905.se
833628952 gbpln1906.se
800337028 gbpln1907.se
775679569 gbpln1908.se
756201475 gbpln1909.se
147147531 gbpln191.seq
729171201 gbpln1910.se
803715547 gbpln1911.se
666969206 gbpln1912.se
837791026 gbpln1913.se
805450455 gbpln1914.se
782697461 gbpln1915.se
750312638 gbpln1916.se
712090922 gbpln1917.se
810098655 gbpln1918.se
661446766 gbpln1919.se
490697083 gbpln192.seq
844251896 gbpln1920.se
800661389 gbpln1921.se
770104661 gbpln1922.se
746196369 gbpln1923.se
740624627 gbpln1924.se
810764368 gbpln1925.se
430820664 gbpln1926.se
439418037 gbpln1927.se
495349376 gbpln1928.se
420755197 gbpln1929.se
492045809 gbpln193.seq
79867313 gbpln1930.se
477385948 gbpln1931.se
471883612 gbpln1932.se
478940659 gbpln1933.se
333989198 gbpln1934.se
253005912 gbpln1935.se
436323528 gbpln1936.se
474062172 gbpln1937.se
483649355 gbpln1938.se
403534786 gbpln1939.se
495011653 gbpln194.seq
498892972 gbpln1940.se
201620526 gbpln1941.se
492206431 gbpln1942.se
431247284 gbpln1943.se
485331477 gbpln1944.se
499128952 gbpln1945.se
446943656 gbpln1946.se
445678707 gbpln1947.se
492931817 gbpln1948.se
488728965 gbpln1949.se
375787291 gbpln195.seq
442513917 gbpln1950.se
489986240 gbpln1951.se
485052602 gbpln1952.se
402707116 gbpln1953.se
484676594 gbpln1954.se
457870134 gbpln1955.se
485317363 gbpln1956.se
412333094 gbpln1957.se
414213485 gbpln1958.se
392278204 gbpln1959.se
459748362 gbpln196.seq
252441040 gbpln1960.se
483659967 gbpln1961.se
467301410 gbpln1962.se
405580660 gbpln1963.se
457115946 gbpln1964.se
70190485 gbpln1965.se
484439011 gbpln1966.se
462114796 gbpln1967.se
463366807 gbpln1968.se
320374741 gbpln1969.se
221425534 gbpln197.seq
395846795 gbpln1970.se
378719650 gbpln1971.se
367281367 gbpln1972.se
338474475 gbpln1973.se
318607005 gbpln1974.se
311653033 gbpln1975.se
283823331 gbpln1976.se
499365134 gbpln1977.se
472679926 gbpln1978.se
111646958 gbpln1979.se
389473095 gbpln198.seq
475053211 gbpln1980.se
410147052 gbpln1981.se
437551134 gbpln1982.se
453268537 gbpln1983.se
377240170 gbpln1984.se
2734223096 gbpln1985.se
2727931901 gbpln1986.se
2720692598 gbpln1987.se
2732441076 gbpln1988.se
2733260927 gbpln1989.se
304823814 gbpln199.seq
157556535 gbpln1990.se
2694271430 gbpln1991.se
2735442486 gbpln1992.se
2720859722 gbpln1993.se
2732011308 gbpln1994.se
2383529845 gbpln1995.se
2723191931 gbpln1996.se
2689474086 gbpln1997.se
2737751830 gbpln1998.se
2700210160 gbpln1999.se
499846796 gbpln2.seq
243286344 gbpln20.seq
301383681 gbpln200.seq
2006289519 gbpln2000.se
2636141786 gbpln2001.se
2722875815 gbpln2002.se
2725415454 gbpln2003.se
2730393002 gbpln2004.se
1948886785 gbpln2005.se
2738131093 gbpln2006.se
2727379378 gbpln2007.se
2679871098 gbpln2008.se
2737685310 gbpln2009.se
318452230 gbpln201.seq
786720890 gbpln2010.se
2727907345 gbpln2011.se
2657432129 gbpln2012.se
2735229991 gbpln2013.se
2728645371 gbpln2014.se
218791011 gbpln2015.se
2719617838 gbpln2016.se
2721885171 gbpln2017.se
2721092581 gbpln2018.se
2679558604 gbpln2019.se
281218213 gbpln202.seq
181580803 gbpln2020.se
2722179116 gbpln2021.se
2736369220 gbpln2022.se
2726783046 gbpln2023.se
2440060122 gbpln2024.se
2736724965 gbpln2025.se
2696541624 gbpln2026.se
422496617 gbpln2027.se
2731302183 gbpln2028.se
2702984894 gbpln2029.se
447505205 gbpln203.seq
2732485324 gbpln2030.se
1906858977 gbpln2031.se
1292626852 gbpln2032.se
407499681 gbpln2033.se
471674647 gbpln2034.se
392501299 gbpln2035.se
471465881 gbpln2036.se
465574138 gbpln2037.se
440952437 gbpln2038.se
575645529 gbpln2039.se
228460638 gbpln204.seq
734445378 gbpln2040.se
697159202 gbpln2041.se
621889642 gbpln2042.se
656718843 gbpln2043.se
558783862 gbpln2044.se
699089816 gbpln2045.se
574123634 gbpln2046.se
721607985 gbpln2047.se
718233528 gbpln2048.se
628979866 gbpln2049.se
497423138 gbpln205.seq
662283407 gbpln2050.se
559564406 gbpln2051.se
726501832 gbpln2052.se
175851 gbpln2053.se
558553896 gbpln2054.se
736054186 gbpln2055.se
682550439 gbpln2056.se
616280683 gbpln2057.se
628026548 gbpln2058.se
551354059 gbpln2059.se
495662331 gbpln206.seq
677933274 gbpln2060.se
549876381 gbpln2061.se
689339626 gbpln2062.se
658635449 gbpln2063.se
604420911 gbpln2064.se
622625000 gbpln2065.se
544618917 gbpln2066.se
696594014 gbpln2067.se
174779 gbpln2068.se
568398582 gbpln2069.se
444550735 gbpln207.seq
752800823 gbpln2070.se
698346119 gbpln2071.se
608730243 gbpln2072.se
652235208 gbpln2073.se
542363484 gbpln2074.se
702360856 gbpln2075.se
565600613 gbpln2076.se
754304818 gbpln2077.se
711293759 gbpln2078.se
605904859 gbpln2079.se
438126854 gbpln208.seq
666855938 gbpln2080.se
544952160 gbpln2081.se
703427667 gbpln2082.se
174749 gbpln2083.se
566716389 gbpln2084.se
718786058 gbpln2085.se
711087366 gbpln2086.se
642562848 gbpln2087.se
647633318 gbpln2088.se
553626911 gbpln2089.se
488990760 gbpln209.seq
565229115 gbpln2090.se
549156577 gbpln2091.se
736859608 gbpln2092.se
691433519 gbpln2093.se
617624847 gbpln2094.se
636966542 gbpln2095.se
552239528 gbpln2096.se
556957719 gbpln2097.se
174818 gbpln2098.se
564066555 gbpln2099.se
462332174 gbpln21.seq
492398817 gbpln210.seq
691947282 gbpln2100.se
624453167 gbpln2101.se
568801669 gbpln2102.se
623008870 gbpln2103.se
524788928 gbpln2104.se
645004954 gbpln2105.se
540958899 gbpln2106.se
655828783 gbpln2107.se
520795030 gbpln2108.se
586540920 gbpln2109.se
352772052 gbpln211.seq
597946208 gbpln2110.se
512499450 gbpln2111.se
665998603 gbpln2112.se
549985709 gbpln2113.se
705073397 gbpln2114.se
569802481 gbpln2115.se
551263895 gbpln2116.se
617715492 gbpln2117.se
533030891 gbpln2118.se
642027672 gbpln2119.se
185131817 gbpln212.seq
537224178 gbpln2120.se
670508728 gbpln2121.se
649315773 gbpln2122.se
588952556 gbpln2123.se
605547434 gbpln2124.se
513253175 gbpln2125.se
637456772 gbpln2126.se
174881 gbpln2127.se
548524272 gbpln2128.se
711748457 gbpln2129.se
369359776 gbpln213.seq
688643289 gbpln2130.se
589153230 gbpln2131.se
607494571 gbpln2132.se
469515369 gbpln2133.se
596414735 gbpln2134.se
563516669 gbpln2135.se
696200282 gbpln2136.se
602471952 gbpln2137.se
479557185 gbpln2138.se
613324917 gbpln2139.se
360003680 gbpln214.seq
542743607 gbpln2140.se
577693408 gbpln2141.se
515295514 gbpln2142.se
698832234 gbpln2143.se
595216266 gbpln2144.se
522577566 gbpln2145.se
554145572 gbpln2146.se
465690537 gbpln2147.se
637185354 gbpln2148.se
518213118 gbpln2149.se
481797464 gbpln215.seq
700947969 gbpln2150.se
667672842 gbpln2151.se
557142977 gbpln2152.se
587023274 gbpln2153.se
522955911 gbpln2154.se
549261646 gbpln2155.se
174960 gbpln2156.se
555727736 gbpln2157.se
707369547 gbpln2158.se
665776881 gbpln2159.se
185334309 gbpln216.seq
632220444 gbpln2160.se
603354746 gbpln2161.se
512704100 gbpln2162.se
209276730 gbpln2163.se
542361412 gbpln2164.se
673868938 gbpln2165.se
669299626 gbpln2166.se
594324003 gbpln2167.se
633286407 gbpln2168.se
540739103 gbpln2169.se
332596046 gbpln217.seq
656466500 gbpln2170.se
573168484 gbpln2171.se
664511655 gbpln2172.se
699170489 gbpln2173.se
613488890 gbpln2174.se
604892488 gbpln2175.se
530136173 gbpln2176.se
321128187 gbpln2177.se
549702443 gbpln2178.se
691732891 gbpln2179.se
352285419 gbpln218.seq
690639525 gbpln2180.se
592908220 gbpln2181.se
583827820 gbpln2182.se
505911951 gbpln2183.se
187370785 gbpln2184.se
531607726 gbpln2185.se
670735982 gbpln2186.se
639701218 gbpln2187.se
625168916 gbpln2188.se
608581292 gbpln2189.se
316491733 gbpln219.seq
409196174 gbpln2190.se
650768736 gbpln2191.se
553023979 gbpln2192.se
701464510 gbpln2193.se
681749344 gbpln2194.se
628995544 gbpln2195.se
631664938 gbpln2196.se
532240293 gbpln2197.se
701394148 gbpln2198.se
563260621 gbpln2199.se
458606826 gbpln22.seq
356545945 gbpln220.seq
694363863 gbpln2200.se
602187920 gbpln2201.se
534603645 gbpln2202.se
623960566 gbpln2203.se
400123881 gbpln2204.se
659795356 gbpln2205.se
548217914 gbpln2206.se
710835335 gbpln2207.se
630332153 gbpln2208.se
576299747 gbpln2209.se
237684058 gbpln221.seq
601997530 gbpln2210.se
504851755 gbpln2211.se
628751564 gbpln2212.se
175090 gbpln2213.se
564528827 gbpln2214.se
618979127 gbpln2215.se
635231824 gbpln2216.se
529924441 gbpln2217.se
621986808 gbpln2218.se
523379327 gbpln2219.se
344675277 gbpln222.seq
594649456 gbpln2220.se
519615124 gbpln2221.se
616668781 gbpln2222.se
675038822 gbpln2223.se
595433203 gbpln2224.se
605474869 gbpln2225.se
500671219 gbpln2226.se
684971873 gbpln2227.se
552386546 gbpln2228.se
716306444 gbpln2229.se
325130194 gbpln223.seq
672179655 gbpln2230.se
600740349 gbpln2231.se
620624199 gbpln2232.se
482434358 gbpln2233.se
619293983 gbpln2234.se
503654450 gbpln2235.se
687554133 gbpln2236.se
692658095 gbpln2237.se
519573430 gbpln2238.se
609582586 gbpln2239.se
319807389 gbpln224.seq
522424837 gbpln2240.se
637977863 gbpln2241.se
174958 gbpln2242.se
814010732 gbpln2243.se
1048521841 gbpln2244.se
1038155649 gbpln2245.se
833369914 gbpln2246.se
931292853 gbpln2247.se
811379776 gbpln2248.se
1004411700 gbpln2249.se
320591842 gbpln225.seq
73580987 gbpln2250.se
812614241 gbpln2251.se
1052276437 gbpln2252.se
1035793500 gbpln2253.se
832863065 gbpln2254.se
922247149 gbpln2255.se
807661511 gbpln2256.se
1004047797 gbpln2257.se
62119261 gbpln2258.se
537475227 gbpln2259.se
370343519 gbpln226.seq
460223025 gbpln2260.se
693641164 gbpln2261.se
580029100 gbpln2262.se
597416510 gbpln2263.se
505105364 gbpln2264.se
657955597 gbpln2265.se
551663040 gbpln2266.se
470220012 gbpln2267.se
640870217 gbpln2268.se
550372651 gbpln2269.se
226022854 gbpln227.seq
609801478 gbpln2270.se
526021655 gbpln2271.se
679622534 gbpln2272.se
554031927 gbpln2273.se
683042768 gbpln2274.se
659526432 gbpln2275.se
583157115 gbpln2276.se
580366358 gbpln2277.se
500443859 gbpln2278.se
672372455 gbpln2279.se
487885129 gbpln228.seq
554076188 gbpln2280.se
701020945 gbpln2281.se
648496395 gbpln2282.se
568395035 gbpln2283.se
607372526 gbpln2284.se
532052842 gbpln2285.se
684166413 gbpln2286.se
494379648 gbpln2287.se
488905431 gbpln2288.se
443593696 gbpln2289.se
488700928 gbpln229.seq
447037980 gbpln2290.se
486295927 gbpln2291.se
489944647 gbpln2292.se
120811847 gbpln2293.se
445384194 gbpln2294.se
486655806 gbpln2295.se
436113233 gbpln2296.se
414594212 gbpln2297.se
458531282 gbpln2298.se
454242911 gbpln2299.se
465601747 gbpln23.seq
471379021 gbpln230.seq
489283288 gbpln2300.se
468470878 gbpln2301.se
467159933 gbpln2302.se
405724963 gbpln2303.se
141752273 gbpln2304.se
475725974 gbpln2305.se
490807512 gbpln2306.se
465293781 gbpln2307.se
464190576 gbpln2308.se
499942611 gbpln2309.se
474510233 gbpln231.seq
485800833 gbpln2310.se
412005073 gbpln2311.se
438081540 gbpln2312.se
494440209 gbpln2313.se
487591848 gbpln2314.se
388231814 gbpln2315.se
239493380 gbpln2316.se
454602157 gbpln2317.se
491297089 gbpln2318.se
486368814 gbpln2319.se
273986841 gbpln232.seq
489095838 gbpln2320.se
475803306 gbpln2321.se
492231886 gbpln2322.se
334148590 gbpln2323.se
498732770 gbpln2324.se
422601321 gbpln2325.se
489563882 gbpln2326.se
466879977 gbpln2327.se
403630469 gbpln2328.se
201693354 gbpln2329.se
413234155 gbpln233.seq
425465420 gbpln2330.se
148596170 gbpln2331.se
221798426 gbpln2332.se
1908341558 gbpln2333.se
1899626925 gbpln2334.se
1507440270 gbpln2335.se
1195338085 gbpln2336.se
871930698 gbpln2337.se
491359468 gbpln2338.se
421163895 gbpln2339.se
425115149 gbpln234.seq
489821939 gbpln2340.se
56498931 gbpln2341.se
469370229 gbpln2342.se
494577090 gbpln2343.se
459637310 gbpln2344.se
428345494 gbpln2345.se
471151788 gbpln2346.se
498560271 gbpln2347.se
496959342 gbpln2348.se
488149774 gbpln2349.se
425560692 gbpln235.seq
496820963 gbpln2350.se
256996209 gbpln2351.se
457508500 gbpln2352.se
462747609 gbpln2353.se
489498695 gbpln2354.se
409075226 gbpln2355.se
778284082 gbpln2356.se
627032043 gbpln2357.se
971627123 gbpln2358.se
850272715 gbpln2359.se
753151986 gbpln236.seq
849609082 gbpln2360.se
850190924 gbpln2361.se
976829654 gbpln2362.se
814643125 gbpln2363.se
879514342 gbpln2364.se
812317704 gbpln2365.se
742052286 gbpln2366.se
746185007 gbpln2367.se
944480603 gbpln2368.se
877381912 gbpln2369.se
744282264 gbpln237.seq
418956047 gbpln2370.se
379047469 gbpln2371.se
491746997 gbpln2372.se
408109925 gbpln2373.se
411464498 gbpln2374.se
405519448 gbpln2375.se
421563263 gbpln2376.se
486899328 gbpln2377.se
448446966 gbpln2378.se
468299962 gbpln2379.se
743804521 gbpln238.seq
498098635 gbpln2380.se
328659405 gbpln2381.se
397747269 gbpln2382.se
349681340 gbpln2383.se
412743518 gbpln2384.se
308781250 gbpln2385.se
220936514 gbpln2386.se
362786573 gbpln2387.se
372826577 gbpln2388.se
389647645 gbpln2389.se
739735479 gbpln239.seq
356807036 gbpln2390.se
423855958 gbpln2391.se
318309373 gbpln2392.se
224253502 gbpln2393.se
357536065 gbpln2394.se
499721839 gbpln2395.se
373201666 gbpln2396.se
487616772 gbpln2397.se
443634648 gbpln2398.se
444216942 gbpln2399.se
494528875 gbpln24.seq
667988546 gbpln240.seq
324026933 gbpln2400.se
302388084 gbpln2401.se
306898966 gbpln2402.se
275771316 gbpln2403.se
274214478 gbpln2404.se
282458958 gbpln2405.se
242559643 gbpln2406.se
249358523 gbpln2407.se
475649908 gbpln2408.se
456204313 gbpln2409.se
650329544 gbpln241.seq
395616203 gbpln2410.se
489602228 gbpln2411.se
289257941 gbpln2412.se
288793337 gbpln2413.se
275059682 gbpln2414.se
268591783 gbpln2415.se
268346034 gbpln2416.se
286994965 gbpln2417.se
262879986 gbpln2418.se
458464803 gbpln2419.se
574703572 gbpln242.seq
455513152 gbpln2420.se
390558841 gbpln2421.se
198175855 gbpln2422.se
311610770 gbpln2423.se
305533406 gbpln2424.se
289673508 gbpln2425.se
286829600 gbpln2426.se
256898846 gbpln2427.se
268622309 gbpln2428.se
256979800 gbpln2429.se
490264012 gbpln243.seq
492315386 gbpln2430.se
408343937 gbpln2431.se
399837733 gbpln2432.se
356204441 gbpln2433.se
1225077527 gbpln2434.se
720006493 gbpln2435.se
919172194 gbpln2436.se
874099561 gbpln2437.se
897784196 gbpln2438.se
876816853 gbpln2439.se
430773005 gbpln244.seq
928190368 gbpln2440.se
951802003 gbpln2441.se
824940722 gbpln2442.se
760296712 gbpln2443.se
729009749 gbpln2444.se
725897595 gbpln2445.se
714162060 gbpln2446.se
661112453 gbpln2447.se
467652752 gbpln2448.se
493038138 gbpln2449.se
494631260 gbpln245.seq
304602931 gbpln2450.se
498158027 gbpln2451.se
481755962 gbpln2452.se
420237390 gbpln2453.se
375114024 gbpln2454.se
482460500 gbpln2455.se
443633499 gbpln2456.se
499999935 gbpln2457.se
464765931 gbpln2458.se
434517734 gbpln246.seq
494162266 gbpln247.seq
469688145 gbpln248.seq
488706817 gbpln249.seq
426926678 gbpln25.seq
497418943 gbpln250.seq
381310794 gbpln251.seq
460983181 gbpln252.seq
455183610 gbpln253.seq
477269031 gbpln254.seq
487646183 gbpln255.seq
467090611 gbpln256.seq
71114034 gbpln257.seq
495017956 gbpln258.seq
460145370 gbpln259.seq
224879017 gbpln26.seq
499758825 gbpln260.seq
480460294 gbpln261.seq
357789591 gbpln262.seq
495236494 gbpln263.seq
338585381 gbpln264.seq
445491347 gbpln265.seq
499907826 gbpln266.seq
169709069 gbpln267.seq
484246438 gbpln268.seq
457709024 gbpln269.seq
369920299 gbpln27.seq
491940182 gbpln270.seq
445664088 gbpln271.seq
453106454 gbpln272.seq
138964454 gbpln273.seq
462991476 gbpln274.seq
493318599 gbpln275.seq
494504946 gbpln276.seq
45419007 gbpln277.seq
626279429 gbpln278.seq
818536598 gbpln279.seq
320631792 gbpln28.seq
744339771 gbpln280.seq
840483636 gbpln281.seq
794011180 gbpln282.seq
688257643 gbpln283.seq
841579594 gbpln284.seq
496414302 gbpln285.seq
479854160 gbpln286.seq
440990924 gbpln287.seq
475149874 gbpln288.seq
492529207 gbpln289.seq
318185493 gbpln29.seq
460254850 gbpln290.seq
434265022 gbpln291.seq
486594471 gbpln292.seq
435668408 gbpln293.seq
493251190 gbpln294.seq
480184778 gbpln295.seq
277480565 gbpln296.seq
480165306 gbpln297.seq
459338903 gbpln298.seq
482853354 gbpln299.seq
499974223 gbpln3.seq
320810750 gbpln30.seq
489564507 gbpln300.seq
490055303 gbpln301.seq
342066317 gbpln302.seq
492321474 gbpln303.seq
474321265 gbpln304.seq
482808661 gbpln305.seq
498884306 gbpln306.seq
499983012 gbpln307.seq
277763314 gbpln308.seq
487966613 gbpln309.seq
339200181 gbpln31.seq
489943528 gbpln310.seq
494562566 gbpln311.seq
476843997 gbpln312.seq
457015521 gbpln313.seq
71430896 gbpln314.seq
429003094 gbpln315.seq
458279570 gbpln316.seq
488652569 gbpln317.seq
557116302 gbpln318.seq
564042982 gbpln319.seq
222826757 gbpln32.seq
565589046 gbpln320.seq
598412524 gbpln321.seq
651226985 gbpln322.seq
669833733 gbpln323.seq
251126055 gbpln324.seq
481665756 gbpln325.seq
315075338 gbpln326.seq
428846882 gbpln327.seq
458083406 gbpln328.seq
488435218 gbpln329.seq
336947956 gbpln33.seq
556900270 gbpln330.seq
563794885 gbpln331.seq
565347445 gbpln332.seq
598194649 gbpln333.seq
650965037 gbpln334.seq
669554729 gbpln335.seq
475110216 gbpln336.seq
407794053 gbpln337.seq
432774718 gbpln338.seq
99494863 gbpln339.seq
309835203 gbpln34.seq
443580780 gbpln340.seq
480285834 gbpln341.seq
359163047 gbpln342.seq
457191780 gbpln343.seq
406143837 gbpln344.seq
436793969 gbpln345.seq
459965743 gbpln346.seq
467931651 gbpln347.seq
471381035 gbpln348.seq
479332584 gbpln349.seq
351268105 gbpln35.seq
251212563 gbpln350.seq
458330600 gbpln351.seq
485968877 gbpln352.seq
477646524 gbpln353.seq
442878481 gbpln354.seq
494854700 gbpln355.seq
411727448 gbpln356.seq
466032484 gbpln357.seq
478742350 gbpln358.seq
479307889 gbpln359.seq
492841594 gbpln36.seq
472913638 gbpln360.seq
498246978 gbpln361.seq
398694105 gbpln362.seq
498492071 gbpln363.seq
468619495 gbpln364.seq
446785917 gbpln365.seq
463443515 gbpln366.seq
364586957 gbpln367.seq
481413942 gbpln368.seq
453066758 gbpln369.seq
497634304 gbpln37.seq
499255637 gbpln370.seq
411076712 gbpln371.seq
311643879 gbpln372.seq
456454550 gbpln373.seq
393522953 gbpln374.seq
368848942 gbpln375.seq
352401561 gbpln376.seq
334932373 gbpln377.seq
464179868 gbpln378.seq
133786016 gbpln379.seq
490332825 gbpln38.seq
480010844 gbpln380.seq
499497049 gbpln381.seq
491475622 gbpln382.seq
441945654 gbpln383.seq
491867038 gbpln384.seq
463533213 gbpln385.seq
474890759 gbpln386.seq
468746954 gbpln387.seq
484948080 gbpln388.seq
419370759 gbpln389.seq
419794317 gbpln39.seq
86418 gbpln390.seq
361751 gbpln391.seq
164981114 gbpln392.seq
40089516 gbpln393.seq
74918158 gbpln394.seq
499997847 gbpln395.seq
360321581 gbpln396.seq
499998459 gbpln397.seq
499997970 gbpln398.seq
144000020 gbpln399.seq
499897802 gbpln4.seq
472674201 gbpln40.seq
499998217 gbpln400.seq
499602722 gbpln401.seq
499958424 gbpln402.seq
291027751 gbpln403.seq
298761380 gbpln404.seq
211420757 gbpln405.seq
248588960 gbpln406.seq
185674454 gbpln407.seq
997331398 gbpln408.seq
56517854 gbpln409.seq
500000131 gbpln41.seq
487357680 gbpln410.seq
473525596 gbpln411.seq
473209473 gbpln412.seq
467870653 gbpln413.seq
168324953 gbpln414.seq
442170645 gbpln415.seq
460425795 gbpln416.seq
479222672 gbpln417.seq
92564056 gbpln418.seq
609356119 gbpln419.seq
25009408 gbpln42.seq
786074578 gbpln420.seq
733167229 gbpln421.seq
736239733 gbpln422.seq
691575746 gbpln423.seq
660133963 gbpln424.seq
739031764 gbpln425.seq
457972634 gbpln426.seq
425794743 gbpln427.seq
499999929 gbpln428.seq
66354013 gbpln429.seq
346111820 gbpln43.seq
499999389 gbpln430.seq
500000118 gbpln431.seq
272047862 gbpln432.seq
499999458 gbpln433.seq
499998922 gbpln434.seq
93879111 gbpln435.seq
499998888 gbpln436.seq
484618299 gbpln437.seq
499999618 gbpln438.seq
421275702 gbpln439.seq
384907647 gbpln44.seq
499991352 gbpln440.seq
391044897 gbpln441.seq
499998947 gbpln442.seq
499998491 gbpln443.seq
499996057 gbpln444.seq
72191740 gbpln445.seq
499999086 gbpln446.seq
499907369 gbpln447.seq
423258403 gbpln448.seq
499998405 gbpln449.seq
205693142 gbpln45.seq
499812432 gbpln450.seq
497042128 gbpln451.seq
489523740 gbpln452.seq
88477255 gbpln453.seq
499831885 gbpln454.seq
491589683 gbpln455.seq
402785639 gbpln456.seq
445924319 gbpln457.seq
499811150 gbpln458.seq
5650012 gbpln459.seq
85942873 gbpln46.seq
492255134 gbpln460.seq
226945063 gbpln461.seq
315805316 gbpln462.seq
665291577 gbpln463.seq
860028189 gbpln464.seq
800605872 gbpln465.seq
794469115 gbpln466.seq
762933697 gbpln467.seq
729969959 gbpln468.seq
808217924 gbpln469.seq
477916829 gbpln47.seq
209360455 gbpln470.seq
924325157 gbpln471.seq
1201978654 gbpln472.seq
1227268207 gbpln473.seq
1152253241 gbpln474.seq
1115248374 gbpln475.seq
1125506105 gbpln476.seq
1145303472 gbpln477.seq
695608615 gbpln478.seq
494750269 gbpln479.seq
499904224 gbpln48.seq
460644363 gbpln480.seq
152680390 gbpln481.seq
462987281 gbpln482.seq
480457520 gbpln483.seq
494737040 gbpln484.seq
446441302 gbpln485.seq
117077133 gbpln486.seq
485280656 gbpln487.seq
153318246 gbpln488.seq
689933987 gbpln489.seq
498817817 gbpln49.seq
887561680 gbpln490.seq
834970472 gbpln491.seq
826391913 gbpln492.seq
792513917 gbpln493.seq
743209872 gbpln494.seq
833073712 gbpln495.seq
562407 gbpln496.seq
665291577 gbpln497.seq
860028189 gbpln498.seq
800605872 gbpln499.seq
480121205 gbpln5.seq
323729344 gbpln50.seq
794469115 gbpln500.seq
762933697 gbpln501.seq
729969959 gbpln502.seq
808217924 gbpln503.seq
189172290 gbpln504.seq
663098252 gbpln505.seq
855592604 gbpln506.seq
807031053 gbpln507.seq
793905039 gbpln508.seq
773303164 gbpln509.seq
499081471 gbpln51.seq
718153248 gbpln510.seq
804870210 gbpln511.seq
661762125 gbpln512.seq
840180304 gbpln513.seq
796430245 gbpln514.seq
779180715 gbpln515.seq
761224530 gbpln516.seq
725380245 gbpln517.seq
792983451 gbpln518.seq
652402241 gbpln519.seq
497391852 gbpln52.seq
831209396 gbpln520.seq
783682955 gbpln521.seq
775938782 gbpln522.seq
741958804 gbpln523.seq
700440901 gbpln524.seq
788705159 gbpln525.seq
683172483 gbpln526.seq
872662143 gbpln527.seq
815663229 gbpln528.seq
813528167 gbpln529.seq
499428423 gbpln53.seq
780491844 gbpln530.seq
734904793 gbpln531.seq
816941948 gbpln532.seq
635039454 gbpln533.seq
824184474 gbpln534.seq
768070182 gbpln535.seq
758956882 gbpln536.seq
732189331 gbpln537.seq
706311232 gbpln538.seq
766293442 gbpln539.seq
103294748 gbpln54.seq
651415133 gbpln540.seq
830082304 gbpln541.seq
783385752 gbpln542.seq
770520351 gbpln543.seq
753421970 gbpln544.seq
699441547 gbpln545.seq
784443196 gbpln546.seq
4698 gbpln547.seq
702337808 gbpln548.seq
906907390 gbpln549.seq
496567059 gbpln55.seq
844110716 gbpln550.seq
841780855 gbpln551.seq
805270043 gbpln552.seq
764396863 gbpln553.seq
841492595 gbpln554.seq
714482811 gbpln555.seq
916127997 gbpln556.seq
858459407 gbpln557.seq
848936990 gbpln558.seq
813129213 gbpln559.seq
478891417 gbpln56.seq
765593150 gbpln560.seq
862731158 gbpln561.seq
665885634 gbpln562.seq
854365265 gbpln563.seq
802776346 gbpln564.seq
793295912 gbpln565.seq
769246240 gbpln566.seq
710912919 gbpln567.seq
799876815 gbpln568.seq
629668050 gbpln569.seq
383840468 gbpln57.seq
814320946 gbpln570.seq
759349720 gbpln571.seq
762512207 gbpln572.seq
724647884 gbpln573.seq
679679449 gbpln574.seq
784312844 gbpln575.seq
684180819 gbpln576.seq
873292213 gbpln577.seq
827422505 gbpln578.seq
815925825 gbpln579.seq
454048257 gbpln58.seq
779009585 gbpln580.seq
739747654 gbpln581.seq
834950434 gbpln582.seq
663096073 gbpln583.seq
849628701 gbpln584.seq
803882830 gbpln585.seq
794420470 gbpln586.seq
760127459 gbpln587.seq
714663802 gbpln588.seq
801095950 gbpln589.seq
495221947 gbpln59.seq
668869887 gbpln590.seq
854770002 gbpln591.seq
805931576 gbpln592.seq
798923954 gbpln593.seq
766411223 gbpln594.seq
723133936 gbpln595.seq
803351408 gbpln596.seq
664176987 gbpln597.seq
854339916 gbpln598.seq
803900400 gbpln599.seq
499999166 gbpln6.seq
486126589 gbpln60.seq
791449620 gbpln600.seq
761145205 gbpln601.seq
715062603 gbpln602.seq
806379176 gbpln603.seq
668964953 gbpln604.seq
870939392 gbpln605.seq
809408813 gbpln606.seq
801514137 gbpln607.seq
768794024 gbpln608.seq
723644689 gbpln609.seq
498663354 gbpln61.seq
815153418 gbpln610.seq
661177159 gbpln611.seq
846934671 gbpln612.seq
794708793 gbpln613.seq
789781753 gbpln614.seq
764576068 gbpln615.seq
711115451 gbpln616.seq
797517245 gbpln617.seq
691953899 gbpln618.seq
888406351 gbpln619.seq
471931537 gbpln62.seq
835271741 gbpln620.seq
823533989 gbpln621.seq
787819193 gbpln622.seq
748786657 gbpln623.seq
838184652 gbpln624.seq
488802687 gbpln625.seq
439661491 gbpln626.seq
155752105 gbpln627.seq
758806100 gbpln628.seq
898446949 gbpln629.seq
497321530 gbpln63.seq
628489896 gbpln630.seq
1024113089 gbpln631.seq
1032878661 gbpln632.seq
858694781 gbpln633.seq
960391204 gbpln634.seq
1090094606 gbpln635.seq
781959143 gbpln636.seq
946995961 gbpln637.seq
857542781 gbpln638.seq
656405285 gbpln639.seq
472649872 gbpln64.seq
907889097 gbpln640.seq
896386890 gbpln641.seq
726432335 gbpln642.seq
798296822 gbpln643.seq
918393750 gbpln644.seq
584961784 gbpln645.seq
948865971 gbpln646.seq
954536271 gbpln647.seq
819735731 gbpln648.seq
756588093 gbpln649.seq
478648821 gbpln65.seq
876067119 gbpln650.seq
625446321 gbpln651.seq
977801494 gbpln652.seq
854357980 gbpln653.seq
807732556 gbpln654.seq
947696453 gbpln655.seq
1067629605 gbpln656.seq
822222048 gbpln657.seq
950272996 gbpln658.seq
845138843 gbpln659.seq
83738365 gbpln66.seq
643846993 gbpln660.seq
894745096 gbpln661.seq
893352134 gbpln662.seq
722578984 gbpln663.seq
776227316 gbpln664.seq
899750467 gbpln665.seq
592059964 gbpln666.seq
933986451 gbpln667.seq
939527664 gbpln668.seq
810117922 gbpln669.seq
494334107 gbpln67.seq
765938558 gbpln670.seq
886537018 gbpln671.seq
623519964 gbpln672.seq
996940649 gbpln673.seq
1030190034 gbpln674.seq
832828033 gbpln675.seq
956342979 gbpln676.seq
1134286144 gbpln677.seq
790513299 gbpln678.seq
944161893 gbpln679.seq
475215142 gbpln68.seq
860035788 gbpln680.seq
647268685 gbpln681.seq
902239623 gbpln682.seq
611029440 gbpln683.seq
734907577 gbpln684.seq
787834228 gbpln685.seq
910724363 gbpln686.seq
606016896 gbpln687.seq
961485234 gbpln688.seq
1242775191 gbpln689.seq
468208544 gbpln69.seq
816670128 gbpln690.seq
636658925 gbpln691.seq
818591771 gbpln692.seq
766580884 gbpln693.seq
752100829 gbpln694.seq
724519993 gbpln695.seq
690955648 gbpln696.seq
769738288 gbpln697.seq
750738544 gbpln698.seq
872184389 gbpln699.seq
499939641 gbpln7.seq
486860731 gbpln70.seq
624480879 gbpln700.seq
995069022 gbpln701.seq
1012956234 gbpln702.seq
827074347 gbpln703.seq
940621783 gbpln704.seq
1079418810 gbpln705.seq
776922106 gbpln706.seq
938380968 gbpln707.seq
848757671 gbpln708.seq
643572913 gbpln709.seq
272302955 gbpln71.seq
891714442 gbpln710.seq
878638403 gbpln711.seq
721632671 gbpln712.seq
779156122 gbpln713.seq
895553446 gbpln714.seq
604678568 gbpln715.seq
931006295 gbpln716.seq
933660027 gbpln717.seq
810459540 gbpln718.seq
761872100 gbpln719.seq
172902228 gbpln72.seq
878702815 gbpln720.seq
627081460 gbpln721.seq
994320235 gbpln722.seq
999434327 gbpln723.seq
823789349 gbpln724.seq
945629782 gbpln725.seq
1062113821 gbpln726.seq
792298939 gbpln727.seq
941851700 gbpln728.seq
850142413 gbpln729.seq
471233536 gbpln73.seq
656955691 gbpln730.seq
904094753 gbpln731.seq
900193903 gbpln732.seq
728906821 gbpln733.seq
741172650 gbpln734.seq
898719079 gbpln735.seq
599002526 gbpln736.seq
937117048 gbpln737.seq
936021119 gbpln738.seq
812696702 gbpln739.seq
455042321 gbpln74.seq
746628212 gbpln740.seq
897168807 gbpln741.seq
626698501 gbpln742.seq
1007072101 gbpln743.seq
1000831797 gbpln744.seq
841918855 gbpln745.seq
963426816 gbpln746.seq
1093654114 gbpln747.seq
791118382 gbpln748.seq
959940756 gbpln749.seq
488809223 gbpln75.seq
853263842 gbpln750.seq
648051398 gbpln751.seq
901282075 gbpln752.seq
923491092 gbpln753.seq
732477869 gbpln754.seq
789987733 gbpln755.seq
926022053 gbpln756.seq
610840579 gbpln757.seq
949759032 gbpln758.seq
955444559 gbpln759.seq
355272263 gbpln76.seq
818480442 gbpln760.seq
752251380 gbpln761.seq
897893149 gbpln762.seq
631111272 gbpln763.seq
1022032953 gbpln764.seq
1006306956 gbpln765.seq
837035085 gbpln766.seq
966140819 gbpln767.seq
1090560006 gbpln768.seq
800164754 gbpln769.seq
200538454 gbpln77.seq
959884028 gbpln770.seq
886916735 gbpln771.seq
641540050 gbpln772.seq
910168783 gbpln773.seq
908785549 gbpln774.seq
729527181 gbpln775.seq
797552105 gbpln776.seq
910975470 gbpln777.seq
616026199 gbpln778.seq
945685366 gbpln779.seq
377219536 gbpln78.seq
953145956 gbpln780.seq
820081609 gbpln781.seq
763165947 gbpln782.seq
870898266 gbpln783.seq
618200825 gbpln784.seq
1009123187 gbpln785.seq
1016689515 gbpln786.seq
832912303 gbpln787.seq
952656374 gbpln788.seq
1065835283 gbpln789.seq
375192640 gbpln79.seq
776075044 gbpln790.seq
935940025 gbpln791.seq
846831932 gbpln792.seq
641399988 gbpln793.seq
892709705 gbpln794.seq
594848385 gbpln795.seq
720169483 gbpln796.seq
780564861 gbpln797.seq
888344689 gbpln798.seq
610800072 gbpln799.seq
226151695 gbpln8.seq
386441749 gbpln80.seq
934713391 gbpln800.seq
1233388213 gbpln801.seq
807523234 gbpln802.seq
19542 gbpln803.seq
757881986 gbpln804.seq
889760627 gbpln805.seq
635890046 gbpln806.seq
1007873898 gbpln807.seq
1015524558 gbpln808.seq
836625022 gbpln809.seq
475314026 gbpln81.seq
959076059 gbpln810.seq
1077416379 gbpln811.seq
789416089 gbpln812.seq
958430056 gbpln813.seq
877922843 gbpln814.seq
648665455 gbpln815.seq
907513209 gbpln816.seq
904978028 gbpln817.seq
727024880 gbpln818.seq
789120540 gbpln819.seq
452882572 gbpln82.seq
898507915 gbpln820.seq
617229811 gbpln821.seq
942711764 gbpln822.seq
964780021 gbpln823.seq
818917331 gbpln824.seq
755294557 gbpln825.seq
882064051 gbpln826.seq
627203691 gbpln827.seq
993595919 gbpln828.seq
1021497440 gbpln829.seq
125944249 gbpln83.seq
827286497 gbpln830.seq
962451301 gbpln831.seq
1082256067 gbpln832.seq
781463827 gbpln833.seq
919665368 gbpln834.seq
852133929 gbpln835.seq
645388382 gbpln836.seq
905574854 gbpln837.seq
906714977 gbpln838.seq
718743537 gbpln839.seq
476593700 gbpln84.seq
787529633 gbpln840.seq
910251919 gbpln841.seq
608518276 gbpln842.seq
934541265 gbpln843.seq
954054955 gbpln844.seq
806443717 gbpln845.seq
1009766480 gbpln846.seq
1318260463 gbpln847.seq
1253136609 gbpln848.seq
1066198175 gbpln849.seq
434249982 gbpln85.seq
1119572655 gbpln850.seq
1040217505 gbpln851.seq
1310077288 gbpln852.seq
955690374 gbpln853.seq
1230684440 gbpln854.seq
1179787958 gbpln855.seq
1125383520 gbpln856.seq
1051194518 gbpln857.seq
965656648 gbpln858.seq
1110281977 gbpln859.seq
440487400 gbpln86.seq
32675 gbpln860.seq
253174917 gbpln861.seq
654245898 gbpln862.seq
843080362 gbpln863.seq
787261705 gbpln864.seq
773098599 gbpln865.seq
745082094 gbpln866.seq
711612756 gbpln867.seq
801222610 gbpln868.seq
271156 gbpln869.seq
444203819 gbpln87.seq
398651709 gbpln870.seq
315170317 gbpln871.seq
306732013 gbpln872.seq
319872292 gbpln873.seq
286450423 gbpln874.seq
220883441 gbpln875.seq
470283415 gbpln876.seq
475876375 gbpln877.seq
499130261 gbpln878.seq
460644363 gbpln879.seq
189178972 gbpln88.seq
359155255 gbpln880.seq
399402445 gbpln881.seq
501115666 gbpln882.seq
413826113 gbpln883.seq
367000227 gbpln884.seq
238050627 gbpln885.seq
352241749 gbpln886.seq
298781185 gbpln887.seq
490717667 gbpln888.seq
86108252 gbpln889.seq
460469435 gbpln89.seq
9838016 gbpln890.seq
10168231 gbpln891.seq
766528189 gbpln892.seq
422668596 gbpln893.seq
133601533 gbpln894.seq
756143249 gbpln895.seq
878426054 gbpln896.seq
631056251 gbpln897.seq
993852367 gbpln898.seq
1020132695 gbpln899.seq
500000209 gbpln9.seq
440542307 gbpln90.seq
830166807 gbpln900.seq
955723315 gbpln901.seq
1057964328 gbpln902.seq
784007552 gbpln903.seq
947940191 gbpln904.seq
857511193 gbpln905.seq
649137171 gbpln906.seq
903393879 gbpln907.seq
908180396 gbpln908.seq
721135945 gbpln909.seq
452992006 gbpln91.seq
786739709 gbpln910.seq
918070756 gbpln911.seq
603192844 gbpln912.seq
938102555 gbpln913.seq
955978436 gbpln914.seq
813787878 gbpln915.seq
639701128 gbpln916.seq
468552999 gbpln917.seq
499475514 gbpln918.seq
498586280 gbpln919.seq
497916786 gbpln92.seq
20795939 gbpln920.seq
768129678 gbpln921.seq
891209633 gbpln922.seq
1017177961 gbpln923.seq
1036708108 gbpln924.seq
980496603 gbpln925.seq
1096870510 gbpln926.seq
964601805 gbpln927.seq
883690282 gbpln928.seq
879367269 gbpln929.seq
452560860 gbpln93.seq
922136688 gbpln930.seq
805432021 gbpln931.seq
912345991 gbpln932.seq
954500353 gbpln933.seq
944560088 gbpln934.seq
29543025 gbpln935.seq
404689567 gbpln936.seq
499997587 gbpln937.seq
499998682 gbpln938.seq
488964703 gbpln939.seq
363117062 gbpln94.seq
499998605 gbpln940.seq
499813392 gbpln941.seq
499999553 gbpln942.seq
90185297 gbpln943.seq
499998058 gbpln944.seq
499927227 gbpln945.seq
500000022 gbpln946.seq
326707114 gbpln947.seq
499748088 gbpln948.seq
499974021 gbpln949.seq
495372504 gbpln95.seq
499993366 gbpln950.seq
32336415 gbpln951.seq
499815407 gbpln952.seq
499858822 gbpln953.seq
499754197 gbpln954.seq
174267451 gbpln955.seq
499999366 gbpln956.seq
499941807 gbpln957.seq
499982638 gbpln958.seq
499998007 gbpln959.seq
472129613 gbpln96.seq
499820155 gbpln960.seq
136492608 gbpln961.seq
499814172 gbpln962.seq
499886617 gbpln963.seq
499589726 gbpln964.seq
412005104 gbpln965.seq
499990243 gbpln966.seq
499820681 gbpln967.seq
499953608 gbpln968.seq
499833936 gbpln969.seq
477884160 gbpln97.seq
84989104 gbpln970.seq
499939778 gbpln971.seq
499999054 gbpln972.seq
499905893 gbpln973.seq
291631209 gbpln974.seq
499889165 gbpln975.seq
499999991 gbpln976.seq
499882980 gbpln977.seq
485173945 gbpln978.seq
315191996 gbpln979.seq
460004048 gbpln98.seq
674055631 gbpln980.seq
865045961 gbpln981.seq
815791689 gbpln982.seq
802718902 gbpln983.seq
776304595 gbpln984.seq
721531499 gbpln985.seq
809857060 gbpln986.seq
679344023 gbpln987.seq
873797632 gbpln988.seq
820367220 gbpln989.seq
430418757 gbpln99.seq
806296382 gbpln990.seq
775209384 gbpln991.seq
744231520 gbpln992.seq
817156402 gbpln993.seq
771380170 gbpln994.seq
913253142 gbpln995.seq
634934982 gbpln996.seq
1019175188 gbpln997.seq
1023638564 gbpln998.seq
822225605 gbpln999.seq
148373644 gbpri1.seq
499825465 gbpri10.seq
499966274 gbpri11.seq
248882813 gbpri12.seq
499849548 gbpri13.seq
352979039 gbpri14.seq
162643079 gbpri15.seq
494712989 gbpri16.seq
499956353 gbpri17.seq
499952905 gbpri18.seq
499962231 gbpri19.seq
499849640 gbpri2.seq
254317986 gbpri20.seq
317623611 gbpri21.seq
301999314 gbpri22.seq
491210460 gbpri23.seq
445784960 gbpri24.seq
381564599 gbpri25.seq
343180411 gbpri26.seq
476587789 gbpri27.seq
474072403 gbpri28.seq
368094098 gbpri29.seq
499891275 gbpri3.seq
499998059 gbpri30.seq
73923753 gbpri31.seq
499936200 gbpri32.seq
445709575 gbpri33.seq
427947001 gbpri34.seq
376529642 gbpri35.seq
483909975 gbpri36.seq
361488390 gbpri37.seq
388660134 gbpri38.seq
448630862 gbpri39.seq
499855408 gbpri4.seq
499942041 gbpri40.seq
307422469 gbpri41.seq
314630532 gbpri42.seq
470160481 gbpri43.seq
368030827 gbpri44.seq
425225490 gbpri45.seq
474922500 gbpri46.seq
254728483 gbpri47.seq
434253471 gbpri48.seq
470466014 gbpri49.seq
499729176 gbpri5.seq
448364439 gbpri50.seq
281198579 gbpri51.seq
340509118 gbpri52.seq
417831330 gbpri53.seq
388737343 gbpri54.seq
460172605 gbpri55.seq
498945852 gbpri56.seq
425127193 gbpri57.seq
84915826 gbpri58.seq
499325712 gbpri59.seq
393528728 gbpri6.seq
481986671 gbpri60.seq
477279859 gbpri61.seq
486297556 gbpri62.seq
434085555 gbpri63.seq
486584425 gbpri64.seq
353370715 gbpri65.seq
333458839 gbpri66.seq
419262080 gbpri67.seq
486067692 gbpri68.seq
473340709 gbpri69.seq
499802910 gbpri7.seq
257299879 gbpri70.seq
500000080 gbpri71.seq
499986578 gbpri72.seq
235617103 gbpri73.seq
499999782 gbpri74.seq
499997086 gbpri75.seq
316411730 gbpri76.seq
499989738 gbpri77.seq
499999210 gbpri78.seq
328917948 gbpri79.seq
499984899 gbpri8.seq
258775295 gbpri80.seq
499996627 gbpri81.seq
499998772 gbpri82.seq
372268619 gbpri83.seq
499969779 gbpri84.seq
499986502 gbpri85.seq
499974586 gbpri86.seq
9963313 gbpri87.seq
499967070 gbpri9.seq
1435813 gbrel.txt
499951536 gbrod1.seq
499998574 gbrod10.seq
419878182 gbrod100.seq
403492494 gbrod101.seq
439526332 gbrod102.seq
248164111 gbrod103.seq
405939473 gbrod104.seq
384447340 gbrod105.seq
355679333 gbrod106.seq
497729616 gbrod107.seq
445498035 gbrod108.seq
466416387 gbrod109.seq
6033902 gbrod11.seq
384594494 gbrod110.seq
370764567 gbrod111.seq
352341932 gbrod112.seq
472534897 gbrod113.seq
442899850 gbrod114.seq
391247240 gbrod115.seq
302308728 gbrod116.seq
480858122 gbrod117.seq
424097302 gbrod118.seq
389168953 gbrod119.seq
499806176 gbrod12.seq
364557408 gbrod120.seq
496236266 gbrod121.seq
457035537 gbrod122.seq
397907216 gbrod123.seq
303919253 gbrod124.seq
472719372 gbrod125.seq
199611566 gbrod126.seq
379735208 gbrod127.seq
373874236 gbrod128.seq
492612107 gbrod129.seq
203924668 gbrod13.seq
455685049 gbrod130.seq
424015225 gbrod131.seq
422109961 gbrod132.seq
402489078 gbrod133.seq
150585215 gbrod134.seq
432875924 gbrod135.seq
473809988 gbrod136.seq
493341944 gbrod137.seq
369899434 gbrod138.seq
352286248 gbrod139.seq
499996808 gbrod14.seq
495134062 gbrod140.seq
469349893 gbrod141.seq
385134441 gbrod142.seq
370752989 gbrod143.seq
350782953 gbrod144.seq
472215298 gbrod145.seq
440418647 gbrod146.seq
390673256 gbrod147.seq
299732413 gbrod148.seq
469102685 gbrod149.seq
499997002 gbrod15.seq
389834819 gbrod150.seq
372942018 gbrod151.seq
357041751 gbrod152.seq
471802981 gbrod153.seq
442335356 gbrod154.seq
272062219 gbrod155.seq
421368094 gbrod156.seq
465159875 gbrod157.seq
385490257 gbrod158.seq
365814425 gbrod159.seq
499998793 gbrod16.seq
349038378 gbrod160.seq
318450016 gbrod161.seq
448518533 gbrod162.seq
413714740 gbrod163.seq
419290195 gbrod164.seq
466211866 gbrod165.seq
387893635 gbrod166.seq
186742583 gbrod167.seq
369103842 gbrod168.seq
487915723 gbrod169.seq
296354483 gbrod17.seq
450102561 gbrod170.seq
413892753 gbrod171.seq
419378521 gbrod172.seq
249506719 gbrod173.seq
431031986 gbrod174.seq
392811039 gbrod175.seq
374963024 gbrod176.seq
339853098 gbrod177.seq
465902366 gbrod178.seq
448509046 gbrod179.seq
416932044 gbrod18.seq
478088985 gbrod180.seq
74225189 gbrod181.seq
401026287 gbrod182.seq
438450513 gbrod183.seq
392223411 gbrod184.seq
298791488 gbrod185.seq
421037306 gbrod186.seq
377024222 gbrod187.seq
358182039 gbrod188.seq
498127194 gbrod189.seq
485622431 gbrod19.seq
395007403 gbrod190.seq
420940299 gbrod191.seq
420418108 gbrod192.seq
416033149 gbrod193.seq
371638158 gbrod194.seq
168940443 gbrod195.seq
344507393 gbrod196.seq
318954535 gbrod197.seq
344554082 gbrod198.seq
342695770 gbrod199.seq
499801667 gbrod2.seq
447177606 gbrod20.seq
464792186 gbrod200.seq
401018426 gbrod201.seq
244981400 gbrod202.seq
424020455 gbrod203.seq
445077763 gbrod204.seq
471066620 gbrod205.seq
463756029 gbrod206.seq
477523791 gbrod207.seq
429214893 gbrod208.seq
482809898 gbrod209.seq
401874104 gbrod21.seq
409881666 gbrod210.seq
499005744 gbrod211.seq
445425390 gbrod212.seq
453009972 gbrod213.seq
238222178 gbrod214.seq
433121687 gbrod215.seq
401444461 gbrod216.seq
355166120 gbrod217.seq
439733945 gbrod218.seq
399262915 gbrod219.seq
366906621 gbrod22.seq
343303814 gbrod220.seq
449604401 gbrod221.seq
373291356 gbrod222.seq
491021867 gbrod223.seq
411878942 gbrod224.seq
394783112 gbrod225.seq
354215147 gbrod226.seq
478827549 gbrod227.seq
464689320 gbrod228.seq
496457781 gbrod229.seq
178573599 gbrod23.seq
328639335 gbrod230.seq
429295912 gbrod231.seq
201904361 gbrod232.seq
381229576 gbrod233.seq
352252100 gbrod234.seq
483911001 gbrod235.seq
439271128 gbrod236.seq
432391884 gbrod237.seq
379422136 gbrod238.seq
487314628 gbrod239.seq
488460696 gbrod24.seq
424101431 gbrod240.seq
402251656 gbrod241.seq
377306384 gbrod242.seq
496030481 gbrod243.seq
476084602 gbrod244.seq
404173831 gbrod245.seq
121703297 gbrod246.seq
471718554 gbrod247.seq
429849644 gbrod248.seq
369205357 gbrod249.seq
424418862 gbrod25.seq
458471717 gbrod250.seq
410175604 gbrod251.seq
423146610 gbrod252.seq
172228268 gbrod253.seq
492401067 gbrod254.seq
487467397 gbrod255.seq
412574887 gbrod256.seq
371643290 gbrod257.seq
458445658 gbrod258.seq
395932157 gbrod259.seq
451727059 gbrod26.seq
429793810 gbrod260.seq
490297286 gbrod261.seq
410121996 gbrod262.seq
409184503 gbrod263.seq
367837774 gbrod264.seq
447381136 gbrod265.seq
223327565 gbrod266.seq
402425622 gbrod267.seq
448449857 gbrod268.seq
461815006 gbrod269.seq
499112036 gbrod27.seq
478700924 gbrod270.seq
408314221 gbrod271.seq
349093340 gbrod272.seq
455227074 gbrod273.seq
454883295 gbrod274.seq
483614724 gbrod275.seq
369373092 gbrod276.seq
442583968 gbrod277.seq
421061266 gbrod278.seq
196273488 gbrod279.seq
467946548 gbrod28.seq
350815101 gbrod280.seq
431195894 gbrod281.seq
436876327 gbrod282.seq
495700637 gbrod283.seq
383320388 gbrod284.seq
457101351 gbrod285.seq
410386577 gbrod286.seq
373894312 gbrod287.seq
447245565 gbrod288.seq
442554857 gbrod289.seq
425428799 gbrod29.seq
496529716 gbrod290.seq
438732151 gbrod291.seq
404017310 gbrod292.seq
417018539 gbrod293.seq
194574877 gbrod294.seq
493375331 gbrod295.seq
407058545 gbrod296.seq
420360712 gbrod297.seq
497137694 gbrod298.seq
376315111 gbrod299.seq
499860799 gbrod3.seq
380509124 gbrod30.seq
435156107 gbrod300.seq
487765053 gbrod301.seq
406428098 gbrod302.seq
448028858 gbrod303.seq
469164401 gbrod304.seq
471219154 gbrod305.seq
251509050 gbrod306.seq
303883779 gbrod307.seq
469719503 gbrod308.seq
386750689 gbrod309.seq
359291146 gbrod31.seq
495403498 gbrod310.seq
440414980 gbrod311.seq
405968892 gbrod312.seq
477306463 gbrod313.seq
337532140 gbrod314.seq
462256366 gbrod315.seq
415376279 gbrod316.seq
492229021 gbrod317.seq
123278654 gbrod318.seq
496959769 gbrod319.seq
441031541 gbrod32.seq
479839682 gbrod320.seq
488921167 gbrod321.seq
491723007 gbrod322.seq
280003390 gbrod323.seq
411886297 gbrod324.seq
462247794 gbrod325.seq
498359150 gbrod326.seq
488306432 gbrod327.seq
487425220 gbrod328.seq
493682332 gbrod329.seq
489661762 gbrod33.seq
493124496 gbrod330.seq
465223215 gbrod331.seq
454737651 gbrod332.seq
464631644 gbrod333.seq
472206295 gbrod334.seq
254113502 gbrod335.seq
439091843 gbrod336.seq
415353898 gbrod337.seq
369082913 gbrod338.seq
455254536 gbrod339.seq
301541840 gbrod34.seq
401064112 gbrod340.seq
431845684 gbrod341.seq
459347562 gbrod342.seq
162402725 gbrod343.seq
245696968 gbrod35.seq
444533522 gbrod36.seq
404901396 gbrod37.seq
350079181 gbrod38.seq
484303888 gbrod39.seq
499965631 gbrod4.seq
464197213 gbrod40.seq
475600609 gbrod41.seq
417011576 gbrod42.seq
368092577 gbrod43.seq
459234406 gbrod44.seq
385583012 gbrod45.seq
488265022 gbrod46.seq
434197329 gbrod47.seq
412800312 gbrod48.seq
454365663 gbrod49.seq
499960342 gbrod5.seq
382748472 gbrod50.seq
428038719 gbrod51.seq
487918369 gbrod52.seq
440586747 gbrod53.seq
359290553 gbrod54.seq
499999709 gbrod55.seq
307922789 gbrod56.seq
390007635 gbrod57.seq
346418766 gbrod58.seq
345548222 gbrod59.seq
80291490 gbrod6.seq
465925928 gbrod60.seq
403537722 gbrod61.seq
386823577 gbrod62.seq
403462511 gbrod63.seq
391812927 gbrod64.seq
346719868 gbrod65.seq
491742089 gbrod66.seq
445010312 gbrod67.seq
493387550 gbrod68.seq
300864949 gbrod69.seq
499846851 gbrod7.seq
466768965 gbrod70.seq
374387663 gbrod71.seq
350248940 gbrod72.seq
470230178 gbrod73.seq
465917437 gbrod74.seq
493546372 gbrod75.seq
164945760 gbrod76.seq
403745653 gbrod77.seq
436915885 gbrod78.seq
473498938 gbrod79.seq
499742719 gbrod8.seq
494867130 gbrod80.seq
353125249 gbrod81.seq
339090141 gbrod82.seq
372648418 gbrod83.seq
304437664 gbrod84.seq
466850317 gbrod85.seq
387285794 gbrod86.seq
374061084 gbrod87.seq
353646449 gbrod88.seq
160857005 gbrod89.seq
499945822 gbrod9.seq
461956462 gbrod90.seq
433837684 gbrod91.seq
474478559 gbrod92.seq
316311284 gbrod93.seq
418985554 gbrod94.seq
371050540 gbrod95.seq
363244189 gbrod96.seq
482685615 gbrod97.seq
448001147 gbrod98.seq
413360145 gbrod99.seq
499999658 gbsts1.seq
499999261 gbsts10.seq
433593483 gbsts11.seq
499999583 gbsts2.seq
38293156 gbsts3.seq
499998792 gbsts4.seq
499998127 gbsts5.seq
456725186 gbsts6.seq
499999303 gbsts7.seq
499999382 gbsts8.seq
21009609 gbsts9.seq
300842027 gbsyn1.seq
484840372 gbsyn10.seq
420813753 gbsyn11.seq
490139440 gbsyn12.seq
343340422 gbsyn13.seq
372527348 gbsyn14.seq
417861289 gbsyn15.seq
448312981 gbsyn16.seq
416378132 gbsyn17.seq
453065790 gbsyn18.seq
263307032 gbsyn19.seq
343340424 gbsyn2.seq
484840366 gbsyn20.seq
420813747 gbsyn21.seq
498979310 gbsyn22.seq
495655717 gbsyn23.seq
499996288 gbsyn24.seq
435006371 gbsyn25.seq
499993129 gbsyn26.seq
499997802 gbsyn27.seq
499998427 gbsyn28.seq
249085870 gbsyn29.seq
372527353 gbsyn3.seq
469645438 gbsyn30.seq
417861297 gbsyn4.seq
448312992 gbsyn5.seq
81377357 gbsyn6.seq
470781602 gbsyn7.seq
317285242 gbsyn8.seq
263307034 gbsyn9.seq
499999170 gbtsa1.seq
499997170 gbtsa10.seq
499997439 gbtsa100.seq
499999811 gbtsa101.seq
499996108 gbtsa102.seq
404671505 gbtsa103.seq
499996434 gbtsa104.seq
499998444 gbtsa105.seq
499998535 gbtsa106.seq
472601874 gbtsa107.seq
499998000 gbtsa108.seq
499995608 gbtsa109.seq
499999169 gbtsa11.seq
233503542 gbtsa110.seq
499991596 gbtsa111.seq
499999834 gbtsa112.seq
499999770 gbtsa113.seq
499998939 gbtsa114.seq
34150369 gbtsa115.seq
499995781 gbtsa116.seq
499999069 gbtsa117.seq
499994937 gbtsa118.seq
470659755 gbtsa119.seq
280571641 gbtsa12.seq
499998218 gbtsa120.seq
499998672 gbtsa121.seq
499999924 gbtsa122.seq
280313902 gbtsa123.seq
499999116 gbtsa124.seq
499998111 gbtsa125.seq
499999818 gbtsa126.seq
423256101 gbtsa127.seq
499996305 gbtsa13.seq
499999062 gbtsa14.seq
161780319 gbtsa15.seq
500000121 gbtsa16.seq
499994772 gbtsa17.seq
260516544 gbtsa18.seq
499998904 gbtsa19.seq
499999528 gbtsa2.seq
500000036 gbtsa20.seq
499995141 gbtsa21.seq
72460486 gbtsa22.seq
500000102 gbtsa23.seq
499998850 gbtsa24.seq
499999664 gbtsa25.seq
284712908 gbtsa26.seq
499999143 gbtsa27.seq
499999640 gbtsa28.seq
77188803 gbtsa29.seq
148639076 gbtsa3.seq
499999538 gbtsa30.seq
499998402 gbtsa31.seq
160181305 gbtsa32.seq
499998942 gbtsa33.seq
499997585 gbtsa34.seq
499998185 gbtsa35.seq
492954858 gbtsa36.seq
499999905 gbtsa37.seq
499998822 gbtsa38.seq
499996375 gbtsa39.seq
499998486 gbtsa4.seq
229182509 gbtsa40.seq
499997763 gbtsa41.seq
499999567 gbtsa42.seq
499999364 gbtsa43.seq
177582677 gbtsa44.seq
499998570 gbtsa45.seq
499998681 gbtsa46.seq
356101733 gbtsa47.seq
499999382 gbtsa48.seq
499999056 gbtsa49.seq
499998583 gbtsa5.seq
298479435 gbtsa50.seq
499997916 gbtsa51.seq
499999591 gbtsa52.seq
402924700 gbtsa53.seq
499999696 gbtsa54.seq
499997992 gbtsa55.seq
499998333 gbtsa56.seq
343934196 gbtsa57.seq
499999894 gbtsa58.seq
499999312 gbtsa59.seq
58524370 gbtsa6.seq
499996663 gbtsa60.seq
226876032 gbtsa61.seq
499998883 gbtsa62.seq
499998945 gbtsa63.seq
261554469 gbtsa64.seq
499999567 gbtsa65.seq
464262990 gbtsa66.seq
499998462 gbtsa67.seq
499999620 gbtsa68.seq
499998268 gbtsa69.seq
499998361 gbtsa7.seq
168770314 gbtsa70.seq
499997567 gbtsa71.seq
500000162 gbtsa72.seq
499998185 gbtsa73.seq
2512297 gbtsa74.seq
499998125 gbtsa75.seq
499999999 gbtsa76.seq
131338866 gbtsa77.seq
500000012 gbtsa78.seq
499999875 gbtsa79.seq
499999426 gbtsa8.seq
34997856 gbtsa80.seq
499999375 gbtsa81.seq
499997355 gbtsa82.seq
499996990 gbtsa83.seq
499997400 gbtsa84.seq
48843479 gbtsa85.seq
499997725 gbtsa86.seq
499999047 gbtsa87.seq
499998830 gbtsa88.seq
83128617 gbtsa89.seq
274552792 gbtsa9.seq
499998662 gbtsa90.seq
390370134 gbtsa91.seq
499998191 gbtsa92.seq
499994249 gbtsa93.seq
499998640 gbtsa94.seq
208350764 gbtsa95.seq
499999734 gbtsa96.seq
499998253 gbtsa97.seq
499996332 gbtsa98.seq
230879944 gbtsa99.seq
7316851 gbuna1.seq
499998709 gbvrl1.seq
315101551 gbvrl10.seq
499960060 gbvrl100.seq
499973423 gbvrl1000.se
433047615 gbvrl1001.se
499991710 gbvrl1002.se
499994036 gbvrl1003.se
499989401 gbvrl1004.se
499984663 gbvrl1005.se
83227543 gbvrl1006.se
499972477 gbvrl1007.se
499968473 gbvrl1008.se
499987568 gbvrl1009.se
499993674 gbvrl101.seq
499964281 gbvrl1010.se
101935477 gbvrl1011.se
499959573 gbvrl1012.se
499976239 gbvrl1013.se
499984409 gbvrl1014.se
369334715 gbvrl1015.se
499979245 gbvrl1016.se
499979721 gbvrl1017.se
499979821 gbvrl1018.se
499963429 gbvrl1019.se
202481508 gbvrl102.seq
160099447 gbvrl1020.se
499972227 gbvrl1021.se
499975329 gbvrl1022.se
499983189 gbvrl1023.se
499983490 gbvrl1024.se
499992002 gbvrl1025.se
103867249 gbvrl1026.se
499985908 gbvrl1027.se
499963642 gbvrl1028.se
499983539 gbvrl1029.se
499945861 gbvrl103.seq
500000000 gbvrl1030.se
307395367 gbvrl1031.se
499961016 gbvrl1032.se
499968835 gbvrl1033.se
499992120 gbvrl1034.se
324381302 gbvrl1035.se
499982522 gbvrl1036.se
499972967 gbvrl1037.se
499972756 gbvrl1038.se
499961382 gbvrl1039.se
499993489 gbvrl104.seq
499987423 gbvrl1040.se
178045189 gbvrl1041.se
499992266 gbvrl1042.se
499999515 gbvrl1043.se
499999971 gbvrl1044.se
185947857 gbvrl1045.se
499960835 gbvrl1046.se
499976145 gbvrl1047.se
499962382 gbvrl1048.se
499988045 gbvrl1049.se
499969143 gbvrl105.seq
435791362 gbvrl1050.se
499979538 gbvrl1051.se
499988396 gbvrl1052.se
499995815 gbvrl1053.se
499974470 gbvrl1054.se
267421335 gbvrl1055.se
499970207 gbvrl1056.se
499979885 gbvrl1057.se
499976341 gbvrl1058.se
499986328 gbvrl1059.se
252147323 gbvrl106.seq
499967623 gbvrl1060.se
99741919 gbvrl1061.se
499969024 gbvrl1062.se
499960580 gbvrl1063.se
499965049 gbvrl1064.se
168973421 gbvrl1065.se
499983495 gbvrl1066.se
499987107 gbvrl1067.se
499993791 gbvrl1068.se
499985099 gbvrl1069.se
499939986 gbvrl107.seq
499981273 gbvrl1070.se
323937529 gbvrl1071.se
499994108 gbvrl1072.se
499982446 gbvrl1073.se
499989804 gbvrl1074.se
351389973 gbvrl1075.se
499972426 gbvrl1076.se
499940245 gbvrl1077.se
499950871 gbvrl1078.se
267177707 gbvrl1079.se
499943109 gbvrl108.seq
499953146 gbvrl1080.se
499963515 gbvrl1081.se
499941705 gbvrl1082.se
138224635 gbvrl1083.se
499950125 gbvrl1084.se
499948105 gbvrl1085.se
499948669 gbvrl1086.se
147461231 gbvrl1087.se
499934073 gbvrl1088.se
499948866 gbvrl1089.se
499950409 gbvrl109.seq
499989129 gbvrl1090.se
151036225 gbvrl1091.se
499983400 gbvrl1092.se
499957290 gbvrl1093.se
499938584 gbvrl1094.se
370878098 gbvrl1095.se
500000240 gbvrl11.seq
447575200 gbvrl110.seq
499974451 gbvrl111.seq
499948725 gbvrl112.seq
499934036 gbvrl113.seq
147258184 gbvrl114.seq
499945893 gbvrl115.seq
499975442 gbvrl116.seq
499996356 gbvrl117.seq
499992767 gbvrl118.seq
11677548 gbvrl119.seq
499997810 gbvrl12.seq
499983254 gbvrl120.seq
499996166 gbvrl121.seq
499944146 gbvrl122.seq
261077215 gbvrl123.seq
499988967 gbvrl124.seq
499940262 gbvrl125.seq
499965475 gbvrl126.seq
499938069 gbvrl127.seq
10734996 gbvrl128.seq
499948680 gbvrl129.seq
499999454 gbvrl13.seq
499992082 gbvrl130.seq
499997878 gbvrl131.seq
499991585 gbvrl132.seq
317292776 gbvrl133.seq
499983054 gbvrl134.seq
500000248 gbvrl135.seq
499973059 gbvrl136.seq
499982774 gbvrl137.seq
499974584 gbvrl138.seq
230219843 gbvrl139.seq
167716575 gbvrl14.seq
499996809 gbvrl140.seq
499999895 gbvrl141.seq
499991400 gbvrl142.seq
325521675 gbvrl143.seq
499966066 gbvrl144.seq
499968818 gbvrl145.seq
499980029 gbvrl146.seq
301217569 gbvrl147.seq
499979028 gbvrl148.seq
499960001 gbvrl149.seq
499997304 gbvrl15.seq
499980815 gbvrl150.seq
188041568 gbvrl151.seq
499940481 gbvrl152.seq
499966248 gbvrl153.seq
499992697 gbvrl154.seq
499935005 gbvrl155.seq
263691398 gbvrl156.seq
499994928 gbvrl157.seq
499954320 gbvrl158.seq
499996427 gbvrl159.seq
499999037 gbvrl16.seq
240076943 gbvrl160.seq
499961866 gbvrl161.seq
499981491 gbvrl162.seq
499963979 gbvrl163.seq
499938599 gbvrl164.seq
268425091 gbvrl165.seq
499935212 gbvrl166.seq
499955895 gbvrl167.seq
499960906 gbvrl168.seq
499979556 gbvrl169.seq
137049682 gbvrl17.seq
230286107 gbvrl170.seq
499994101 gbvrl171.seq
499988195 gbvrl172.seq
499987737 gbvrl173.seq
338461002 gbvrl174.seq
499944059 gbvrl175.seq
499975871 gbvrl176.seq
499950142 gbvrl177.seq
135729438 gbvrl178.seq
499984458 gbvrl179.seq
499997218 gbvrl18.seq
499934404 gbvrl180.seq
499997472 gbvrl181.seq
154420332 gbvrl182.seq
499977523 gbvrl183.seq
499960236 gbvrl184.seq
499971922 gbvrl185.seq
493177685 gbvrl186.seq
499959914 gbvrl187.seq
499935842 gbvrl188.seq
499993010 gbvrl189.seq
499999346 gbvrl19.seq
499982922 gbvrl190.seq
7432721 gbvrl191.seq
499951054 gbvrl192.seq
499946701 gbvrl193.seq
499989336 gbvrl194.seq
177144588 gbvrl195.seq
499974446 gbvrl196.seq
499955314 gbvrl197.seq
499941593 gbvrl198.seq
499989411 gbvrl199.seq
499994531 gbvrl2.seq
321494786 gbvrl20.seq
268313859 gbvrl200.seq
499962119 gbvrl201.seq
500000195 gbvrl202.seq
499967693 gbvrl203.seq
499985526 gbvrl204.seq
282768194 gbvrl205.seq
499936813 gbvrl206.seq
499959861 gbvrl207.seq
499981132 gbvrl208.seq
499934353 gbvrl209.seq
499993685 gbvrl21.seq
313535749 gbvrl210.seq
499990914 gbvrl211.seq
499969757 gbvrl212.seq
499981840 gbvrl213.seq
499978639 gbvrl214.seq
286863642 gbvrl215.seq
499970217 gbvrl216.seq
499982382 gbvrl217.seq
499934014 gbvrl218.seq
499979769 gbvrl219.seq
499997946 gbvrl22.seq
270981379 gbvrl220.seq
499968524 gbvrl221.seq
499963328 gbvrl222.seq
499947249 gbvrl223.seq
499949383 gbvrl224.seq
284480367 gbvrl225.seq
499976696 gbvrl226.seq
499995974 gbvrl227.seq
499988986 gbvrl228.seq
499983848 gbvrl229.seq
348860042 gbvrl23.seq
284053962 gbvrl230.seq
499974800 gbvrl231.seq
499934452 gbvrl232.seq
499986826 gbvrl233.seq
499962069 gbvrl234.seq
274829487 gbvrl235.seq
499957628 gbvrl236.seq
499980000 gbvrl237.seq
499942312 gbvrl238.seq
499948683 gbvrl239.seq
499542547 gbvrl24.seq
239583375 gbvrl240.seq
499995448 gbvrl241.seq
499989671 gbvrl242.seq
499940863 gbvrl243.seq
499988564 gbvrl244.seq
263144370 gbvrl245.seq
499995908 gbvrl246.seq
499955463 gbvrl247.seq
499954338 gbvrl248.seq
499991527 gbvrl249.seq
499999556 gbvrl25.seq
264351405 gbvrl250.seq
499955591 gbvrl251.seq
499944449 gbvrl252.seq
499933908 gbvrl253.seq
499951872 gbvrl254.seq
264054649 gbvrl255.seq
499948469 gbvrl256.seq
499987219 gbvrl257.seq
499937055 gbvrl258.seq
137571832 gbvrl259.seq
373390942 gbvrl26.seq
499939737 gbvrl260.seq
499989905 gbvrl261.seq
499966479 gbvrl262.seq
146244699 gbvrl263.seq
499944789 gbvrl264.seq
499944834 gbvrl265.seq
499943615 gbvrl266.seq
499968688 gbvrl267.seq
499995153 gbvrl268.seq
499956558 gbvrl269.seq
499998781 gbvrl27.seq
245792518 gbvrl270.seq
499953049 gbvrl271.seq
499984245 gbvrl272.seq
499975210 gbvrl273.seq
499964471 gbvrl274.seq
254737531 gbvrl275.seq
499960063 gbvrl276.seq
499989044 gbvrl277.seq
499958758 gbvrl278.seq
499985868 gbvrl279.seq
499994073 gbvrl28.seq
262950858 gbvrl280.seq
499933463 gbvrl281.seq
499990210 gbvrl282.seq
499937855 gbvrl283.seq
499975099 gbvrl284.seq
421440261 gbvrl285.seq
499966811 gbvrl286.seq
499951871 gbvrl287.seq
499978481 gbvrl288.seq
166973409 gbvrl289.seq
317230695 gbvrl29.seq
499998709 gbvrl290.seq
499963901 gbvrl291.seq
499995678 gbvrl292.seq
228199220 gbvrl293.seq
499958490 gbvrl294.seq
499945382 gbvrl295.seq
499971991 gbvrl296.seq
309527775 gbvrl297.seq
499992351 gbvrl298.seq
499955523 gbvrl299.seq
499950855 gbvrl3.seq
499998521 gbvrl30.seq
499996214 gbvrl300.seq
269200727 gbvrl301.seq
499977417 gbvrl302.seq
499997321 gbvrl303.seq
499937572 gbvrl304.seq
372922730 gbvrl305.seq
499987362 gbvrl306.seq
499982413 gbvrl307.seq
499995917 gbvrl308.seq
386286627 gbvrl309.seq
499995753 gbvrl31.seq
499936519 gbvrl310.seq
499959053 gbvrl311.seq
499953918 gbvrl312.seq
499996492 gbvrl313.seq
25372997 gbvrl314.seq
499981164 gbvrl315.seq
499955514 gbvrl316.seq
499946943 gbvrl317.seq
270338506 gbvrl318.seq
499985846 gbvrl319.seq
499999392 gbvrl32.seq
499944255 gbvrl320.seq
499972554 gbvrl321.seq
248926802 gbvrl322.seq
499946216 gbvrl323.seq
499958815 gbvrl324.seq
499994043 gbvrl325.seq
165278419 gbvrl326.seq
500000212 gbvrl327.seq
499984560 gbvrl328.seq
499998230 gbvrl329.seq
393252273 gbvrl33.seq
499985409 gbvrl330.seq
70613227 gbvrl331.seq
499985499 gbvrl332.seq
499982271 gbvrl333.seq
499993251 gbvrl334.seq
464591304 gbvrl335.seq
499976156 gbvrl336.seq
499990464 gbvrl337.seq
499987091 gbvrl338.seq
499948902 gbvrl339.seq
499999796 gbvrl34.seq
2258854 gbvrl340.seq
499979084 gbvrl341.seq
499962681 gbvrl342.seq
499940572 gbvrl343.seq
499981323 gbvrl344.seq
147998614 gbvrl345.seq
499943070 gbvrl346.seq
499944766 gbvrl347.seq
499942420 gbvrl348.seq
191148406 gbvrl349.seq
499970215 gbvrl35.seq
499952125 gbvrl350.seq
499935590 gbvrl351.seq
499983793 gbvrl352.seq
452050881 gbvrl353.seq
499991371 gbvrl354.seq
499955764 gbvrl355.seq
499971769 gbvrl356.seq
223023780 gbvrl357.seq
499949824 gbvrl358.seq
499971871 gbvrl359.seq
435537627 gbvrl36.seq
499949989 gbvrl360.seq
361414694 gbvrl361.seq
499990916 gbvrl362.seq
499995464 gbvrl363.seq
499971597 gbvrl364.seq
499976672 gbvrl365.seq
155220943 gbvrl366.seq
499952542 gbvrl367.seq
499955497 gbvrl368.seq
499999095 gbvrl369.seq
499999439 gbvrl37.seq
495870890 gbvrl370.seq
499942082 gbvrl371.seq
499940276 gbvrl372.seq
499957958 gbvrl373.seq
498014116 gbvrl374.seq
499939715 gbvrl375.seq
499966453 gbvrl376.seq
499972030 gbvrl377.seq
278819141 gbvrl378.seq
499970229 gbvrl379.seq
499994039 gbvrl38.seq
499933929 gbvrl380.seq
499937932 gbvrl381.seq
261317507 gbvrl382.seq
499978082 gbvrl383.seq
499989797 gbvrl384.seq
499958618 gbvrl385.seq
239623278 gbvrl386.seq
499955437 gbvrl387.seq
499932923 gbvrl388.seq
499952426 gbvrl389.seq
434128562 gbvrl39.seq
300033077 gbvrl390.seq
499939610 gbvrl391.seq
499990831 gbvrl392.seq
499954389 gbvrl393.seq
223525698 gbvrl394.seq
499982849 gbvrl395.seq
499964734 gbvrl396.seq
499994484 gbvrl397.seq
164134330 gbvrl398.seq
499974380 gbvrl399.seq
499994737 gbvrl4.seq
499999975 gbvrl40.seq
499967172 gbvrl400.seq
499983764 gbvrl401.seq
233279768 gbvrl402.seq
499998133 gbvrl403.seq
499969645 gbvrl404.seq
499981161 gbvrl405.seq
459639371 gbvrl406.seq
499981973 gbvrl407.seq
499988975 gbvrl408.seq
499952154 gbvrl409.seq
499999652 gbvrl41.seq
417449228 gbvrl410.seq
499952366 gbvrl411.seq
499947781 gbvrl412.seq
499976782 gbvrl413.seq
189778502 gbvrl414.seq
499938260 gbvrl415.seq
499958380 gbvrl416.seq
499962146 gbvrl417.seq
243596282 gbvrl418.seq
499964907 gbvrl419.seq
499998541 gbvrl42.seq
499964037 gbvrl420.seq
499961633 gbvrl421.seq
210812954 gbvrl422.seq
499935634 gbvrl423.seq
499994653 gbvrl424.seq
499951257 gbvrl425.seq
405670791 gbvrl426.seq
499940071 gbvrl427.seq
499953362 gbvrl428.seq
499989873 gbvrl429.seq
333172249 gbvrl43.seq
298659363 gbvrl430.seq
499978636 gbvrl431.seq
499937999 gbvrl432.seq
499954499 gbvrl433.seq
381587577 gbvrl434.seq
499948773 gbvrl435.seq
499974560 gbvrl436.seq
499987664 gbvrl437.seq
499936188 gbvrl438.seq
122532330 gbvrl439.seq
499961651 gbvrl44.seq
499959870 gbvrl440.seq
499972252 gbvrl441.seq
499950224 gbvrl442.seq
215469384 gbvrl443.seq
499962495 gbvrl444.seq
499990220 gbvrl445.seq
499972879 gbvrl446.seq
499997229 gbvrl447.seq
499961172 gbvrl448.seq
404986875 gbvrl449.seq
499936850 gbvrl45.seq
499999517 gbvrl450.seq
499982001 gbvrl451.seq
499969047 gbvrl452.seq
283619401 gbvrl453.seq
499996811 gbvrl454.seq
499933775 gbvrl455.seq
499968967 gbvrl456.seq
167625455 gbvrl457.seq
499991514 gbvrl458.seq
499992775 gbvrl459.seq
499997400 gbvrl46.seq
499999682 gbvrl460.seq
383391915 gbvrl461.seq
499966375 gbvrl462.seq
499970705 gbvrl463.seq
499955338 gbvrl464.seq
499938017 gbvrl465.seq
277265009 gbvrl466.seq
499944560 gbvrl467.seq
499944209 gbvrl468.seq
499968905 gbvrl469.seq
301450954 gbvrl47.seq
278052258 gbvrl470.seq
499986263 gbvrl471.seq
499939347 gbvrl472.seq
499981503 gbvrl473.seq
342380719 gbvrl474.seq
499940624 gbvrl475.seq
499998377 gbvrl476.seq
499993004 gbvrl477.seq
279331205 gbvrl478.seq
499956561 gbvrl479.seq
499954241 gbvrl48.seq
499968177 gbvrl480.seq
499963215 gbvrl481.seq
288859301 gbvrl482.seq
499976210 gbvrl483.seq
499979350 gbvrl484.seq
499934314 gbvrl485.seq
456853619 gbvrl486.seq
499940801 gbvrl487.seq
499988101 gbvrl488.seq
499978269 gbvrl489.seq
499964951 gbvrl49.seq
467706496 gbvrl490.seq
499939547 gbvrl491.seq
499965483 gbvrl492.seq
499943235 gbvrl493.seq
499973615 gbvrl494.seq
499957431 gbvrl495.seq
499960289 gbvrl496.seq
237908298 gbvrl497.seq
499984330 gbvrl498.seq
499975511 gbvrl499.seq
29746641 gbvrl5.seq
499995191 gbvrl50.seq
499990329 gbvrl500.seq
499977720 gbvrl501.seq
265470593 gbvrl502.seq
499985431 gbvrl503.seq
499948308 gbvrl504.seq
499952291 gbvrl505.seq
276224301 gbvrl506.seq
499990299 gbvrl507.seq
499970079 gbvrl508.seq
499958122 gbvrl509.seq
358230706 gbvrl51.seq
191675526 gbvrl510.seq
499998053 gbvrl511.seq
499975456 gbvrl512.seq
499969677 gbvrl513.seq
223680995 gbvrl514.seq
499994831 gbvrl515.seq
499990971 gbvrl516.seq
499952965 gbvrl517.seq
236510773 gbvrl518.seq
499997342 gbvrl519.seq
499932352 gbvrl52.seq
499992676 gbvrl520.seq
499960476 gbvrl521.seq
499940733 gbvrl522.seq
335774034 gbvrl523.seq
499983561 gbvrl524.seq
499970651 gbvrl525.seq
499995466 gbvrl526.seq
499993247 gbvrl527.seq
337438355 gbvrl528.seq
499985815 gbvrl529.seq
499983780 gbvrl53.seq
499953105 gbvrl530.seq
499990320 gbvrl531.seq
499954778 gbvrl532.seq
430539109 gbvrl533.seq
499998722 gbvrl534.seq
499948737 gbvrl535.seq
499990702 gbvrl536.seq
313562965 gbvrl537.seq
499938269 gbvrl538.seq
499721036 gbvrl539.seq
499943600 gbvrl54.seq
499982520 gbvrl540.seq
352222044 gbvrl541.seq
499995454 gbvrl542.seq
499985917 gbvrl543.seq
499956693 gbvrl544.seq
499944267 gbvrl545.seq
182146090 gbvrl546.seq
499955729 gbvrl547.seq
499963180 gbvrl548.seq
499962896 gbvrl549.seq
286857001 gbvrl55.seq
230213600 gbvrl550.seq
499933944 gbvrl551.seq
499944546 gbvrl552.seq
499957784 gbvrl553.seq
310820035 gbvrl554.seq
499943510 gbvrl555.seq
499940746 gbvrl556.seq
499955231 gbvrl557.seq
222164817 gbvrl558.seq
499973452 gbvrl559.seq
499975594 gbvrl56.seq
499992215 gbvrl560.seq
499943014 gbvrl561.seq
208236533 gbvrl562.seq
499952641 gbvrl563.seq
499961096 gbvrl564.seq
499967663 gbvrl565.seq
169962842 gbvrl566.seq
499965997 gbvrl567.seq
499989281 gbvrl568.seq
499952517 gbvrl569.seq
499971983 gbvrl57.seq
205382902 gbvrl570.seq
499938615 gbvrl571.seq
499981459 gbvrl572.seq
499847703 gbvrl573.seq
295900745 gbvrl574.seq
499951593 gbvrl575.seq
499767292 gbvrl576.seq
499989893 gbvrl577.seq
383761833 gbvrl578.seq
499978313 gbvrl579.seq
499997564 gbvrl58.seq
499956035 gbvrl580.seq
499975509 gbvrl581.seq
200589528 gbvrl582.seq
499970512 gbvrl583.seq
499998251 gbvrl584.seq
499963675 gbvrl585.seq
410802803 gbvrl586.seq
499958557 gbvrl587.seq
499963814 gbvrl588.seq
499959083 gbvrl589.seq
499980187 gbvrl59.seq
499976548 gbvrl590.seq
18237001 gbvrl591.seq
499949937 gbvrl592.seq
499995778 gbvrl593.seq
499994397 gbvrl594.seq
177744339 gbvrl595.seq
499996441 gbvrl596.seq
499962523 gbvrl597.seq
499997156 gbvrl598.seq
415265294 gbvrl599.seq
499998593 gbvrl6.seq
197971901 gbvrl60.seq
499964999 gbvrl600.seq
499975298 gbvrl601.seq
499967689 gbvrl602.seq
487505195 gbvrl603.seq
499940114 gbvrl604.seq
499959019 gbvrl605.seq
499989590 gbvrl606.seq
499968409 gbvrl607.seq
97055455 gbvrl608.seq
499992464 gbvrl609.seq
499962764 gbvrl61.seq
499935695 gbvrl610.seq
499938694 gbvrl611.seq
142720242 gbvrl612.seq
499935370 gbvrl613.seq
499990083 gbvrl614.seq
499932723 gbvrl615.seq
206401101 gbvrl616.seq
499954425 gbvrl617.seq
499949299 gbvrl618.seq
499979455 gbvrl619.seq
499998190 gbvrl62.seq
192985326 gbvrl620.seq
499998347 gbvrl621.seq
499934746 gbvrl622.seq
499988996 gbvrl623.seq
156730832 gbvrl624.seq
499976555 gbvrl625.seq
499936098 gbvrl626.seq
499980528 gbvrl627.seq
187211567 gbvrl628.seq
499947021 gbvrl629.seq
499958865 gbvrl63.seq
499965816 gbvrl630.seq
499968619 gbvrl631.seq
499962582 gbvrl632.seq
149029027 gbvrl633.seq
492738925 gbvrl634.seq
499973021 gbvrl635.seq
253869488 gbvrl636.seq
76815845 gbvrl637.seq
499979979 gbvrl638.seq
499965262 gbvrl639.seq
499969699 gbvrl64.seq
499992805 gbvrl640.seq
252210177 gbvrl641.seq
499979104 gbvrl642.seq
499999809 gbvrl643.seq
499964201 gbvrl644.seq
280382976 gbvrl645.seq
499973547 gbvrl646.seq
499964780 gbvrl647.seq
499974018 gbvrl648.seq
175135386 gbvrl649.seq
186644611 gbvrl65.seq
499973309 gbvrl650.seq
499989608 gbvrl651.seq
499960757 gbvrl652.seq
147804991 gbvrl653.seq
499996522 gbvrl654.seq
499971122 gbvrl655.seq
499973686 gbvrl656.seq
259661349 gbvrl657.seq
499963274 gbvrl658.seq
499968852 gbvrl659.seq
499959229 gbvrl66.seq
499994020 gbvrl660.seq
141758832 gbvrl661.seq
499987428 gbvrl662.seq
499986183 gbvrl663.seq
499970029 gbvrl664.seq
119837707 gbvrl665.seq
146296175 gbvrl666.seq
499967013 gbvrl667.seq
499996633 gbvrl668.seq
499970769 gbvrl669.seq
499989237 gbvrl67.seq
126388437 gbvrl670.seq
499995120 gbvrl671.seq
499972873 gbvrl672.seq
499969488 gbvrl673.seq
471353671 gbvrl674.seq
499967731 gbvrl675.seq
499981503 gbvrl676.seq
499966252 gbvrl677.seq
148206664 gbvrl678.seq
499995662 gbvrl679.seq
499993800 gbvrl68.seq
499985048 gbvrl680.seq
499985400 gbvrl681.seq
363308908 gbvrl682.seq
499975349 gbvrl683.seq
499995044 gbvrl684.seq
499982421 gbvrl685.seq
499984336 gbvrl686.seq
281596540 gbvrl687.seq
499978306 gbvrl688.seq
499974491 gbvrl689.seq
499995138 gbvrl69.seq
499971452 gbvrl690.seq
499960503 gbvrl691.seq
56386242 gbvrl692.seq
499993829 gbvrl693.seq
499998290 gbvrl694.seq
499998944 gbvrl695.seq
404134109 gbvrl696.seq
499976158 gbvrl697.seq
499992691 gbvrl698.seq
499970768 gbvrl699.seq
499999106 gbvrl7.seq
154635809 gbvrl70.seq
358552958 gbvrl700.seq
499994976 gbvrl701.seq
499995631 gbvrl702.seq
499993106 gbvrl703.seq
247357210 gbvrl704.seq
499986293 gbvrl705.seq
499984816 gbvrl706.seq
499967239 gbvrl707.seq
314635508 gbvrl708.seq
499961396 gbvrl709.seq
499950078 gbvrl71.seq
499984158 gbvrl710.seq
499986788 gbvrl711.seq
288025255 gbvrl712.seq
499970230 gbvrl713.seq
499981579 gbvrl714.seq
499998615 gbvrl715.seq
285158648 gbvrl716.seq
499967026 gbvrl717.seq
499980568 gbvrl718.seq
499961738 gbvrl719.seq
499970728 gbvrl72.seq
291559508 gbvrl720.seq
499973581 gbvrl721.seq
499977906 gbvrl722.seq
499972170 gbvrl723.seq
289138070 gbvrl724.seq
499966396 gbvrl725.seq
499987226 gbvrl726.seq
499974314 gbvrl727.seq
280112559 gbvrl728.seq
499989154 gbvrl729.seq
499936161 gbvrl73.seq
499975570 gbvrl730.seq
499962760 gbvrl731.seq
499988688 gbvrl732.seq
137977402 gbvrl733.seq
499991812 gbvrl734.seq
499998884 gbvrl735.seq
499998440 gbvrl736.seq
499965827 gbvrl737.seq
78679008 gbvrl738.seq
499970339 gbvrl739.seq
411246285 gbvrl74.seq
499996499 gbvrl740.seq
499984600 gbvrl741.seq
499965087 gbvrl742.seq
98844236 gbvrl743.seq
499992259 gbvrl744.seq
499990217 gbvrl745.seq
499966023 gbvrl746.seq
118505686 gbvrl747.seq
499988359 gbvrl748.seq
499970326 gbvrl749.seq
499940609 gbvrl75.seq
499999323 gbvrl750.seq
128891738 gbvrl751.seq
499961344 gbvrl752.seq
499965246 gbvrl753.seq
499963743 gbvrl754.seq
129520828 gbvrl755.seq
499989649 gbvrl756.seq
499990091 gbvrl757.seq
499993045 gbvrl758.seq
499997622 gbvrl759.seq
499986038 gbvrl76.seq
154992715 gbvrl760.seq
499990389 gbvrl761.seq
499997500 gbvrl762.seq
499978686 gbvrl763.seq
259989341 gbvrl764.seq
499978661 gbvrl765.seq
499961935 gbvrl766.seq
499976715 gbvrl767.seq
499974967 gbvrl768.seq
315477211 gbvrl769.seq
499990092 gbvrl77.seq
499978445 gbvrl770.seq
499985683 gbvrl771.seq
499975835 gbvrl772.seq
400008726 gbvrl773.seq
499960836 gbvrl774.seq
499971777 gbvrl775.seq
499983297 gbvrl776.seq
499998600 gbvrl777.seq
499963451 gbvrl778.seq
499965104 gbvrl779.seq
362638423 gbvrl78.seq
128009138 gbvrl780.seq
499998201 gbvrl781.seq
499994429 gbvrl782.seq
499974041 gbvrl783.seq
499966031 gbvrl784.seq
499992532 gbvrl785.seq
478191694 gbvrl786.seq
499977958 gbvrl787.seq
499968023 gbvrl788.seq
500000199 gbvrl789.seq
499999421 gbvrl79.seq
499961570 gbvrl790.seq
392138866 gbvrl791.seq
499987579 gbvrl792.seq
499987807 gbvrl793.seq
499979629 gbvrl794.seq
499962956 gbvrl795.seq
81093847 gbvrl796.seq
499970748 gbvrl797.seq
499963974 gbvrl798.seq
499989137 gbvrl799.seq
499998810 gbvrl8.seq
499947431 gbvrl80.seq
499992926 gbvrl800.seq
499966380 gbvrl801.seq
326924656 gbvrl802.seq
499967744 gbvrl803.seq
499988602 gbvrl804.seq
499970539 gbvrl805.seq
499992754 gbvrl806.seq
368120436 gbvrl807.seq
499961814 gbvrl808.seq
499975293 gbvrl809.seq
499984160 gbvrl81.seq
499964890 gbvrl810.seq
499986361 gbvrl811.seq
24043791 gbvrl812.seq
499969458 gbvrl813.seq
499992114 gbvrl814.seq
499979236 gbvrl815.seq
499988026 gbvrl816.seq
22590184 gbvrl817.seq
499988892 gbvrl818.seq
499958582 gbvrl819.seq
326609834 gbvrl82.seq
499998891 gbvrl820.seq
499984766 gbvrl821.seq
46828118 gbvrl822.seq
499995703 gbvrl823.seq
499968334 gbvrl824.seq
499993852 gbvrl825.seq
499996602 gbvrl826.seq
10933612 gbvrl827.seq
499984317 gbvrl828.seq
499959785 gbvrl829.seq
499995550 gbvrl83.seq
499997386 gbvrl830.seq
242993684 gbvrl831.seq
499985905 gbvrl832.seq
499960615 gbvrl833.seq
499973456 gbvrl834.seq
499990857 gbvrl835.seq
52232764 gbvrl836.seq
499964490 gbvrl837.seq
499964464 gbvrl838.seq
500000082 gbvrl839.seq
499938641 gbvrl84.seq
499999836 gbvrl840.seq
59983696 gbvrl841.seq
499995720 gbvrl842.seq
499998218 gbvrl843.seq
499975379 gbvrl844.seq
191184922 gbvrl845.seq
499990027 gbvrl846.seq
499998072 gbvrl847.seq
499964642 gbvrl848.seq
187063445 gbvrl849.seq
499973290 gbvrl85.seq
499995967 gbvrl850.seq
499977928 gbvrl851.seq
499991686 gbvrl852.seq
194078795 gbvrl853.seq
499980969 gbvrl854.seq
499982179 gbvrl855.seq
499989763 gbvrl856.seq
223834918 gbvrl857.seq
499984500 gbvrl858.seq
499973318 gbvrl859.seq
45085591 gbvrl86.seq
499970794 gbvrl860.seq
224405807 gbvrl861.seq
499994221 gbvrl862.seq
499964420 gbvrl863.seq
499989233 gbvrl864.seq
191992835 gbvrl865.seq
499979086 gbvrl866.seq
499980339 gbvrl867.seq
499975396 gbvrl868.seq
197260979 gbvrl869.seq
499969660 gbvrl87.seq
499967952 gbvrl870.seq
499999616 gbvrl871.seq
499989909 gbvrl872.seq
499994460 gbvrl873.seq
499971439 gbvrl874.seq
210537192 gbvrl875.seq
499994396 gbvrl876.seq
499960629 gbvrl877.seq
499988409 gbvrl878.seq
373194307 gbvrl879.seq
499938360 gbvrl88.seq
499970312 gbvrl880.seq
499995829 gbvrl881.seq
499993275 gbvrl882.seq
117606948 gbvrl883.seq
499985783 gbvrl884.seq
499999955 gbvrl885.seq
499997938 gbvrl886.seq
307125894 gbvrl887.seq
499969220 gbvrl888.seq
499999878 gbvrl889.seq
499982877 gbvrl89.seq
499993728 gbvrl890.seq
499998249 gbvrl891.seq
499964927 gbvrl892.seq
499968844 gbvrl893.seq
78929220 gbvrl894.seq
499973254 gbvrl895.seq
499969713 gbvrl896.seq
499969563 gbvrl897.seq
286738372 gbvrl898.seq
499965605 gbvrl899.seq
500000019 gbvrl9.seq
185102130 gbvrl90.seq
499984803 gbvrl900.seq
499981918 gbvrl901.seq
499964944 gbvrl902.seq
190811873 gbvrl903.seq
499983057 gbvrl904.seq
499961583 gbvrl905.seq
499995798 gbvrl906.seq
499984248 gbvrl907.seq
148129947 gbvrl908.seq
499962549 gbvrl909.seq
499995877 gbvrl91.seq
499994082 gbvrl910.seq
499988751 gbvrl911.seq
499972397 gbvrl912.seq
499984666 gbvrl913.seq
1810975 gbvrl914.seq
499959094 gbvrl915.seq
499983038 gbvrl916.seq
499992901 gbvrl917.seq
422170540 gbvrl918.seq
499975132 gbvrl919.seq
499959550 gbvrl92.seq
499995567 gbvrl920.seq
499995290 gbvrl921.seq
199372111 gbvrl922.seq
499993381 gbvrl923.seq
499985259 gbvrl924.seq
499997469 gbvrl925.seq
156460575 gbvrl926.seq
499959332 gbvrl927.seq
499968902 gbvrl928.seq
499993349 gbvrl929.seq
499954432 gbvrl93.seq
499966660 gbvrl930.seq
400354661 gbvrl931.seq
499959638 gbvrl932.seq
499980583 gbvrl933.seq
499990051 gbvrl934.seq
499973318 gbvrl935.seq
344871922 gbvrl936.seq
499974503 gbvrl937.seq
499967581 gbvrl938.seq
500000188 gbvrl939.seq
193598966 gbvrl94.seq
266779067 gbvrl940.seq
499973862 gbvrl941.seq
499988498 gbvrl942.seq
499971868 gbvrl943.seq
154951226 gbvrl944.seq
499974801 gbvrl945.seq
499970831 gbvrl946.seq
499961802 gbvrl947.seq
499987483 gbvrl948.seq
499964777 gbvrl949.seq
499969181 gbvrl95.seq
499980832 gbvrl950.seq
111556145 gbvrl951.seq
499971178 gbvrl952.seq
499975894 gbvrl953.seq
499993408 gbvrl954.seq
499982950 gbvrl955.seq
499962062 gbvrl956.seq
499993473 gbvrl957.seq
110227900 gbvrl958.seq
499977953 gbvrl959.seq
499987352 gbvrl96.seq
499988439 gbvrl960.seq
499990785 gbvrl961.seq
499994288 gbvrl962.seq
499964929 gbvrl963.seq
499972152 gbvrl964.seq
166666603 gbvrl965.seq
499973060 gbvrl966.seq
499976784 gbvrl967.seq
499975843 gbvrl968.seq
499994641 gbvrl969.seq
499956176 gbvrl97.seq
333937173 gbvrl970.seq
499993852 gbvrl971.seq
499995349 gbvrl972.seq
499974111 gbvrl973.seq
499988841 gbvrl974.seq
318630320 gbvrl975.seq
499993744 gbvrl976.seq
499965435 gbvrl977.seq
499982504 gbvrl978.seq
499977584 gbvrl979.seq
230194956 gbvrl98.seq
481610372 gbvrl980.seq
499980908 gbvrl981.seq
499998043 gbvrl982.seq
499975412 gbvrl983.seq
499973714 gbvrl984.seq
48125717 gbvrl985.seq
499986783 gbvrl986.seq
499964953 gbvrl987.seq
499987753 gbvrl988.seq
153956903 gbvrl989.seq
499988530 gbvrl99.seq
499968881 gbvrl990.seq
499973548 gbvrl991.seq
499968822 gbvrl992.seq
339023301 gbvrl993.seq
499987569 gbvrl994.seq
499981580 gbvrl995.seq
499997631 gbvrl996.seq
274621927 gbvrl997.seq
499968003 gbvrl998.seq
499997675 gbvrl999.seq
499976231 gbvrt1.seq
290137512 gbvrt10.seq
319264825 gbvrt100.seq
275756310 gbvrt101.seq
252640764 gbvrt102.seq
251496346 gbvrt103.seq
466369517 gbvrt104.seq
418722221 gbvrt105.seq
186091499 gbvrt106.seq
404212771 gbvrt107.seq
481131818 gbvrt108.seq
474827268 gbvrt109.seq
87351606 gbvrt11.seq
480710663 gbvrt110.seq
89576281 gbvrt111.seq
435880707 gbvrt112.seq
487966706 gbvrt113.seq
497561524 gbvrt114.seq
468911725 gbvrt115.seq
1063697373 gbvrt116.seq
1045817456 gbvrt117.seq
754876698 gbvrt118.seq
616753988 gbvrt119.seq
499800119 gbvrt12.seq
490283916 gbvrt120.seq
470651151 gbvrt121.seq
397152890 gbvrt122.seq
351566814 gbvrt123.seq
339881554 gbvrt124.seq
404716166 gbvrt125.seq
489465929 gbvrt126.seq
499108511 gbvrt127.seq
486719349 gbvrt128.seq
58362562 gbvrt129.seq
284674796 gbvrt13.seq
436489699 gbvrt130.seq
486735687 gbvrt131.seq
492786702 gbvrt132.seq
424170309 gbvrt133.seq
281367593 gbvrt134.seq
478264522 gbvrt135.seq
485840122 gbvrt136.seq
493662272 gbvrt137.seq
75046811 gbvrt138.seq
979125221 gbvrt139.seq
15637437 gbvrt14.seq
838606764 gbvrt140.seq
678362247 gbvrt141.seq
476490051 gbvrt142.seq
461393141 gbvrt143.seq
438814149 gbvrt144.seq
394334276 gbvrt145.seq
313818221 gbvrt146.seq
288999697 gbvrt147.seq
280186115 gbvrt148.seq
407765043 gbvrt149.seq
36035214 gbvrt15.seq
421853258 gbvrt150.seq
478932645 gbvrt151.seq
480028007 gbvrt152.seq
438022009 gbvrt153.seq
174441466 gbvrt154.seq
487902327 gbvrt155.seq
456814552 gbvrt156.seq
462308829 gbvrt157.seq
168813991 gbvrt158.seq
455915969 gbvrt159.seq
18509260 gbvrt16.seq
469542169 gbvrt160.seq
479148432 gbvrt161.seq
211438035 gbvrt162.seq
481255007 gbvrt163.seq
475910680 gbvrt164.seq
366785231 gbvrt165.seq
464881586 gbvrt166.seq
474452025 gbvrt167.seq
234874130 gbvrt168.seq
697335450 gbvrt169.seq
497676963 gbvrt17.seq
670835803 gbvrt170.seq
524090553 gbvrt171.seq
413420126 gbvrt172.seq
345317144 gbvrt173.seq
329841089 gbvrt174.seq
250750417 gbvrt175.seq
486600390 gbvrt176.seq
364885711 gbvrt177.seq
448395879 gbvrt178.seq
471877569 gbvrt179.seq
497173924 gbvrt18.seq
393642536 gbvrt180.seq
355134416 gbvrt181.seq
470602746 gbvrt182.seq
448657488 gbvrt183.seq
384724558 gbvrt184.seq
432320923 gbvrt185.seq
471604977 gbvrt186.seq
497676594 gbvrt187.seq
207882210 gbvrt188.seq
397267013 gbvrt189.seq
481350583 gbvrt19.seq
366771863 gbvrt190.seq
351249970 gbvrt191.seq
309532358 gbvrt192.seq
296271444 gbvrt193.seq
286321426 gbvrt194.seq
268164730 gbvrt195.seq
253329800 gbvrt196.seq
494939336 gbvrt197.seq
424426418 gbvrt198.seq
410896883 gbvrt199.seq
499844039 gbvrt2.seq
400795564 gbvrt20.seq
369957025 gbvrt200.seq
169574120 gbvrt201.seq
426847158 gbvrt202.seq
496824472 gbvrt203.seq
434394575 gbvrt204.seq
494362940 gbvrt205.seq
61896390 gbvrt206.seq
431425030 gbvrt207.seq
474666078 gbvrt208.seq
479195533 gbvrt209.seq
488197715 gbvrt21.seq
352877912 gbvrt210.seq
479777961 gbvrt211.seq
497464627 gbvrt212.seq
432868094 gbvrt213.seq
439843808 gbvrt214.seq
469531790 gbvrt215.seq
496015817 gbvrt216.seq
488626307 gbvrt217.seq
432135676 gbvrt218.seq
70119528 gbvrt219.seq
479291185 gbvrt22.seq
491056051 gbvrt220.seq
328508705 gbvrt221.seq
497328806 gbvrt222.seq
499238966 gbvrt223.seq
187508760 gbvrt224.seq
490842556 gbvrt225.seq
463385772 gbvrt226.seq
446788975 gbvrt227.seq
438416202 gbvrt228.seq
170595769 gbvrt229.seq
480798341 gbvrt23.seq
451342688 gbvrt230.seq
474563355 gbvrt231.seq
461335548 gbvrt232.seq
436658187 gbvrt233.seq
154682616 gbvrt234.seq
456837606 gbvrt235.seq
488930196 gbvrt236.seq
466502331 gbvrt237.seq
455725140 gbvrt238.seq
453475816 gbvrt239.seq
499274582 gbvrt24.seq
462276007 gbvrt240.seq
497473221 gbvrt241.seq
499283767 gbvrt242.seq
481742871 gbvrt243.seq
54779872 gbvrt244.seq
477445338 gbvrt245.seq
495314530 gbvrt246.seq
486008997 gbvrt247.seq
489201368 gbvrt248.seq
499536480 gbvrt249.seq
483255310 gbvrt25.seq
347470388 gbvrt250.seq
1068402516 gbvrt251.seq
1067356333 gbvrt252.seq
896844819 gbvrt253.seq
805318347 gbvrt254.seq
718662677 gbvrt255.seq
556944666 gbvrt256.seq
299728838 gbvrt257.seq
293507186 gbvrt258.seq
484357811 gbvrt259.seq
484154141 gbvrt26.seq
130768604 gbvrt260.seq
874873715 gbvrt261.seq
685858825 gbvrt262.seq
627564227 gbvrt263.seq
610271897 gbvrt264.seq
543871783 gbvrt265.seq
284797667 gbvrt266.seq
269299175 gbvrt267.seq
474717664 gbvrt268.seq
402979396 gbvrt269.seq
65325644 gbvrt27.seq
343325815 gbvrt270.seq
450550965 gbvrt271.seq
494368803 gbvrt272.seq
470719618 gbvrt273.seq
470514883 gbvrt274.seq
229726934 gbvrt275.seq
500000129 gbvrt276.seq
499998950 gbvrt277.seq
499998793 gbvrt278.seq
29493255 gbvrt279.seq
437233554 gbvrt28.seq
499997750 gbvrt280.seq
499998227 gbvrt281.seq
499997740 gbvrt282.seq
283794002 gbvrt283.seq
445682876 gbvrt284.seq
474231618 gbvrt285.seq
490948606 gbvrt286.seq
332589082 gbvrt287.seq
477156039 gbvrt288.seq
499226352 gbvrt289.seq
488520688 gbvrt29.seq
477696169 gbvrt290.seq
353039605 gbvrt291.seq
438196164 gbvrt292.seq
489809255 gbvrt293.seq
460938782 gbvrt294.seq
425935803 gbvrt295.seq
463058640 gbvrt296.seq
486385420 gbvrt297.seq
437842391 gbvrt298.seq
440417012 gbvrt299.seq
467954433 gbvrt3.seq
456456384 gbvrt30.seq
475637321 gbvrt300.seq
477247535 gbvrt301.seq
464765084 gbvrt302.seq
442158629 gbvrt303.seq
490038950 gbvrt304.seq
437760826 gbvrt305.seq
442760644 gbvrt306.seq
386023782 gbvrt307.seq
474714280 gbvrt308.seq
485233797 gbvrt309.seq
337132552 gbvrt31.seq
481701496 gbvrt310.seq
437638720 gbvrt311.seq
484571077 gbvrt312.seq
497401344 gbvrt313.seq
473482376 gbvrt314.seq
467112365 gbvrt315.seq
171814162 gbvrt316.seq
85205330 gbvrt317.seq
671198197 gbvrt318.seq
590897252 gbvrt319.seq
446089299 gbvrt32.seq
569239246 gbvrt320.seq
521483379 gbvrt321.seq
518191557 gbvrt322.seq
413907798 gbvrt323.seq
491950349 gbvrt324.seq
443427082 gbvrt325.seq
399672190 gbvrt326.seq
288573149 gbvrt327.seq
447682143 gbvrt328.seq
458968414 gbvrt329.seq
379213975 gbvrt33.seq
489671978 gbvrt330.seq
498333218 gbvrt331.seq
249806054 gbvrt332.seq
449206571 gbvrt333.seq
492547884 gbvrt334.seq
481880513 gbvrt335.seq
498774154 gbvrt336.seq
111733219 gbvrt337.seq
436873334 gbvrt338.seq
440148969 gbvrt339.seq
458139031 gbvrt34.seq
482571941 gbvrt340.seq
484107234 gbvrt341.seq
52095057 gbvrt342.seq
470800028 gbvrt343.seq
472090268 gbvrt344.seq
484800876 gbvrt345.seq
476579517 gbvrt346.seq
487431970 gbvrt347.seq
391563647 gbvrt348.seq
455738434 gbvrt349.seq
111157660 gbvrt35.seq
373020280 gbvrt350.seq
430677277 gbvrt351.seq
493479067 gbvrt352.seq
489511330 gbvrt353.seq
496625891 gbvrt354.seq
496023577 gbvrt355.seq
483316423 gbvrt356.seq
455697611 gbvrt357.seq
463738379 gbvrt358.seq
476553580 gbvrt359.seq
402140937 gbvrt36.seq
382729569 gbvrt360.seq
388762659 gbvrt361.seq
162516535 gbvrt362.seq
364042246 gbvrt363.seq
406118404 gbvrt364.seq
490080005 gbvrt365.seq
499117150 gbvrt366.seq
496745927 gbvrt367.seq
114457470 gbvrt368.seq
483642213 gbvrt369.seq
345094744 gbvrt37.seq
486499113 gbvrt370.seq
480199921 gbvrt371.seq
449130925 gbvrt372.seq
493582352 gbvrt373.seq
455855740 gbvrt374.seq
496938106 gbvrt375.seq
445299021 gbvrt376.seq
488289465 gbvrt377.seq
456295928 gbvrt378.seq
491344127 gbvrt379.seq
499274310 gbvrt38.seq
433632055 gbvrt380.seq
461359229 gbvrt381.seq
352990890 gbvrt382.seq
486129256 gbvrt383.seq
433069569 gbvrt384.seq
468000100 gbvrt385.seq
213511428 gbvrt386.seq
464521429 gbvrt387.seq
484103168 gbvrt388.seq
470335860 gbvrt389.seq
359197842 gbvrt39.seq
441506917 gbvrt390.seq
388757745 gbvrt391.seq
491752782 gbvrt392.seq
465458984 gbvrt393.seq
463577414 gbvrt394.seq
475333006 gbvrt395.seq
32860891 gbvrt396.seq
448180683 gbvrt397.seq
468563387 gbvrt398.seq
487321652 gbvrt399.seq
179100370 gbvrt4.seq
495493755 gbvrt40.seq
466578054 gbvrt400.seq
479179652 gbvrt401.seq
463026596 gbvrt402.seq
420071062 gbvrt403.seq
457719226 gbvrt404.seq
490464485 gbvrt405.seq
443384835 gbvrt406.seq
462824598 gbvrt407.seq
334830757 gbvrt408.seq
476386342 gbvrt409.seq
478307083 gbvrt41.seq
491788802 gbvrt410.seq
450398569 gbvrt411.seq
454795466 gbvrt412.seq
469602269 gbvrt413.seq
452609759 gbvrt414.seq
497531511 gbvrt415.seq
437442433 gbvrt416.seq
342108062 gbvrt417.seq
427821552 gbvrt418.seq
472175035 gbvrt419.seq
479569827 gbvrt42.seq
474308742 gbvrt420.seq
115706604 gbvrt421.seq
462970947 gbvrt422.seq
483824917 gbvrt423.seq
480993826 gbvrt424.seq
425541655 gbvrt425.seq
482200158 gbvrt426.seq
494081566 gbvrt427.seq
405268917 gbvrt428.seq
462160991 gbvrt429.seq
499582791 gbvrt43.seq
99044719 gbvrt430.seq
495727890 gbvrt431.seq
499457203 gbvrt432.seq
496827401 gbvrt433.seq
495182596 gbvrt434.seq
157867363 gbvrt435.seq
474797238 gbvrt436.seq
439268361 gbvrt437.seq
419636722 gbvrt438.seq
471975427 gbvrt439.seq
109962708 gbvrt44.seq
294229625 gbvrt440.seq
418033300 gbvrt441.seq
453670883 gbvrt442.seq
492403889 gbvrt443.seq
439486134 gbvrt444.seq
438375278 gbvrt445.seq
477518353 gbvrt446.seq
490480491 gbvrt447.seq
480679107 gbvrt448.seq
492157733 gbvrt449.seq
493406215 gbvrt45.seq
199437741 gbvrt450.seq
478924327 gbvrt451.seq
438315028 gbvrt452.seq
439741604 gbvrt453.seq
461529329 gbvrt454.seq
488438312 gbvrt455.seq
103295169 gbvrt456.seq
483017127 gbvrt457.seq
466200874 gbvrt458.seq
411265058 gbvrt459.seq
487488921 gbvrt46.seq
486575674 gbvrt460.seq
297876207 gbvrt461.seq
429098988 gbvrt462.seq
438830218 gbvrt463.seq
481726385 gbvrt464.seq
485911064 gbvrt465.seq
435037055 gbvrt466.seq
493235159 gbvrt467.seq
482533224 gbvrt468.seq
124789632 gbvrt469.seq
426877541 gbvrt47.seq
323032683 gbvrt470.seq
369600226 gbvrt471.seq
457093781 gbvrt472.seq
436813210 gbvrt473.seq
496330530 gbvrt474.seq
495693233 gbvrt475.seq
466752026 gbvrt476.seq
199939234 gbvrt477.seq
480396248 gbvrt478.seq
461404102 gbvrt479.seq
444428072 gbvrt48.seq
489903935 gbvrt480.seq
388326134 gbvrt481.seq
442642585 gbvrt482.seq
169256572 gbvrt483.seq
440392633 gbvrt484.seq
432958536 gbvrt485.seq
462430807 gbvrt486.seq
434208796 gbvrt487.seq
390926788 gbvrt488.seq
487050412 gbvrt489.seq
464099563 gbvrt49.seq
493172616 gbvrt490.seq
466690640 gbvrt491.seq
474437294 gbvrt492.seq
295373792 gbvrt493.seq
491418844 gbvrt494.seq
345870589 gbvrt495.seq
491561111 gbvrt496.seq
464430708 gbvrt497.seq
498570982 gbvrt498.seq
102451714 gbvrt499.seq
448778544 gbvrt5.seq
157849261 gbvrt50.seq
473497850 gbvrt500.seq
464739015 gbvrt501.seq
462486427 gbvrt502.seq
348110498 gbvrt503.seq
486739527 gbvrt504.seq
474299013 gbvrt505.seq
482556063 gbvrt506.seq
472095997 gbvrt507.seq
481509131 gbvrt508.seq
344867026 gbvrt509.seq
14152653 gbvrt51.seq
319747509 gbvrt510.seq
294452527 gbvrt511.seq
259683468 gbvrt512.seq
496914092 gbvrt513.seq
445665038 gbvrt514.seq
365237321 gbvrt515.seq
422305844 gbvrt516.seq
102143121 gbvrt517.seq
462745258 gbvrt518.seq
468352662 gbvrt519.seq
21384662 gbvrt52.seq
359201870 gbvrt520.seq
277305730 gbvrt521.seq
486477418 gbvrt522.seq
493194515 gbvrt523.seq
410286580 gbvrt524.seq
487454364 gbvrt525.seq
268180715 gbvrt526.seq
420546242 gbvrt527.seq
477553729 gbvrt528.seq
481366956 gbvrt529.seq
90973101 gbvrt53.seq
444950980 gbvrt530.seq
451374017 gbvrt531.seq
103288017 gbvrt532.seq
451569910 gbvrt533.seq
380073467 gbvrt534.seq
434691682 gbvrt535.seq
471518140 gbvrt536.seq
105009709 gbvrt537.seq
495643890 gbvrt538.seq
499124391 gbvrt539.seq
499951059 gbvrt54.seq
497403056 gbvrt540.seq
313091218 gbvrt541.seq
459021489 gbvrt542.seq
151106526 gbvrt543.seq
493221737 gbvrt544.seq
337765201 gbvrt545.seq
489468080 gbvrt546.seq
392687660 gbvrt547.seq
487635690 gbvrt548.seq
444942159 gbvrt549.seq
500000178 gbvrt55.seq
465228543 gbvrt550.seq
400800039 gbvrt551.seq
409788724 gbvrt552.seq
296305505 gbvrt553.seq
271758528 gbvrt554.seq
265258596 gbvrt555.seq
263761059 gbvrt556.seq
473237329 gbvrt557.seq
391745242 gbvrt558.seq
343553702 gbvrt559.seq
499999472 gbvrt56.seq
329809609 gbvrt560.seq
433600879 gbvrt561.seq
489628012 gbvrt562.seq
467831137 gbvrt563.seq
461258912 gbvrt564.seq
44048434 gbvrt565.seq
331764752 gbvrt566.seq
464133617 gbvrt567.seq
496250487 gbvrt568.seq
492153129 gbvrt569.seq
55973042 gbvrt57.seq
343521723 gbvrt570.seq
462279408 gbvrt571.seq
469961167 gbvrt572.seq
492694871 gbvrt573.seq
482668248 gbvrt574.seq
218256438 gbvrt575.seq
499999708 gbvrt58.seq
270397732 gbvrt59.seq
490703641 gbvrt6.seq
499998686 gbvrt60.seq
121299031 gbvrt61.seq
499999309 gbvrt62.seq
448533882 gbvrt63.seq
499999886 gbvrt64.seq
29257303 gbvrt65.seq
444411655 gbvrt66.seq
499998281 gbvrt67.seq
388821435 gbvrt68.seq
499999254 gbvrt69.seq
499120716 gbvrt7.seq
280114924 gbvrt70.seq
499999117 gbvrt71.seq
499996672 gbvrt72.seq
497071337 gbvrt73.seq
499630950 gbvrt74.seq
499990415 gbvrt75.seq
462471618 gbvrt76.seq
202128841 gbvrt77.seq
123737443 gbvrt78.seq
483315271 gbvrt79.seq
483703423 gbvrt8.seq
481925744 gbvrt80.seq
499146212 gbvrt81.seq
499983703 gbvrt82.seq
297372571 gbvrt83.seq
492211550 gbvrt84.seq
492375887 gbvrt85.seq
479677491 gbvrt86.seq
480814553 gbvrt87.seq
362168611 gbvrt88.seq
487931186 gbvrt89.seq
263825361 gbvrt9.seq
465950606 gbvrt90.seq
489430322 gbvrt91.seq
352376679 gbvrt92.seq
465372186 gbvrt93.seq
488788789 gbvrt94.seq
189348250 gbvrt95.seq
451948482 gbvrt96.seq
443703248 gbvrt97.seq
400719178 gbvrt98.seq
427517644 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 102016 184379131
BCT10 102 246510870
BCT100 90 224039666
BCT100 134 235129215
BCT100 115 228912035
BCT100 102 106601372
BCT100 115 203586737
BCT100 104 226028015
BCT100 96 218584648
BCT100 97 227951499
BCT100 83 131115977
BCT100 106 211161090
BCT100 83 206170690
BCT101 98 225070223
BCT101 64 206847127
BCT101 161 208588334
BCT101 136 216587635
BCT101 92 167067351
BCT101 95 210421811
BCT101 116 224818885
BCT101 135 212683110
BCT101 117 206659057
BCT101 100 116200289
BCT101 140 202136849
BCT102 58 138528232
BCT102 99 239136997
BCT102 114 204129524
BCT102 95 220406826
BCT102 106 215751826
BCT102 117 217573203
BCT102 106 236203897
BCT102 132 213387429
BCT102 146 202452910
BCT102 21 57485240
BCT102 91 214961341
BCT103 53 211054879
BCT103 85 213862553
BCT103 116 231089197
BCT103 163 221184134
BCT103 169 167480387
BCT103 99 230958440
BCT103 144 211143166
BCT103 95 210053513
BCT103 73 206035438
BCT103 159 210065937
BCT103 17 39453697
BCT104 45 210584326
BCT104 95 206627544
BCT104 144 207227598
BCT104 126 212122743
BCT104 113 215058720
BCT104 152 209472212
BCT104 21 45775661
BCT104 108 213619490
BCT104 122 217401288
BCT104 127 214862676
BCT104 144 207576401
BCT105 45 210864282
BCT105 110 196816946
BCT105 92 214664273
BCT105 53 215187127
BCT105 48 207074053
BCT105 66 201797601
BCT105 67 204825713
BCT105 95 207808075
BCT105 164 213028389
BCT105 132 143710142
BCT105 143 211484895
BCT106 45 212727898
BCT106 141 216775348
BCT106 93 209518297
BCT106 104 219360911
BCT106 62 105294553
BCT106 103 210615479
BCT106 132 205651899
BCT106 126 200902918
BCT106 146 257876858
BCT106 126 203135451
BCT106 11 39417326
BCT107 76 222861078
BCT107 124 209895621
BCT107 182 217456644
BCT107 120 261213212
BCT107 79 202934376
BCT107 117 211165709
BCT107 94 222051330
BCT107 112 214113604
BCT107 151 197301962
BCT107 189 199519901
BCT107 194 203527827
BCT108 40 115080869
BCT108 70 95972423
BCT108 107 202699573
BCT108 109 213768140
BCT108 131 198442998
BCT108 117 205117537
BCT108 92 207797846
BCT108 107 209655182
BCT108 16 31567328
BCT108 127 206571320
BCT108 72 210327486
BCT109 112 227959956
BCT109 45 205507706
BCT109 33 205557479
BCT109 3 21040570
BCT109 38 200622777
BCT109 57 210996969
BCT109 87 229797365
BCT109 105 212001413
BCT109 143 219033653
BCT109 179 214419595
BCT109 73 62531391
BCT11 141 236989370
BCT110 129 231316827
BCT110 528 115589384
BCT110 1589 2511957
BCT110 3172 5268484
BCT110 6338 7796395
BCT110 12613 14997690
BCT110 25523 27672494
BCT110 50566 54072396
BCT110 148854 156684290
BCT110 14230 193553348
BCT110 3297 203942569
BCT111 99 245428056
BCT111 2512 213432676
BCT111 7212 212654349
BCT111 164 249069009
BCT111 39928 39703867
BCT111 75125 183083691
BCT111 11034 200066507
BCT111 6078 200796727
BCT111 100672 182698124
BCT111 60999 67448214
BCT111 149155 156910442
BCT112 87 223381451
BCT112 84585 88136036
BCT112 144566 151063496
BCT112 25927 25602726
BCT112 132534 167488185
BCT112 31546 43761167
BCT112 116460 178490515
BCT112 7619 17055808
BCT112 33016 54145060
BCT112 41199 224779504
BCT112 5144 322651386
BCT113 59 181990919
BCT113 3043 52121002
BCT113 5034 225438591
BCT113 3847 224092509
BCT113 1442 273316652
BCT113 109 222593498
BCT113 55 216844860
BCT113 70 213822191
BCT113 34 137765382
BCT113 69 224394912
BCT113 364 238323955
BCT114 93 237302287
BCT114 889 289911825
BCT114 316 85816731
BCT114 1274 198668008
BCT114 287 209619920
BCT114 559 377168493
BCT114 919 316619406
BCT114 271 80140439
BCT114 3148 246273076
BCT114 661 247595544
BCT114 368 370985581
BCT115 103 223843089
BCT115 350 254527429
BCT115 362 393266490
BCT115 351 385253095
BCT115 330 252129872
BCT115 1935 224001909
BCT115 20 40370455
BCT115 86 222746849
BCT115 78 227354684
BCT115 3023 245927078
BCT115 1230 124242115
BCT116 62 225168570
BCT116 1412 261424764
BCT116 47 241352896
BCT116 45 243003094
BCT116 2180 269716913
BCT116 945 54278114
BCT116 2284 261463112
BCT116 87 288890299
BCT116 417 278222635
BCT116 3023 263078339
BCT116 11940 19905115
BCT117 64 140507059
BCT117 25214 42009480
BCT117 118251 188698156
BCT117 114833 191975949
BCT117 92358 166857865
BCT117 97831 200538961
BCT117 119674 193415505
BCT117 54562 295652979
BCT117 122459 202305133
BCT117 98331 227594643
BCT117 724 181153446
BCT118 89 229551845
BCT118 358 274616850
BCT118 156 207619882
BCT118 208 205768159
BCT118 197 205113543
BCT118 200 205637754
BCT118 173 202326691
BCT118 45 60784238
BCT118 179 205883676
BCT118 202 206537177
BCT118 226 205678653
BCT119 90 230404163
BCT119 173 206520918
BCT119 37 50683886
BCT119 237 205937725
BCT119 304 211429514
BCT119 248 235438689
BCT119 890 214955458
BCT119 152 271521130
BCT119 600 313227342
BCT119 587 233046879
BCT119 280 274505337
BCT12 161 262427707
BCT120 99 240958902
BCT120 53036 279823416
BCT120 3401 5215316
BCT121 27 42382325
BCT122 94 226656782
BCT123 118 229172914
BCT124 129 235728302
BCT125 60 116779005
BCT126 114 212138354
BCT127 75 223237061
BCT128 112 225347102
BCT129 124 217786851
BCT13 18 24867996
BCT130 3 5977905
BCT131 246 222256023
BCT132 104 221252195
BCT133 100 224644129
BCT134 83 222703364
BCT135 21 86233168
BCT136 68 221578114
BCT137 87 219795809
BCT138 85 224407383
BCT139 80 222158521
BCT14 169 234246001
BCT140 4 11001364
BCT141 124 217933644
BCT142 53 217706139
BCT143 90 227492926
BCT144 57 149506400
BCT145 94 223837173
BCT146 73 221711999
BCT147 122 215811464
BCT148 80 227727095
BCT149 8 8657925
BCT15 153 241428314
BCT150 159 220206896
BCT151 84 220629983
BCT152 79 216070642
BCT153 141 227102717
BCT154 107 224394264
BCT155 80 221199213
BCT156 92 196245950
BCT157 115 225967887
BCT158 92 220409897
BCT159 158 214217907
BCT16 187 250598365
BCT160 88 207032597
BCT161 140 220978157
BCT162 63 217844098
BCT163 90 215013764
BCT164 125 217101319
BCT165 88 223616604
BCT166 21 65066945
BCT167 174 220602866
BCT168 128 221993348
BCT169 118 216449560
BCT17 219 231641963
BCT170 170 220678969
BCT171 54 177570665
BCT172 104 218683705
BCT173 113 217389079
BCT174 151 218678288
BCT175 108 219330740
BCT176 112 226939239
BCT177 130 201487093
BCT178 94 226698167
BCT179 104 222093509
BCT18 31 58194184
BCT180 93 221389007
BCT181 111 224520970
BCT182 94 220173706
BCT183 138 222095932
BCT184 44 84896110
BCT185 161 220699365
BCT186 100 223727909
BCT187 96 223995439
BCT188 95 219439398
BCT189 71 223304376
BCT19 135 235079883
BCT190 129 228001663
BCT191 150 229208112
BCT192 77 216466477
BCT193 11 10188678
BCT194 100 233591727
BCT195 95 219993420
BCT196 133 222280876
BCT197 85 221811199
BCT198 26 92438538
BCT199 119 222185746
BCT2 106 226805638
BCT20 131 231843219
BCT200 151 231715107
BCT201 72 216080650
BCT202 81 120955479
BCT203 111 216184725
BCT204 156 227708035
BCT205 111 220250972
BCT206 89 136614524
BCT207 133 229717687
BCT208 109 213797140
BCT209 111 220064957
BCT21 109 220733955
BCT210 77 222877345
BCT211 19 34014599
BCT212 98 220152536
BCT213 132 227699493
BCT214 126 229823053
BCT215 115 247492878
BCT216 116 229072476
BCT217 35 100612124
BCT218 131 216438017
BCT219 93 226438829
BCT22 212 222430645
BCT220 108 224089005
BCT221 116 221458112
BCT222 65 122261042
BCT223 127 225144984
BCT224 137 258852104
BCT225 100 226684234
BCT226 159 219265722
BCT227 71 116660995
BCT228 123 222422665
BCT229 115 218469346
BCT23 50 66104168
BCT230 89 219209021
BCT231 103 229936404
BCT232 104 209481600
BCT233 104 234499310
BCT234 94 222201735
BCT235 95 222593575
BCT236 105 225137188
BCT237 98 229933616
BCT238 106 224550172
BCT239 90 192942285
BCT24 174 220036188
BCT240 104 221826114
BCT241 108 221051727
BCT242 98 226007841
BCT243 76 270744187
BCT244 75 254647899
BCT245 101 225874656
BCT246 178 218571314
BCT247 132 228118798
BCT248 58 111799670
BCT249 303 275292038
BCT25 157 217996559
BCT250 119 219435892
BCT251 114 219246925
BCT252 53 88783408
BCT253 89 220099828
BCT254 87 228427298
BCT255 82 236651858
BCT256 106 224032415
BCT257 39 81227217
BCT258 60 216868170
BCT259 120 221119124
BCT26 52 221902715
BCT260 86 223426276
BCT261 85 217663772
BCT262 31 72411893
BCT263 157 275025230
BCT264 82 232627723
BCT265 84 220566907
BCT266 144 212385076
BCT267 20 28670539
BCT268 109 262921422
BCT269 72 217635148
BCT27 110 224934926
BCT270 100 214909619
BCT271 79 210171996
BCT272 143 306547296
BCT273 72 239204396
BCT274 88 216728836
BCT275 131 224161084
BCT276 140 264048514
BCT277 50 101444202
BCT278 146 273570514
BCT279 114 257004034
BCT28 204 233470802
BCT280 35 229012536
BCT281 60 215899496
BCT282 112 219135997
BCT283 126 219604182
BCT284 95 249332001
BCT285 78 222741730
BCT286 14 34821419
BCT287 124 215159011
BCT288 98 220607386
BCT289 65 210721442
BCT29 3 27676824
BCT290 137 230450043
BCT291 114 227067240
BCT292 109 229190301
BCT293 88 225088899
BCT294 80 141524915
BCT295 107 223678318
BCT296 82 218642004
BCT297 95 229902920
BCT298 97 183022758
BCT299 93 235647841
BCT3 37542 125814925
BCT30 83 236556551
BCT300 104 235928514
BCT301 69 223063860
BCT302 105 213496548
BCT303 119 216777827
BCT304 166 226651969
BCT305 161 212763762
BCT306 157 238023030
BCT307 8 17431560
BCT308 101 230275411
BCT309 119 225277295
BCT31 96 221838262
BCT310 156 250483403
BCT311 117 235914627
BCT312 10 46450140
BCT313 123 226718502
BCT314 112 212578426
BCT315 91 227407856
BCT316 111 218543332
BCT317 153 221137906
BCT318 155 212286893
BCT319 119 183827081
BCT32 96 219800168
BCT320 127 225491526
BCT321 106 222744013
BCT322 83 218273834
BCT323 70 215964942
BCT324 123 196813336
BCT325 87 241506031
BCT326 110 227814029
BCT327 82 219259803
BCT328 52 214399303
BCT329 90 197873444
BCT33 117 236937870
BCT330 113 220728285
BCT331 129 231228144
BCT332 125 212458214
BCT333 94 219289732
BCT334 148 223216642
BCT335 3 10254404
BCT336 124 248813935
BCT337 110 222498371
BCT338 82 228432498
BCT339 61 221300332
BCT34 50 70336694
BCT340 89 186048729
BCT341 128 238885544
BCT342 201 232731845
BCT343 144 217080977
BCT344 134 215029591
BCT345 118 217111970
BCT346 41 76975466
BCT347 139 245503240
BCT348 169 279754521
BCT349 165 215010867
BCT35 83 218320760
BCT350 135 218768734
BCT351 19 125140083
BCT352 72 229560250
BCT353 126 238154065
BCT354 742 221695520
BCT355 398 217882477
BCT356 95 232152237
BCT357 6 15239951
BCT358 115 224523179
BCT359 120 214271004
BCT36 105 222970569
BCT360 102 211428284
BCT361 127 217681230
BCT362 188 233278336
BCT363 230 225229102
BCT364 129 223160743
BCT365 75 164588533
BCT366 136 222929134
BCT367 146 220643724
BCT368 142 217749525
BCT369 131 229168171
BCT37 82 232936682
BCT370 145 233120869
BCT371 97 238465297
BCT372 59 129171418
BCT373 113 227348795
BCT374 143 228415697
BCT375 133 230301712
BCT376 143 217787195
BCT377 84 228448881
BCT378 13 27883457
BCT379 130 230534195
BCT38 119 235544692
BCT380 118 226122673
BCT381 80 223238517
BCT382 91 225542391
BCT383 58 219031718
BCT384 50 220953317
BCT385 132 225967417
BCT386 48 19128392
BCT387 200 233036939
BCT388 127 252087880
BCT389 114 227136753
BCT39 187 254336335
BCT390 215 225277178
BCT391 74 105630813
BCT392 90 239192530
BCT393 114 247991308
BCT394 46 214210162
BCT395 53 216377196
BCT396 19 73275105
BCT397 128 213375994
BCT398 113 228373833
BCT399 72 224187533
BCT4 41290 139250707
BCT40 162 235716785
BCT400 133 247411727
BCT401 182 232684152
BCT402 114 216401796
BCT403 112 219464033
BCT404 62 126238712
BCT405 184 265248059
BCT406 184 238017458
BCT407 299 227349707
BCT408 123 230691656
BCT409 155 239989579
BCT41 162 285723804
BCT410 116 236526519
BCT411 105 221043801
BCT412 16 25750290
BCT413 109 230735808
BCT414 84 216238233
BCT415 94 218004732
BCT416 102 226314622
BCT417 155 220876767
BCT418 68 123957640
BCT419 89 221294643
BCT42 104 224210141
BCT420 108 228032164
BCT421 120 225520882
BCT422 153 335842367
BCT423 110 218250059
BCT424 101 285163697
BCT425 55 131018393
BCT426 116 223524149
BCT427 153 221386449
BCT428 100 220428149
BCT429 94 224434864
BCT43 131 230640010
BCT430 157 223587766
BCT431 118 230273588
BCT432 119 221798255
BCT433 82 94432839
BCT434 122 226585208
BCT435 153 219365274
BCT436 149 229541054
BCT437 159 230173281
BCT438 131 218220461
BCT439 21 41744019
BCT44 34 67043870
BCT440 130 238739741
BCT441 144 219192263
BCT442 141 221558368
BCT443 99 219564845
BCT444 92 213102293
BCT445 106 227602274
BCT446 122 242875742
BCT447 100 313072351
BCT448 88 215834731
BCT449 101 137773450
BCT45 164 221117526
BCT450 123 217943213
BCT451 125 223387893
BCT452 93 216431058
BCT453 101 256544346
BCT454 67 188984278
BCT455 118 212264610
BCT456 113 224096535
BCT457 110 224785936
BCT458 118 216093672
BCT459 46 87010523
BCT46 182 226510942
BCT460 144 219919128
BCT461 104 251665529
BCT462 156 212575427
BCT463 159 212139624
BCT464 12 11443917
BCT465 238 214458452
BCT466 129 214250986
BCT467 99 218510804
BCT468 117 230291203
BCT469 123 262063092
BCT47 249 222464459
BCT470 78 178549235
BCT471 103 236047200
BCT472 127 236790346
BCT473 131 219550029
BCT474 104 228221181
BCT475 91 216460991
BCT476 53 217868736
BCT477 81 148217592
BCT478 165 216872086
BCT479 119 219438729
BCT48 138 188825985
BCT480 114 229553940
BCT481 134 213504721
BCT482 11 41867039
BCT483 78 220992704
BCT484 139 212603090
BCT485 157 216271864
BCT486 317 213898340
BCT487 364 210657095
BCT488 132 214358054
BCT489 129 214345921
BCT49 117 219700493
BCT490 138 211643808
BCT491 186 222281010
BCT492 151 212756765
BCT493 79 104966745
BCT494 161 208257957
BCT495 162 212193463
BCT496 114 210605338
BCT497 157 213126972
BCT498 132 209356669
BCT499 131 195243107
BCT5 20642 162919204
BCT50 154 231749228
BCT500 183 210687290
BCT501 116 210811583
BCT502 136 211510245
BCT503 167 220748430
BCT504 55 112883059
BCT505 156 239757304
BCT506 132 228642948
BCT507 212 229686477
BCT508 114 221407292
BCT509 13 30166462
BCT51 179 217496436
BCT510 112 230828773
BCT511 126 221442497
BCT512 130 232586607
BCT513 108 234490322
BCT514 116 96570292
BCT515 107 232838404
BCT516 96 224202359
BCT517 110 224180420
BCT518 69 230451487
BCT519 119 247887479
BCT52 207 219674506
BCT520 111 267612902
BCT521 71 144393115
BCT522 184 216765022
BCT523 123 232248162
BCT524 132 222732283
BCT525 118 215196560
BCT526 193 220065332
BCT527 123 225435430
BCT528 141 225643357
BCT529 2 9711339
BCT53 147 157984357
BCT530 98 244806965
BCT531 140 231132901
BCT532 93 213640233
BCT533 144 216096685
BCT534 52 79482139
BCT535 140 218732960
BCT536 109 225107446
BCT537 89 216531385
BCT538 160 227565367
BCT539 100 79332059
BCT54 150 229244957
BCT540 157 237479776
BCT541 137 340179435
BCT542 129 246757216
BCT543 188 271554474
BCT544 127 219640401
BCT545 70 232305542
BCT546 113 219878224
BCT547 29 90299175
BCT548 119 220313347
BCT549 89 220615423
BCT55 132 216086617
BCT550 91 230065071
BCT551 118 220710534
BCT552 114 215070730
BCT553 145 214781258
BCT554 22 34118909
BCT555 125 216431578
BCT556 139 217127904
BCT557 127 231713695
BCT558 120 216867760
BCT559 285 221512732
BCT56 81 221931886
BCT560 63 80282166
BCT561 139 228155956
BCT562 96 240199682
BCT563 86 218203266
BCT564 170 210933694
BCT565 134 217729188
BCT566 175 209625406
BCT567 79 96733079
BCT568 156 208447709
BCT569 127 240984651
BCT57 109 222406832
BCT570 128 222248609
BCT571 160 221935754
BCT572 96 151677122
BCT573 160 225500184
BCT574 50 213452168
BCT575 230 254160025
BCT576 132 234547809
BCT577 90 221019009
BCT578 128 191258602
BCT579 153 215988330
BCT58 113 228094449
BCT580 126 276622167
BCT581 205 209499795
BCT582 142 249238352
BCT583 98 257053887
BCT584 10 28305238
BCT585 126 229963741
BCT586 143 224119815
BCT587 143 228055648
BCT588 99 220513805
BCT589 100 221827976
BCT59 93 224120142
BCT590 14 36127315
BCT591 123 221651394
BCT592 130 226062430
BCT593 103 221052628
BCT594 100 222269888
BCT595 94 218107342
BCT596 125 230964292
BCT597 48 128546625
BCT598 128 228496151
BCT599 146 223925807
BCT6 2600 37759883
BCT60 502 112470026
BCT600 166 215804467
BCT601 151 224697554
BCT602 117 221724909
BCT603 112 194039034
BCT604 206 242745918
BCT605 115 230743055
BCT606 183 208573489
BCT607 96 221504128
BCT608 73 229935992
BCT609 163 214524829
BCT61 5200 7533877
BCT610 156 178907953
BCT611 118 219970257
BCT612 61 208926431
BCT613 58 212720835
BCT614 96 227347619
BCT615 163 211364382
BCT616 46 141537947
BCT617 83 216322242
BCT618 94 212424978
BCT619 162 239996086
BCT62 10402 13141863
BCT620 196 290109228
BCT621 68 134048239
BCT622 134 222118709
BCT623 42 214577135
BCT624 37 214639852
BCT625 169 234699017
BCT626 64 148941997
BCT627 93 213934681
BCT628 94 215092310
BCT629 111 222844906
BCT63 53921 202024569
BCT630 144 220055980
BCT631 1 3804066
BCT632 96 215824553
BCT633 117 217349806
BCT634 91 215441587
BCT635 125 214278124
BCT636 58 50622662
BCT637 125 221173811
BCT638 105 243553672
BCT639 112 219526221
BCT64 185 208765651
BCT640 116 225797430
BCT641 56 68232735
BCT642 113 234776612
BCT643 131 215059389
BCT644 132 215446490
BCT645 109 305361100
BCT646 119 389226149
BCT647 37 89297409
BCT648 103 315044090
BCT649 132 215840869
BCT65 101 231004346
BCT650 130 216288700
BCT651 128 225312427
BCT652 116 189016502
BCT653 132 214807403
BCT654 146 211344811
BCT655 157 218339452
BCT656 131 227463680
BCT657 150 284425536
BCT658 96 111912110
BCT659 117 217993852
BCT66 122 221744163
BCT660 101 220308758
BCT661 85 219851191
BCT662 176 273793462
BCT663 12 37505206
BCT664 167 228607581
BCT665 142 234882570
BCT666 129 216056427
BCT667 313 216930339
BCT668 100 219463728
BCT669 11 23786760
BCT67 105 223658793
BCT670 153 253634546
BCT671 117 220928082
BCT672 114 220243493
BCT673 145 215912655
BCT674 128 209612221
BCT675 55 80905256
BCT676 114 208287954
BCT677 111 218909223
BCT678 178 210684333
BCT679 138 220364043
BCT68 132 225901521
BCT680 68 39649747
BCT681 137 242501423
BCT682 146 212177855
BCT683 99 226813904
BCT684 184 224843837
BCT685 76 171603231
BCT686 128 218013642
BCT687 163 236987131
BCT688 149 233234431
BCT689 95 223094380
BCT69 121 221767226
BCT690 153 216702829
BCT691 15 33023684
BCT692 121 216371427
BCT693 144 235531916
BCT694 189 230516470
BCT695 57 212158620
BCT696 54 213861014
BCT697 102 213303998
BCT698 85 213343638
BCT699 121 213119277
BCT7 1310 133308362
BCT70 143 222824414
BCT700 85 222314307
BCT701 84 234274068
BCT702 88 203519746
BCT703 170 215443584
BCT704 147 221075478
BCT705 334 213083661
BCT706 58 212224764
BCT707 72 224728661
BCT708 187 254744920
BCT709 151 222165008
BCT71 144 225008783
BCT710 24 63588680
BCT711 73 212371616
BCT712 92 217821699
BCT713 107 224242047
BCT714 140 207591800
BCT715 138 210023829
BCT716 34 63064456
BCT717 142 206612759
BCT718 117 213883354
BCT719 136 219396034
BCT72 132 146571992
BCT720 80 217057439
BCT721 97 179738098
BCT722 122 220472990
BCT723 85 241011219
BCT724 83 219160791
BCT725 139 229008424
BCT726 114 209823386
BCT727 115 228573543
BCT728 104 180087813
BCT729 104 223025233
BCT73 255 227294457
BCT730 106 217782989
BCT731 123 226271822
BCT732 137 243256026
BCT733 53 88148326
BCT734 107 217566484
BCT735 74 218950444
BCT736 120 225051478
BCT737 145 214500516
BCT738 88 111987983
BCT739 86 213573894
BCT74 86 220119558
BCT740 130 217540925
BCT741 123 210871336
BCT742 171 239325822
BCT743 118 223254380
BCT744 118 212305147
BCT745 61 103694457
BCT746 90 210404774
BCT747 68 218117704
BCT748 78 215089705
BCT749 170 206703246
BCT75 113 224688543
BCT750 90 212853708
BCT751 91 205774211
BCT752 150 220495306
BCT753 74 209792743
BCT754 67 208772721
BCT755 169 212721867
BCT756 56 116045619
BCT757 130 220379388
BCT758 150 212561762
BCT759 122 208757280
BCT76 128 222273877
BCT760 141 218623226
BCT761 71 120622855
BCT762 143 232831805
BCT763 167 218748651
BCT764 262 219114964
BCT765 93 238194838
BCT766 132 210704841
BCT767 146 269013799
BCT768 13 26087527
BCT769 98 208485006
BCT77 135 219988879
BCT770 100 210533604
BCT771 82 210000879
BCT772 135 209511382
BCT773 128 222695129
BCT774 85 214544139
BCT775 122 204382829
BCT776 17 62866914
BCT777 128 230171908
BCT778 113 212211634
BCT779 117 217176695
BCT78 111 162805198
BCT780 126 204798555
BCT781 127 209019053
BCT782 126 217197760
BCT783 2 2874374
BCT784 123 211751375
BCT785 133 205963114
BCT786 123 199946665
BCT787 109 202839658
BCT788 105 200392301
BCT789 46 59924951
BCT79 136 223054995
BCT790 96 210680253
BCT791 102 215577489
BCT792 126 215817254
BCT793 90 206369463
BCT794 167 210992359
BCT795 195 258965701
BCT796 119 231103861
BCT797 109 210143469
BCT798 131 217704792
BCT799 194 242616899
BCT8 191 234251938
BCT80 112 217399067
BCT800 105 221956996
BCT801 115 214870077
BCT802 77 109323484
BCT803 125 211065306
BCT804 122 213122123
BCT805 81 220648324
BCT806 88 217954742
BCT807 19 71723256
BCT808 118 208676078
BCT809 151 208821074
BCT81 131 223635367
BCT810 168 227462150
BCT811 86 215601192
BCT812 9 50951519
BCT813 78 221812250
BCT814 125 223032976
BCT815 136 225597849
BCT816 170 218721653
BCT817 37 58721844
BCT818 144 208238457
BCT819 87 213429706
BCT82 121 221481204
BCT820 101 217399008
BCT821 122 206947282
BCT822 86 218856604
BCT823 41 73711142
BCT824 129 204889894
BCT825 101 206403455
BCT826 140 206673674
BCT827 103 222681205
BCT828 119 203963977
BCT829 89 218799196
BCT83 138 232661918
BCT830 131 207240191
BCT831 86 243483204
BCT832 92 217110281
BCT833 120 204571763
BCT834 267 330723151
BCT835 3 3861503
BCT836 80 212236513
BCT837 42 216832260
BCT838 45 207609867
BCT839 33 216612314
BCT84 108 225781339
BCT840 35 209868915
BCT841 29 204617914
BCT842 38 208164840
BCT843 42 210485019
BCT844 44 211051572
BCT845 38 212223550
BCT846 22 149998670
BCT847 48 210451747
BCT848 40 209817027
BCT849 53 216171741
BCT85 38 50860113
BCT850 42 210660307
BCT851 35 212502390
BCT852 3 19426947
BCT853 50 214605937
BCT854 51 211812861
BCT855 52 210023927
BCT856 56 216125499
BCT857 60 210424088
BCT858 6 33897440
BCT859 47 212007461
BCT86 95 230912422
BCT860 54 215909714
BCT861 50 213554838
BCT862 49 213263466
BCT863 7 35840570
BCT864 39 216577772
BCT865 36 216150585
BCT866 46 213466951
BCT867 38 209902179
BCT868 9 43244600
BCT869 44 214561662
BCT87 117 227983621
BCT870 52 212949917
BCT871 49 212995495
BCT872 39 214973231
BCT873 48 217211812
BCT874 35 159130592
BCT875 32 212769851
BCT876 46 210260903
BCT877 55 212164559
BCT878 49 214983300
BCT879 113 222641659
BCT88 160 232898310
BCT880 64 79318788
BCT881 96 220160568
BCT882 138 246607249
BCT883 117 234489358
BCT884 106 215203074
BCT885 75 176543406
BCT886 130 206130775
BCT887 99 216262761
BCT888 132 209024743
BCT889 146 232106166
BCT89 154 221704284
BCT890 148 212976662
BCT891 53 74260790
BCT892 98 210426593
BCT893 119 210398752
BCT894 103 238874264
BCT895 90 217207547
BCT896 84 206836362
BCT897 43 84419270
BCT898 146 230130694
BCT899 257 224571901
BCT9 133 236750743
BCT90 128 238275556
BCT900 105 230226623
BCT901 68 207912503
BCT902 8 28049535
BCT903 38 205943556
BCT904 40 208182310
BCT905 141 206631333
BCT906 102 213591656
BCT907 32 44307499
BCT908 150 219617638
BCT909 129 230665747
BCT91 114 230664549
BCT910 184 217564262
BCT911 143 214196903
BCT912 137 212881820
BCT913 1 7092945
BCT914 109 214927660
BCT915 230 212909813
BCT916 130 207789667
BCT917 95 201627013
BCT918 33 208554139
BCT919 139 210071272
BCT92 54 123393656
BCT920 63 64908925
BCT921 142 208438983
BCT922 137 257147365
BCT923 92 204593264
BCT924 109 213617047
BCT925 74 205146894
BCT926 81 181353068
BCT927 103 243832933
BCT928 146 211812689
BCT929 155 229580318
BCT93 300 239582260
BCT930 145 224336587
BCT931 117 209471651
BCT932 43 70023048
BCT933 144 226846865
BCT934 165 240804894
BCT935 137 203302520
BCT936 116 206724862
BCT937 8 20181809
BCT938 99 227572136
BCT939 122 208880584
BCT94 142 231562727
BCT940 72 221220782
BCT941 103 223417327
BCT942 5 10099927
BCT943 97 215224235
BCT944 133 213074013
BCT945 166 241766167
BCT946 83 215204606
BCT947 96 148262514
BCT948 154 256565973
BCT949 160 215520838
BCT95 354 225466658
BCT950 227 198139332
BCT951 194 214164016
BCT952 150 238466321
BCT953 183 214004217
BCT954 115 231244324
BCT955 84 84489215
BCT956 267 221230052
BCT957 105 198582168
BCT958 157 198577520
BCT959 111 216079526
BCT96 110 222922994
BCT960 58 205365498
BCT961 126 194755999
BCT962 132 204137212
BCT963 218 208821287
BCT964 91 214185377
BCT965 131 218273982
BCT966 90 213365816
BCT967 66 215010028
BCT968 24 89083167
BCT969 72 216882544
BCT97 120 208517065
BCT970 77 206821532
BCT971 116 212317257
BCT972 149 202431016
BCT973 99 208380995
BCT974 125 217303903
BCT975 25 67523714
BCT976 102 220914310
BCT977 132 203436790
BCT978 129 204375074
BCT979 103 214791358
BCT98 120 227476688
BCT980 163 211740668
BCT981 21 47297581
BCT982 73 214650101
BCT983 86 223702639
BCT984 97 206763127
BCT985 127 199796444
BCT986 63 73275462
BCT987 113 204388700
BCT988 141 204601292
BCT989 134 217690282
BCT99 99 226611423
BCT990 136 210543891
BCT991 126 180689856
BCT992 107 242505953
BCT993 136 210453521
BCT994 115 256551995
BCT995 91 210048481
BCT996 72 320427022
BCT997 16 55088322
BCT998 190 322204163
BCT999 178 306151071
ENV1 189935 141862471
ENV10 83 219720293
ENV11 123 233168356
ENV12 160 211753504
ENV13 78 217974652
ENV14 75001 200284245
ENV15 164232 120901464
ENV16 218957 102557787
ENV17 176354 159883932
ENV18 19607 17093160
ENV19 204685 124198548
ENV2 107540 182340808
ENV20 186311 145969593
ENV21 209227 131010830
ENV22 180832 144716759
ENV23 1253 1680771
ENV24 155432 156521079
ENV25 244834 67513554
ENV26 92644 21374075
ENV27 220959 118335235
ENV28 255263 109061723
ENV29 205148 126323456
ENV3 107534 190935055
ENV30 27436 25911781
ENV31 152286 158743065
ENV32 201174 103412499
ENV33 68234 51315191
ENV34 213266 108913712
ENV35 170980 153756120
ENV36 135003 163680006
ENV37 11565 15756086
ENV38 179911 128295039
ENV39 218036 118475194
ENV4 123 288587808
ENV40 78544 41744926
ENV41 143978 97999834
ENV42 100614 112273801
ENV43 130608 80421746
ENV44 173932 138863702
ENV45 163623 139549512
ENV46 179878 114643421
ENV47 200965 107345641
ENV48 196346 109547800
ENV49 111595 97826521
ENV5 82 223082810
ENV50 158036 134815523
ENV51 145069 136773586
ENV52 169158 47812980
ENV53 172152 133099110
ENV54 210920 100423911
ENV55 142453 62215787
ENV56 216484 84261358
ENV57 212738 92633350
ENV58 108072 43434401
ENV59 224249 98772107
ENV6 113 218427071
ENV60 224778 91719263
ENV61 142977 92510405
ENV62 198338 110961572
ENV63 182989 90540711
ENV64 183046 120492196
ENV65 56546 44849913
ENV66 130925 184596597
ENV67 222730 136081982
ENV68 234258 94804834
ENV69 97664 44643021
ENV7 70 214282206
ENV70 194508 112018451
ENV71 131103 170964472
ENV72 67598 134769130
ENV73 41601 215300471
ENV74 137248 143694176
ENV75 80013 189575188
ENV76 47179 225510654
ENV77 121901 208180310
ENV78 87665 295987188
ENV79 1049 380331571
ENV8 20 65472971
ENV80 1053 383361624
ENV81 688 391877182
ENV82 751 390664475
ENV83 916 392687310
ENV84 153 55401057
ENV85 443 393951292
ENV86 427 391732837
ENV87 1056 391791633
ENV88 1068 392685879
ENV89 68 47794770
ENV9 76 217162029
ENV90 507 386789577
ENV91 495 393960280
ENV92 754 393494364
ENV93 813 390896220
ENV94 730 393266141
ENV95 12621 145211819
EST1 152675 59068774
EST10 155732 67102548
EST100 9280 6073374
EST101 152751 76457993
EST102 144974 99269788
EST103 145182 85226207
EST104 148851 93102880
EST105 7590 4379704
EST106 149588 109398421
EST107 135202 99317177
EST108 136259 97455014
EST109 136242 94833807
EST11 163524 69167407
EST110 2430 1604588
EST111 136737 77265728
EST112 176402 105751785
EST113 193937 119219957
EST114 236932 141668239
EST115 6644 4079812
EST116 229453 127643708
EST117 181415 102870914
EST118 190249 93414076
EST119 5248 4073334
EST12 150868 64813535
EST120 148552 100253258
EST121 154735 119130491
EST122 166280 97900067
EST123 22063 15461205
EST124 130028 82530428
EST125 83543 30920786
EST126 36769 12485692
EST127 84106 31034635
EST128 84264 34515269
EST129 33711 11378339
EST13 186630 83471161
EST130 85031 32709177
EST131 82017 34968192
EST132 83454 35266094
EST133 84118 32965334
EST134 14468 5903340
EST135 83460 51063090
EST136 173481 87480434
EST137 170361 77647991
EST138 145260 91618093
EST139 29926 18954860
EST14 104811 47840316
EST140 140082 86844098
EST141 149390 97854038
EST142 157158 78701962
EST143 181287 92625427
EST144 9191 5349082
EST145 141523 76012752
EST146 151524 73200135
EST147 148374 86976403
EST148 155585 83483584
EST149 12068 7116900
EST15 197325 111627306
EST150 166215 102160051
EST151 202194 107310927
EST152 158867 93286369
EST153 102222 51075859
EST154 155639 79042501
EST155 135075 80133731
EST156 141690 88158876
EST157 165810 85752287
EST158 9314 5218716
EST159 178955 104146744
EST16 147207 104727496
EST160 218711 94419121
EST161 145779 85813988
EST162 161375 87629602
EST163 3062 1523802
EST164 140641 82381870
EST165 132518 83737464
EST166 147240 88253080
EST167 146470 80724455
EST168 20660 10474074
EST169 117769 61073260
EST17 156583 83438215
EST170 115690 61941713
EST171 122419 54128062
EST172 121107 48630686
EST173 29423 11431564
EST174 122215 48678047
EST175 125709 48482605
EST176 165795 83310643
EST177 172205 75576921
EST178 24657 15513157
EST179 147743 104364925
EST18 190948 116798416
EST180 163429 99358064
EST181 205284 116217156
EST182 167108 93350542
EST183 154079 103286743
EST184 134219 92993843
EST185 10781 6013701
EST186 146582 94120876
EST187 154988 80945678
EST188 131921 71038778
EST189 160841 90602190
EST19 177401 113022813
EST190 13426 8488348
EST191 148840 87645185
EST192 153698 95464921
EST193 175523 99185391
EST194 140423 77123132
EST195 5092 4172247
EST196 123957 64267925
EST197 162713 90845821
EST198 173188 99607451
EST199 149613 92840164
EST2 157282 60511000
EST20 71002 55723226
EST200 6220 3898334
EST201 164742 79129501
EST202 122492 84332359
EST203 163357 96332572
EST204 163858 96045573
EST205 14397 6880168
EST206 5847 2580354
EST207 111150 63073430
EST208 151159 87089869
EST209 107205 63530208
EST21 194366 109128304
EST210 164131 100717476
EST211 168271 124553548
EST212 82827 67366748
EST213 186242 95036481
EST214 145260 90138733
EST215 87567 65796037
EST216 141914 85219333
EST217 137886 75147497
EST218 95616 30688109
EST219 146890 86264843
EST22 179786 92385104
EST220 148591 82458987
EST221 141362 94229070
EST222 155415 90007104
EST223 9715 6818730
EST224 161771 99542731
EST225 154058 93650716
EST226 123359 88321639
EST227 146028 90245814
EST228 6976 4224742
EST229 128831 82021098
EST23 107425 50568912
EST230 127856 89666249
EST231 44462 31954010
EST232 156429 83331488
EST233 167399 92029721
EST234 166930 92691445
EST235 158125 88082990
EST236 163896 91508682
EST237 163228 92242200
EST238 166033 91294921
EST239 154891 85088026
EST24 190972 61390762
EST240 168030 90687163
EST241 187909 98489047
EST242 191300 107036253
EST243 168392 100329485
EST244 180025 103224685
EST245 190025 112759300
EST246 186323 113230756
EST247 178010 115392887
EST248 7071 5607359
EST249 140634 86212237
EST25 136527 39211071
EST250 212632 138839121
EST251 226959 111340152
EST252 164069 113913134
EST253 183146 95756964
EST254 197974 98471029
EST255 123046 89289573
EST256 7475 5185523
EST257 140192 82346312
EST258 206166 112637179
EST259 162529 106400163
EST26 102354 27619605
EST260 93617 92298032
EST261 15407 20057289
EST262 147622 99189632
EST263 150767 89756528
EST264 139175 101742302
EST265 216335 99352819
EST266 4567 2822870
EST267 133615 96419482
EST268 129478 90281514
EST269 135531 98318385
EST27 201338 85169852
EST270 113347 81422479
EST271 17537 11116930
EST272 136224 84348047
EST273 125703 85851017
EST274 127789 96576509
EST275 36548 26163923
EST276 126643 89388805
EST277 116504 79027537
EST278 138883 83664868
EST279 145960 114900779
EST28 19821 8893541
EST280 15616 11047942
EST281 125395 117388350
EST282 132433 98775254
EST283 162337 97562555
EST284 165664 104470663
EST285 19257 12070221
EST286 142230 92433803
EST287 168916 115087168
EST288 151692 103908519
EST289 136286 103145259
EST29 203801 100091766
EST290 3504 2324257
EST291 159549 97229973
EST292 222526 90766361
EST293 152836 111325212
EST294 160398 71766467
EST295 10511 1188715
EST296 208917 37980980
EST297 212285 83331327
EST298 150079 115258622
EST299 168109 97764449
EST3 156018 54727708
EST30 216481 109022941
EST300 154827 103149238
EST301 169052 109970400
EST302 149395 109822175
EST303 2197 1476231
EST304 180744 102235132
EST305 178556 93090463
EST306 168973 109471713
EST307 158897 104102902
EST308 2412 1924660
EST309 225880 106203457
EST31 153855 67071563
EST310 266222 115902028
EST311 185438 112102082
EST312 151098 28711854
EST313 227985 99544771
EST314 175491 100305859
EST315 156178 99890381
EST316 159724 95007108
EST317 501 378403
EST318 166298 114042738
EST319 179944 95179284
EST32 149562 63751558
EST320 143781 97257990
EST321 188320 110423173
EST322 187351 49127557
EST323 201668 33862026
EST324 174164 95391760
EST325 14783 9236867
EST326 158235 113265480
EST327 184738 110428476
EST328 167428 97750567
EST329 165965 109745188
EST33 165159 65680081
EST330 165847 71373897
EST331 127635 80037094
EST332 121223 80447816
EST333 146636 101328568
EST334 22504 8264161
EST335 250611 26632520
EST336 254708 23392212
EST337 152004 94195783
EST338 152251 98608210
EST339 150976 99681932
EST34 146995 64488245
EST340 145898 92253111
EST341 237629 43480316
EST342 185640 80872134
EST343 4027 4970633
EST344 168740 99735080
EST345 164066 101174105
EST346 145573 92691954
EST347 189424 103120774
EST348 156183 109749641
EST349 153279 101584306
EST35 162533 70849732
EST350 2503 944448
EST351 184230 108290864
EST352 169884 94656881
EST353 169139 105194404
EST354 178670 59730057
EST355 195269 72030896
EST356 194748 75388710
EST357 197291 74551080
EST358 134728 70211808
EST359 174807 127367579
EST36 160843 65992517
EST360 148311 85036907
EST361 150468 86648232
EST362 121487 94878394
EST363 6016 4765678
EST364 142701 94368059
EST365 154898 94011344
EST366 162129 90206822
EST367 156746 100297355
EST368 24221 10619332
EST369 45656 24624838
EST37 107940 33682334
EST370 155293 104537031
EST371 137832 97018853
EST372 158224 101866180
EST373 152627 109640383
EST374 30457 25940091
EST375 173528 146728187
EST376 163544 85444380
EST377 127571 80894386
EST378 137822 94036599
EST379 51338 35949456
EST38 99513 30490013
EST380 131619 88276056
EST381 136937 89484345
EST382 139330 96988271
EST383 147110 97086473
EST384 51460 41224894
EST385 164148 86536266
EST386 143623 81414337
EST387 144917 86069192
EST388 144188 103734681
EST389 155671 93199334
EST39 99154 31398751
EST390 137838 87384737
EST391 132358 84149156
EST392 20621 12735139
EST393 196942 107257732
EST394 136851 75001285
EST395 92969 54570705
EST396 120408 80237774
EST397 23482 14313208
EST398 131137 82988342
EST399 119642 76596711
EST4 142973 56363489
EST40 98816 29787153
EST400 147271 80746668
EST401 210375 82563334
EST402 30535 12824521
EST403 163628 84364287
EST404 163914 99171502
EST405 159146 95828757
EST406 125949 81273885
EST407 12201 7996192
EST408 129505 86703580
EST409 137395 90180185
EST41 39237 11600444
EST410 178556 111879524
EST411 154174 93122560
EST412 27981 12146305
EST413 166699 91995576
EST414 168828 124880457
EST415 87410 56148447
EST416 69678 41105952
EST417 34127 16800877
EST418 137385 79881208
EST419 82558 49493964
EST42 101326 31351096
EST420 139666 56831391
EST421 148165 29997368
EST422 148030 30296289
EST423 162446 79992545
EST424 28505 15128716
EST425 201162 115815918
EST426 237754 108749461
EST427 220179 107490326
EST428 127131 74523185
EST429 128057 85803248
EST43 102633 36243427
EST430 131704 80409324
EST431 93228 56881081
EST432 174105 110064955
EST433 213136 84698644
EST434 106574 28506785
EST435 183471 112008437
EST436 203905 111386178
EST437 180307 106396407
EST438 199637 118042696
EST439 132935 62223660
EST44 95475 48218258
EST440 110330 60167533
EST441 162601 108614110
EST442 181152 115720728
EST443 108077 86015819
EST444 177004 139599957
EST445 150295 90619060
EST446 54250 34510266
EST447 166056 106956443
EST448 178219 101078638
EST449 42963 24524631
EST45 121121 52335541
EST450 195466 106587863
EST451 183935 94237774
EST452 52147 38920690
EST453 189910 115818986
EST454 180010 117991294
EST455 54575 33990107
EST456 196573 133887305
EST457 219857 123775014
EST458 190087 126956582
EST459 189241 147388649
EST46 55810 33167886
EST460 310 264791
EST461 204237 155999097
EST462 192186 115130551
EST463 160758 96336999
EST464 181197 94914003
EST465 7455 618615
EST466 53496 4381716
EST467 158232 12239421
EST468 144975 12987161
EST469 147925 29931089
EST47 176556 89017465
EST470 148356 29501756
EST471 8452 1761940
EST472 148043 30264080
EST473 141212 81174487
EST474 171367 100066875
EST475 161649 110829124
EST476 19450 13804348
EST477 160769 92760687
EST478 150651 104122645
EST479 133679 93215490
EST48 158182 65087932
EST480 141645 98058798
EST481 16408 8460433
EST482 157369 103673906
EST483 146437 105286243
EST484 162008 97559403
EST485 165795 50905340
EST486 11911 1871822
EST487 160476 40344382
EST488 150806 102149648
EST489 146637 96518392
EST49 162218 91937040
EST490 170921 112346527
EST491 21820 11821661
EST492 132527 75702844
EST493 189749 107907416
EST494 149390 109146835
EST495 53584 36369591
EST496 126855 87064282
EST497 144984 89957424
EST498 147215 88443431
EST499 163143 89171042
EST5 162051 62593707
EST50 154881 80581826
EST500 37742 19234949
EST501 151785 92116569
EST502 155952 91949431
EST503 168251 101940332
EST504 136389 85423858
EST505 15950 9025714
EST506 100253 71169364
EST507 78626 60620272
EST508 97407 64699787
EST509 143235 80400824
EST51 156390 74771983
EST510 37443 21334080
EST511 120626 73365540
EST512 133392 87396068
EST513 135163 79259009
EST514 151533 92857854
EST515 47048 25601310
EST516 155600 85748129
EST517 184596 110426846
EST518 120081 78936396
EST519 178679 94921106
EST52 108219 61222574
EST520 5747 2182136
EST521 52576 18674859
EST522 182569 100663650
EST523 152147 81321151
EST524 23054 13929447
EST525 162316 94446797
EST526 211236 123658554
EST527 30185 19341621
EST528 147958 99624045
EST529 158446 97595891
EST53 153906 88947034
EST530 134305 87490150
EST531 128605 87865201
EST532 26182 16357153
EST533 178675 74362205
EST534 179100 79391228
EST535 198856 83506649
EST536 194861 80609089
EST537 4095 1379666
EST538 178841 95307232
EST539 174076 102227567
EST54 154180 84961596
EST540 180191 107920861
EST541 172258 103856477
EST542 196663 126493129
EST543 186411 103110933
EST544 178906 82833431
EST545 148085 94327161
EST546 206518 125003286
EST547 205657 126701639
EST548 188926 108266858
EST549 208317 121345654
EST55 152206 92215407
EST550 34317 17820709
EST551 154052 96415299
EST552 188314 117673697
EST553 166534 98815170
EST554 133848 98340892
EST555 8680 7064950
EST556 157219 92146041
EST557 170364 84880278
EST558 149242 85152820
EST559 151161 81931931
EST56 150043 69980186
EST560 11910 7120648
EST561 156480 79964955
EST562 181225 106297481
EST563 162168 102988489
EST564 175034 107729396
EST565 4112 2835985
EST566 170705 117072637
EST567 183779 113546740
EST568 129220 83791155
EST569 168573 97321671
EST57 142162 76714634
EST570 185674 110165295
EST571 39431 26359140
EST572 204465 119127975
EST573 269500 91747576
EST574 25706 9441749
EST575 262208 83553217
EST576 157843 95706673
EST577 156061 104112677
EST578 162590 58135365
EST579 92204 36397534
EST58 151708 83217855
EST59 161193 65787331
EST6 166230 65027190
EST60 144593 70135006
EST61 160363 89937947
EST62 150328 92590364
EST63 150104 99262027
EST64 157594 94518660
EST65 2750 1159006
EST66 154746 103409939
EST67 162946 83001350
EST68 166590 84837766
EST69 142361 77842398
EST7 163847 67729347
EST70 148303 82498115
EST71 148974 86076496
EST72 148443 92215211
EST73 150507 87391920
EST74 3383 2003436
EST75 29919 18235506
EST76 186623 102758272
EST77 170455 90769208
EST78 212135 115450370
EST79 179537 103352293
EST8 161030 67846589
EST80 2595 1769868
EST81 196745 121640362
EST82 167531 93331870
EST83 135983 63275222
EST84 128088 62608076
EST85 11211 5755351
EST86 150319 92587484
EST87 154530 96911701
EST88 130224 66330046
EST89 140145 89262488
EST9 169413 69378292
EST90 14643 7628096
EST91 183459 91893008
EST92 204450 119806817
EST93 202065 108012137
EST94 192053 90423413
EST95 203798 86996774
EST96 145870 86936148
EST97 137781 84685372
EST98 158915 76749677
EST99 51 43963
GSS1 172818 126565512
GSS10 15074 14542328
GSS100 156116 139401502
GSS101 16660 10968419
GSS102 168722 143967545
GSS103 157878 109069542
GSS104 156130 106446313
GSS105 152737 105718247
GSS106 168006 122784077
GSS107 149452 126270618
GSS108 161684 125096048
GSS109 186495 115926183
GSS11 145624 106562569
GSS110 16919 10327274
GSS111 185687 119751799
GSS112 201287 103923207
GSS113 219830 124101551
GSS114 87638 57037950
GSS115 151982 114076675
GSS116 155174 118808984
GSS117 155138 118870658
GSS118 163305 106817350
GSS119 37490 21563377
GSS12 199531 104011022
GSS120 179013 131661113
GSS121 189765 117491847
GSS122 166053 55057548
GSS123 169938 76249060
GSS124 3108 2065491
GSS125 161448 105035511
GSS126 188861 124688564
GSS127 200296 82002210
GSS128 168220 79987296
GSS129 137268 94431217
GSS13 191750 84122684
GSS130 129855 104605133
GSS131 132043 108777560
GSS132 132451 106048276
GSS133 8056 5958858
GSS134 135214 112032054
GSS135 56598 47104660
GSS136 132584 107786768
GSS137 139149 116140565
GSS138 140043 114408742
GSS139 138251 109584898
GSS14 173813 89348940
GSS140 4155 2820771
GSS141 134784 106426486
GSS142 134049 108003847
GSS143 134400 111531585
GSS144 138188 116474348
GSS145 4675 3643453
GSS146 139468 108106612
GSS147 136810 113648547
GSS148 136898 113473892
GSS149 137299 112649085
GSS15 1938 988004
GSS150 559 466085
GSS151 137155 110923756
GSS152 134480 106278327
GSS153 133002 107665198
GSS154 138659 116136290
GSS155 1985 1674795
GSS156 127182 92203837
GSS157 174121 105055718
GSS158 184364 110063775
GSS159 162423 108623596
GSS16 167949 83915468
GSS160 177518 102495753
GSS161 195395 128347977
GSS162 201539 133261442
GSS163 200715 134061851
GSS164 181019 126535857
GSS165 198341 136948587
GSS166 196713 139067120
GSS167 196064 138671402
GSS168 174299 134354206
GSS169 144455 97326934
GSS17 159733 81434570
GSS170 138044 80504279
GSS171 165318 73488234
GSS172 130318 57968790
GSS173 162971 140972883
GSS174 170923 113504023
GSS175 80882 52990649
GSS176 191836 128985792
GSS177 195995 117721523
GSS178 29060 15232802
GSS179 180225 98140530
GSS18 155954 85598323
GSS180 181302 123365801
GSS181 178800 126906476
GSS182 181098 127179984
GSS183 19114 12799890
GSS184 165902 130533276
GSS185 170769 155442034
GSS186 219492 123624062
GSS187 216568 103419657
GSS188 17938 8362456
GSS189 210015 95106166
GSS19 153562 95948361
GSS190 162425 134536276
GSS191 16879 16812210
GSS192 125540 102753347
GSS193 122235 93469471
GSS194 156641 154268782
GSS195 167926 158459909
GSS196 131396 104305071
GSS197 149270 107882813
GSS198 170062 141598521
GSS199 173837 119784937
GSS2 172571 106974251
GSS20 153654 72719206
GSS200 20915 12139581
GSS201 181326 133978343
GSS202 184901 120110360
GSS203 180115 93024445
GSS204 172840 121730733
GSS205 189431 117159380
GSS206 189632 116856204
GSS207 21296 12387505
GSS208 200656 130020228
GSS209 215713 142627344
GSS21 106599 59132134
GSS210 217639 140378671
GSS211 166383 136378793
GSS212 152394 108659129
GSS213 159516 120127536
GSS214 159222 144721751
GSS215 159808 141641241
GSS216 160025 145012269
GSS217 161623 143744366
GSS218 162207 142682743
GSS219 161901 124660013
GSS22 132522 64635660
GSS220 168118 139542770
GSS221 162158 116272085
GSS222 180642 88789528
GSS223 2275 1543221
GSS224 251369 52150506
GSS225 262481 40466091
GSS226 262523 40408947
GSS227 122800 38229504
GSS228 253355 52912344
GSS229 182564 86129082
GSS23 125192 56723722
GSS230 188824 55951827
GSS231 154341 118464759
GSS232 177033 144334259
GSS233 160566 145786280
GSS234 158963 146486119
GSS235 175119 110481562
GSS236 238210 57319690
GSS237 198716 101419694
GSS238 228399 39423474
GSS239 119553 74879314
GSS24 133968 72981771
GSS240 173527 111778918
GSS241 148016 90087402
GSS242 140463 83787484
GSS243 159730 149647691
GSS244 6510 5539956
GSS245 112668 95722541
GSS246 180351 149222837
GSS247 172952 122406011
GSS248 201906 127716686
GSS249 188212 120277412
GSS25 142794 74274291
GSS250 166174 94402794
GSS251 159865 84500494
GSS252 156428 119869610
GSS253 203515 148105610
GSS254 14311 9406937
GSS255 171523 67875770
GSS256 176316 96175653
GSS257 195480 152066346
GSS258 199052 153893384
GSS259 8581 7079434
GSS26 12574 5388027
GSS260 197610 157072181
GSS261 197570 124238096
GSS262 194874 142538969
GSS263 853 588710
GSS264 214431 131244295
GSS265 189953 57620998
GSS266 211774 108913136
GSS267 177797 157192397
GSS268 163847 150141472
GSS269 233829 131848785
GSS27 140896 65655631
GSS270 241255 120361822
GSS28 159847 79832355
GSS29 156451 92519127
GSS3 138091 115757733
GSS30 164864 85230462
GSS31 10282 5319388
GSS32 171961 102867176
GSS33 182793 109077642
GSS34 182265 87041537
GSS35 173003 102201943
GSS36 190487 103919871
GSS37 162239 112347665
GSS38 160362 98313234
GSS39 173083 108442870
GSS4 140070 112435838
GSS40 4467 3211536
GSS41 183985 122974505
GSS42 181741 117322404
GSS43 52286 27335335
GSS44 177820 102905200
GSS45 164518 141969870
GSS46 179633 148569334
GSS47 139686 92499212
GSS48 182873 132017102
GSS49 181617 114554523
GSS5 12740 9526334
GSS50 204428 116967955
GSS51 185581 99459566
GSS52 211954 108037045
GSS53 211747 108318359
GSS54 197283 132772792
GSS55 158243 124832316
GSS56 185581 139403239
GSS57 196772 63137399
GSS58 171739 96410996
GSS59 157709 106163169
GSS6 152750 116376137
GSS60 23373 13575160
GSS61 166615 156644394
GSS62 177188 98818477
GSS63 161235 115245018
GSS64 172262 112292681
GSS65 175437 118749924
GSS66 184317 127706706
GSS67 205680 128787401
GSS68 187487 111746271
GSS69 904 494120
GSS7 170822 119987739
GSS70 200507 134082593
GSS71 215979 158545254
GSS72 188980 137988156
GSS73 173702 107612445
GSS74 198148 111946385
GSS75 140507 76313882
GSS76 163068 95818066
GSS77 10997 7015314
GSS78 159270 97756741
GSS79 159481 96970229
GSS8 177085 108879970
GSS80 172278 114346124
GSS81 170756 109404389
GSS82 174393 122413259
GSS83 188868 105212708
GSS84 174781 125776724
GSS85 164186 106495287
GSS86 1893 1501037
GSS87 189248 108544814
GSS88 180902 113819623
GSS89 166588 117808805
GSS9 141918 118720967
GSS90 192391 105665595
GSS91 10240 5928398
GSS92 213831 107550639
GSS93 226833 89047322
GSS94 213068 138993481
GSS95 183490 92580894
GSS96 94686 37020965
GSS97 193805 75823638
GSS98 201086 123394316
GSS99 191020 122180795
HTC1 41190 63371632
HTC2 32318 72271528
HTC3 32081 77888423
HTC4 84853 50691912
HTC5 129489 161175080
HTC6 125374 123224002
HTC7 137565 130734996
HTC8 68695 61912595
HTG1 3784 374870703
HTG10 2848 363016285
HTG11 1976 365940103
HTG12 1714 382089084
HTG13 1718 381796340
HTG14 1659 383118453
HTG15 1835 380424998
HTG16 1750 361896240
HTG17 1843 380599315
HTG18 1752 382301790
HTG19 1775 381824019
HTG2 5068 373604329
HTG20 1891 380883515
HTG21 2135 355865123
HTG22 2426 376351102
HTG23 2269 379507879
HTG24 2442 381163865
HTG25 2175 382733656
HTG26 2070 368006459
HTG27 2074 380458182
HTG28 2061 380108509
HTG29 1047 202962639
HTG3 2556 370662362
HTG30 2040 379446758
HTG31 2203 375546591
HTG32 986 170706729
HTG33 2152 379221269
HTG34 2348 376393195
HTG35 1372 195850538
HTG36 2462 370234045
HTG37 2428 372528369
HTG38 1015 169191937
HTG39 2235 381490266
HTG4 2735 369989641
HTG40 2336 385145188
HTG41 1069 180930974
HTG42 2312 384776536
HTG43 2363 384490832
HTG44 906 155597869
HTG45 2500 379735659
HTG46 2319 385244375
HTG47 927 158722850
HTG48 2315 385567657
HTG49 2293 386023883
HTG5 2500 373389217
HTG50 900 149450476
HTG51 2237 385154833
HTG52 2106 380011723
HTG53 657 122585305
HTG54 2010 379525743
HTG55 1981 378955508
HTG56 1184 193581815
HTG57 2144 380658486
HTG58 2686 383430148
HTG59 2972 383122016
HTG6 2 386956
HTG60 885 128384665
HTG61 2959 380503057
HTG62 3012 366231486
HTG63 2990 372824610
HTG64 2953 336850403
HTG65 3178 359117111
HTG66 3179 359260560
HTG67 3186 360427818
HTG68 3128 367889098
HTG69 2913 377859052
HTG7 2327 375791086
HTG70 1846 312468258
HTG71 3415 365492036
HTG72 2071 381329139
HTG73 1668 298160154
HTG74 2088 382520375
HTG75 2244 384445864
HTG76 1669 296247510
HTG77 2201 385233869
HTG78 2249 384504439
HTG79 3218 384021459
HTG8 1500 384347777
HTG80 2165 384532378
HTG81 3034 373211752
HTG82 2133 233393918
HTG9 1582 384062276
INV1 154322 140062712
INV10 4 353796308
INV100 19 393479571
INV100 3 146110617
INV100 10 369487108
INV100 12 390659631
INV100 23 390394397
INV100 25 366663447
INV100 15 378170753
INV100 12 180879245
INV100 22 392034752
INV100 12 386348701
INV100 10 373953727
INV101 18 363756879
INV101 6 388811552
INV101 25 386609090
INV101 13 334938607
INV101 3 236174852
INV101 5 333202408
INV101 7 380888452
INV101 6 288483784
INV101 3 359596411
INV101 3 275853845
INV101 5 376167017
INV102 5 243308800
INV102 7 369632890
INV102 15 378314108
INV102 17 368087933
INV102 5 133748391
INV102 20 388296339
INV102 17 379457536
INV102 20 368530964
INV102 5 394539175
INV102 1 71901920
INV102 6 370194894
INV103 39 334947085
INV103 8 316109534
INV103 1 2140038457
INV103 1 1533311695
INV103 1 991394496
INV103 1 709211797
INV103 1 559013835
INV103 1 538612828
INV103 1 476618521
INV103 1 348474640
INV103 1 332259893
INV104 16 388094550
INV104 1 287425978
INV104 1 237816702
INV104 1 222571878
INV104 2 391571136
INV104 8 340292240
INV104 1 47220557
INV104 4 366546274
INV104 12 379725079
INV104 19 391162514
INV104 10 240269750
INV105 15 286886243
INV105 19 374616646
INV105 33 382987660
INV105 33 386339958
INV105 30 353746939
INV105 21 371601066
INV105 6 362567176
INV105 13 390937191
INV105 12 231701502
INV105 27 388004708
INV105 229 382141802
INV106 1 276873094
INV106 33 392005379
INV106 11 192522327
INV106 20 349696121
INV106 9 386500094
INV106 11 373924042
INV106 9 250287188
INV106 16 392208593
INV106 30 375590146
INV106 20 381850848
INV106 9 220479775
INV107 1 234867409
INV107 3 349443465
INV107 3 121655962
INV107 1 378734160
INV107 1 272287048
INV107 6 307813224
INV107 29 391276627
INV107 16 383716194
INV107 34 374759466
INV107 5 262281928
INV107 11 371329702
INV108 1 301373441
INV108 6 368879584
INV108 7 350337011
INV108 14 345060509
INV108 28 376473495
INV108 20 387688055
INV108 25 387549397
INV108 16 273291927
INV108 21 391659234
INV108 15 388003948
INV108 17 392782098
INV109 1 299223332
INV109 22 384497843
INV109 1 384599746
INV109 1 375927842
INV109 5 382993214
INV109 19 385797313
INV109 11 123214675
INV109 3 392646952
INV109 11 381074049
INV109 23 391735799
INV109 18 390168307
INV11 6 363887313
INV110 1 264325503
INV110 2 42007124
INV110 17 349645545
INV110 36 391559871
INV110 15 393037217
INV110 17 380153622
INV110 3 59787137
INV110 18 391697154
INV110 18 366312255
INV110 3 337894111
INV110 4 302073392
INV111 1 233496210
INV111 2 299644653
INV111 2 270514050
INV111 3 389949835
INV111 3 377785151
INV111 1 117072231
INV111 7 379476447
INV111 13 370594929
INV111 19 385355871
INV111 19 310143194
INV111 24 379964624
INV112 1 211810051
INV112 23 389484464
INV112 18 384799792
INV112 11 311697054
INV112 19 385416179
INV112 23 381933246
INV112 21 387246911
INV112 4 249799159
INV112 2 366882438
INV112 14 388370346
INV112 21 372413558
INV113 1 189869738
INV113 11 364644469
INV113 9 299858585
INV113 3 322474280
INV113 5 373079097
INV113 6 253444959
INV113 1 278847389
INV113 2 381917736
INV113 5 382304965
INV113 10 386062363
INV113 10 259701476
INV114 4 368008555
INV114 13 376291971
INV114 17 379702260
INV114 14 391466716
INV114 23 381561736
INV114 7 104919562
INV114 17 384568933
INV114 4 354385143
INV114 5 393615696
INV114 5 350509167
INV114 13 170433122
INV115 10 374438952
INV115 41 385022073
INV115 30 380703697
INV115 20 392681339
INV115 13 369303117
INV115 3 121760452
INV115 10 368178692
INV115 15 386351526
INV115 16 393205423
INV115 22 382093519
INV115 5 84901051
INV116 142 363361056
INV116 23 391606292
INV116 19 384186373
INV116 24 387846790
INV116 20 373516354
INV116 4 111080816
INV116 18 393422118
INV116 46 378688286
INV116 19 382845041
INV116 14 380720656
INV116 16 377993913
INV117 1 68716222
INV117 13 388384596
INV117 15 353225248
INV117 10 385225146
INV117 11 273470899
INV117 12 363823232
INV117 18 371293482
INV117 18 391994412
INV117 31 390819384
INV117 6 350425796
INV117 14 392098573
INV118 7 358563110
INV118 29 373609145
INV118 17 389590392
INV118 16 381486986
INV118 15 318246839
INV118 17 388617783
INV118 14 389176964
INV118 29 259715661
INV118 4 364567413
INV118 8 381014917
INV118 2 78434448
INV119 6 345062453
INV119 5 350286208
INV119 2 290331975
INV119 2 278888238
INV119 2 276514222
INV119 2 269676904
INV119 4 363956289
INV119 18 391284265
INV119 12 224045865
INV119 19 391324862
INV119 17 390982751
INV12 9 371306258
INV120 6 376979739
INV120 18 376274198
INV120 19 352401134
INV120 3 302186515
INV120 4 353711471
INV120 5 357741396
INV120 13 382478042
INV120 12 224411599
INV120 17 376440323
INV120 17 366693890
INV120 13 391571027
INV121 6 346027335
INV121 18 382117156
INV121 3 51115388
INV121 24 358079042
INV121 12 377073348
INV121 21 382278417
INV121 30 359479577
INV121 2 70328500
INV121 13 381531391
INV121 10 308545783
INV121 3 357081424
INV122 8 391541735
INV122 3 303625532
INV122 2 181194408
INV122 44 384390297
INV122 33 392079687
INV122 13 343474254
INV122 1 226676804
INV122 1 219059534
INV122 16 385377860
INV122 22 389649401
INV122 14 386739832
INV123 20 390632956
INV123 14 369921279
INV123 1 61636059
INV123 7 366264750
INV123 9 350557811
INV123 15 365667369
INV123 6 378807618
INV123 190 393479694
INV123 10 373214505
INV123 7 128813925
INV123 37 384493639
INV124 28 376951305
INV124 27 388854011
INV124 23 380037898
INV124 28 363846557
INV124 15 377681854
INV124 22 393673783
INV124 9 130141504
INV124 20 389123558
INV124 20 387294169
INV124 14 389119304
INV124 19 379601315
INV125 19 381997075
INV125 23 386448258
INV125 8 389213531
INV125 13 380257717
INV125 204 387365574
INV125 30 392954113
INV125 3 276039202
INV125 2 378921420
INV125 2 303390991
INV125 9 391074667
INV125 16 390694906
INV126 117982 189844892
INV126 12 366488514
INV126 4 325784878
INV126 6 389357642
INV126 9 384120626
INV126 11 376230233
INV126 5 157146748
INV126 15 387407218
INV126 10 372793310
INV126 13 386573559
INV126 15 366464331
INV127 35062 26585717
INV127 25 368796884
INV127 14 394572131
INV127 15 272825452
INV127 16 382028398
INV127 3 377751995
INV127 1 74373700
INV127 6 372848766
INV127 19 392995865
INV127 20 361450650
INV127 18 393654662
INV128 167091 134103522
INV128 27 368630202
INV128 24 392519924
INV128 20 384861097
INV128 24 394625452
INV128 21 320922556
INV128 4 339818558
INV128 6 372821066
INV128 12 375257232
INV128 18 356987095
INV128 14 392597749
INV129 126884 112526766
INV129 21 390274896
INV129 3 43344510
INV129 31 388699035
INV129 27 388119446
INV129 10 369434192
INV129 17 377251515
INV129 4 346682597
INV129 3 85114833
INV129 22 388207738
INV129 17 378212285
INV13 15 383308273
INV130 37136 273256295
INV130 16 392106212
INV130 25 393533165
INV130 6 365268265
INV130 9 317988506
INV130 13 387631941
INV130 19 375812714
INV130 6 360702987
INV130 9 377395012
INV130 315 360903659
INV130 24 386975977
INV131 2779 371575686
INV131 2 20618579
INV131 11 379797353
INV131 7 271219600
INV131 6 392152830
INV131 13 379500142
INV131 21 371433468
INV131 17 381702180
INV131 3 58464932
INV131 8 341593495
INV131 4 370341263
INV132 44 370097884
INV132 5 385484997
INV132 3 361480762
INV132 2 227816091
INV132 3 326627480
INV132 3 179785975
INV132 1 394411929
INV132 1 208357731
INV132 2 387387157
INV132 28 393959523
INV132 241 387119275
INV133 24 379270301
INV133 22 379489872
INV133 23 385909353
INV133 7 124975265
INV133 15 390696136
INV133 18 371915036
INV133 16 382295963
INV133 15 370940962
INV133 8 363964332
INV133 7 216076461
INV133 1 222508353
INV134 5 76533839
INV134 2 378391780
INV134 11 365473561
INV134 4 178163008
INV134 24 386512327
INV134 26 391903437
INV134 36 382490299
INV134 14 376797262
INV134 8 203772100
INV134 21 389229967
INV134 14 386982868
INV135 32 391299062
INV135 19 389026688
INV135 10 374195572
INV135 7 158156167
INV135 15 377259953
INV135 23 388223446
INV135 14 372625691
INV135 19 382678381
INV135 10 189595137
INV135 24 380015923
INV135 20 388962198
INV136 25 362900281
INV136 14 379590905
INV136 13 301439739
INV136 15 378313646
INV136 15 386611886
INV136 23 392780439
INV136 14 300976708
INV136 22 355579415
INV136 6 382504563
INV136 8 311266892
INV136 3 335903695
INV137 18 380479131
INV137 1 91272002
INV137 4 340601518
INV137 5 393178719
INV137 7 378352357
INV137 8 368654020
INV137 3 55757405
INV137 1 219663937
INV137 2 347956425
INV137 5 371419038
INV137 12 376377240
INV138 19 390062857
INV138 16 384236082
INV138 8 176370631
INV138 18 372019888
INV138 24 386509465
INV138 24 389713698
INV138 31 307760477
INV138 5 386523964
INV138 1 28255227
INV138 5 90894419
INV138 1 485851375
INV139 5 134896453
INV139 1 214862200
INV139 8 378994418
INV139 19 376407609
INV139 46 376414438
INV139 3 388122302
INV139 11 318389619
INV139 3 234762902
INV139 2 315919502
INV139 6 393647630
INV139 11 381373389
INV14 23 362467755
INV140 18 373966012
INV140 19 381074705
INV140 22 386497102
INV140 21 390526659
INV140 254 366101051
INV140 12 386296471
INV140 16 387655277
INV140 21 383151662
INV140 20 383401877
INV140 19 344640379
INV140 1 82766246
INV141 24 386584721
INV141 17 385091065
INV141 20 387924663
INV141 12 388536663
INV141 8 219178196
INV141 11 367097380
INV141 13 382777311
INV141 13 359364339
INV141 7 252534006
INV141 7 348359881
INV141 6 327698438
INV142 8 380395300
INV142 2 316788101
INV142 3 312494531
INV142 4 204379861
INV142 1 406294527
INV142 1 310928733
INV142 3 388958877
INV142 11 148169598
INV142 1 249786838
INV142 2 319646621
INV142 5 298110067
INV143 19 379365223
INV143 1 281865375
INV143 1 241717587
INV143 10 375364887
INV143 17 384501009
INV143 11 328663993
INV143 1 106314825
INV143 4 339541539
INV143 7 369695073
INV143 5 344800758
INV143 8 394204524
INV144 9 138772803
INV144 4 119862796
INV144 10 365101424
INV144 18 388033671
INV144 26 393220942
INV144 12 266980887
INV144 19 392458449
INV144 55 389557696
INV144 24 387260689
INV144 13 234291481
INV144 7 258353618
INV145 28 391443580
INV145 2 295700062
INV145 7 366943025
INV145 11 381355472
INV145 4 106561761
INV145 19 343847635
INV145 17 382516650
INV145 2 332743733
INV145 6 313828708
INV145 16 380123343
INV145 45 361967714
INV146 28 392100242
INV146 3 372946856
INV146 7 266485410
INV146 18 382230867
INV146 10 304685791
INV146 3 347667496
INV146 20 363448675
INV146 26 391194852
INV146 9 375785816
INV146 10 364023583
INV146 9 272133891
INV147 45 382097969
INV147 9 363725267
INV147 8 384234607
INV147 10 393372120
INV147 40 329899252
INV147 6 337260709
INV147 5 383946385
INV147 12 302989156
INV147 19 376745921
INV147 15 386872820
INV147 19 377921066
INV148 27 372689086
INV148 21 391511415
INV148 5 268714484
INV148 2 354551436
INV148 1 157299779
INV148 3 175039039
INV148 1 258850354
INV148 2 335699355
INV148 4 247610254
INV148 1 210654766
INV148 2 362253048
INV149 18 385206419
INV149 2 291631295
INV149 2 121261647
INV149 1 373316775
INV149 1 242235330
INV149 1 230154751
INV149 1 215250610
INV149 11 384181851
INV149 21 394628944
INV149 21 388317282
INV149 5 124958072
INV15 29 382177169
INV150 12 373566826
INV150 20 371325954
INV150 17 377167253
INV150 16 316992586
INV150 8 380596977
INV150 3 59344420
INV150 26 368094122
INV150 14 385505339
INV150 18 337616521
INV150 2 326309498
INV150 4 392502457
INV151 1 94407144
INV151 5 316388481
INV151 10 382487467
INV151 14 367500819
INV151 17 393579082
INV151 16 320660384
INV151 5 358120367
INV151 8 361433354
INV151 3 310200528
INV151 16 382164179
INV151 24 382990678
INV152 15 381614547
INV152 14 386676724
INV152 20 389628974
INV152 9 139734111
INV152 30 384304423
INV152 22 379619161
INV152 5 201083147
INV152 1 214309029
INV152 2 362516173
INV152 2 344553920
INV152 2 335374504
INV153 29 387067226
INV153 2 321615305
INV153 2 309892614
INV153 2 295904703
INV153 2 292629611
INV153 2 287511714
INV153 2 281066585
INV153 3 371349787
INV153 23 393225346
INV153 13 347530107
INV153 4 341473635
INV154 25 384930026
INV154 4 373447781
INV154 5 352685990
INV154 20 386769473
INV154 15 361943918
INV154 9 358194592
INV154 11 383437796
INV154 12 371566673
INV154 29 394011208
INV154 28 385746331
INV154 18 302475867
INV155 18 381070342
INV155 4 318142276
INV155 11 388330882
INV155 6 356025686
INV155 25 390407770
INV155 17 150566893
INV155 2 352537966
INV155 2 276070255
INV155 24 393379081
INV155 43 374993362
INV155 23 391094723
INV156 96883 235171769
INV156 26 389040069
INV156 17 334905483
INV156 6 351795300
INV156 13 391964421
INV156 31 333085123
INV156 1 240654870
INV156 1 223236985
INV156 3 226917127
INV156 1 225692979
INV156 1 215602707
INV157 124547 97382534
INV157 2 359154098
INV157 2 283138276
INV157 3 366799603
INV157 3 307774329
INV157 5 386006823
INV157 6 377763960
INV157 17 380578375
INV157 23 179650194
INV157 9 279714746
INV157 1 319955300
INV158 28942 319697553
INV158 4 294686109
INV158 3 364144297
INV158 11 369858529
INV158 26 367540634
INV158 9 377516512
INV158 10 371704098
INV158 12 343109056
INV158 10 354589932
INV158 34 375616881
INV158 19 394326882
INV159 28941 347133943
INV159 21 374608767
INV159 23 392617132
INV159 19 390763580
INV159 21 373694902
INV159 20 389092152
INV159 6 342447720
INV159 6 392638958
INV159 17 377689199
INV159 27 389728640
INV159 22 354327927
INV16 25 391264799
INV160 20 388604938
INV160 14 387821915
INV160 24 384209358
INV160 18 387080188
INV160 27 368588306
INV160 22 392029793
INV160 14 327862994
INV160 19 377119881
INV160 17 307555546
INV160 3 353482681
INV160 5 299619810
INV161 15 389699299
INV161 1 132666048
INV161 3 317464440
INV161 7 393544312
INV161 19 384876011
INV161 22 371202890
INV161 12 198837579
INV161 23 355220600
INV161 10 359923815
INV161 2 335082113
INV161 6 386079520
INV162 16 252138391
INV162 5 230433460
INV162 5 352992863
INV162 5 380688199
INV162 7 352664180
INV162 9 377429293
INV162 12 394660557
INV162 10 197942219
INV162 2 336892074
INV162 3 370983084
INV162 3 332872960
INV163 34 391108680
INV163 1 123574484
INV163 5 334741585
INV163 6 361874674
INV163 1 600392024
INV163 1 498054485
INV163 6 247445165
INV163 3 377166698
INV163 6 380839905
INV163 13 379838352
INV163 18 376311503
INV164 71 392017627
INV164 13 377693108
INV164 3 77407176
INV164 16 290303689
INV164 4 388534210
INV164 7 367452973
INV164 9 347348840
INV164 6 318055136
INV164 2 231996794
INV164 7 379250551
INV164 13 385052985
INV165 24 388974367
INV165 14 392864015
INV165 23 389418814
INV165 24 358524871
INV165 11 358125685
INV165 6 377157459
INV165 5 313090362
INV165 1 203836987
INV165 2 361472882
INV165 7 389230467
INV165 2 66154651
INV166 21 381982755
INV166 19 379925762
INV166 26 382380400
INV166 7 340680974
INV166 11 368263801
INV166 15 378509559
INV166 11 160650367
INV166 3 346301993
INV166 4 227914153
INV166 1 463878994
INV166 1 411919547
INV167 20 377528210
INV167 3 385717261
INV167 9 382692631
INV167 12 390490662
INV167 4 66996290
INV167 3 374261553
INV167 4 259154223
INV167 2 338881051
INV167 2 297311018
INV167 8 367421825
INV167 4 151351292
INV168 24 388990898
INV168 8 326797151
INV168 2 273333741
INV168 4 277445847
INV168 1 262796939
INV168 2 271972204
INV168 1 127864911
INV168 7 367980411
INV168 8 350419278
INV168 8 346802129
INV168 7 388895464
INV169 29 394663938
INV169 6 332687782
INV169 17 389980029
INV169 19 275721668
INV169 2 316756308
INV169 5 378077717
INV169 8 376434480
INV169 22 386292603
INV169 14 359535040
INV169 31 393401082
INV169 23 252185357
INV17 19 392660452
INV170 27 393364046
INV170 21 393889915
INV170 25 385063393
INV170 31 389476731
INV170 28 383285214
INV170 29 383108478
INV170 30 382677493
INV170 4 368098288
INV170 10 361306401
INV170 3 310174203
INV170 5 377713589
INV171 23 381713426
INV171 5 310344155
INV171 5 388826641
INV171 17 355257629
INV171 5 277866332
INV171 7 377579832
INV171 6 331962748
INV171 8 379965026
INV171 6 351494758
INV171 7 325767769
INV171 1 305569956
INV172 137 350719386
INV172 1 202803143
INV172 5 370802707
INV172 20 387233220
INV172 17 383557345
INV172 12 367544820
INV172 15 379680131
INV172 8 367593407
INV172 12 383019718
INV172 8 342062699
INV172 14 347824666
INV173 4 381900476
INV173 1 54263138
INV173 12 355903329
INV173 6 247193371
INV173 2 339071690
INV173 2 311526032
INV173 11 376067292
INV173 15 392012949
INV173 14 382723066
INV173 21 393287380
INV173 30 386815739
INV174 24 389620289
INV174 4 70209508
INV174 20 393833935
INV174 23 371772514
INV174 36 378152407
INV174 7 361576036
INV174 3 144800141
INV174 12 386123069
INV174 18 379682883
INV174 24 376237200
INV174 18 382676377
INV175 33 393229173
INV175 10 136249824
INV175 17 376448086
INV175 24 392500034
INV175 23 358451346
INV175 12 387353786
INV175 9 196688578
INV175 7 352292992
INV175 10 379488587
INV175 22 377064691
INV175 16 383674032
INV176 9 344807465
INV176 5 109367460
INV176 18 286866675
INV176 3 347598182
INV176 5 338175262
INV176 4 383058601
INV176 1 247560496
INV176 4 303728199
INV176 1 271964629
INV176 1 239161613
INV176 2 386396440
INV177 23 323415557
INV177 2 162310632
INV177 1 370326948
INV177 3 388116385
INV177 6 377917711
INV177 5 354494059
INV177 7 379606228
INV177 59 240919020
INV177 28 359911917
INV177 7 236235409
INV177 2 379651703
INV178 32 372756064
INV178 2 347329764
INV178 2 321027264
INV178 2 301226685
INV178 1 146202077
INV178 2 275982907
INV178 8 379231808
INV178 13 381766812
INV178 1 195322241
INV178 2 321367667
INV178 2 287611822
INV179 20 384740836
INV179 3 363118937
INV179 151 318674679
INV179 3 211854900
INV179 8 376981019
INV179 7 363245700
INV179 6 378101022
INV179 5 256321261
INV179 18 388042686
INV179 23 382786746
INV179 13 372130825
INV18 20 372860966
INV180 25 385708589
INV180 25 317222528
INV180 1 138004034
INV180 3 360707963
INV180 4 357311906
INV180 5 346948291
INV180 14 370286180
INV180 7 318431914
INV180 26 393842626
INV180 22 386509625
INV180 10 353087157
INV181 29 388680045
INV181 10 387832607
INV181 10 373670327
INV181 4 333077632
INV181 5 364543032
INV181 6 393941015
INV181 6 353983694
INV181 7 378037394
INV181 7 341953960
INV181 10 353005371
INV181 16 394332096
INV182 22 323658394
INV182 34 394329872
INV182 22 222473678
INV182 1 276355679
INV182 1 217944636
INV182 1 197031954
INV182 5 380718072
INV182 2 341485480
INV182 2 308085231
INV182 2 281366780
INV182 3 343008649
INV183 25 386606940
INV183 6 394632706
INV183 73 88563404
INV183 40 393860896
INV183 21 389178549
INV183 23 390279201
INV183 11 366024924
INV183 15 383815095
INV183 6 233774553
INV183 11 318926178
INV183 1 236655262
INV184 22 384360764
INV184 1 228831665
INV184 4 200268325
INV184 1 398148334
INV184 1 396779011
INV184 3 365240166
INV184 1 271406195
INV184 1 240115956
INV184 1 234010456
INV184 1 222850789
INV184 1 222041990
INV185 22 375170759
INV185 1 214774154
INV185 1 208864772
INV185 2 385457695
INV185 1 173785391
INV185 2 328914304
INV185 2 280661178
INV185 3 348023719
INV185 3 321038252
INV185 4 383266743
INV185 4 360652640
INV186 31 394116451
INV186 3 225220179
INV186 5 343830006
INV186 19 391034512
INV186 33 377901333
INV186 3 285907573
INV186 5 365873602
INV186 12 352551386
INV186 13 388990812
INV186 20 378129919
INV186 3 74847337
INV187 20 281624502
INV187 19 384569499
INV187 164 363844843
INV187 25 388002625
INV187 24 394108272
INV187 25 388456233
INV187 7 189882940
INV187 12 374058399
INV187 13 369064937
INV187 22 386405232
INV187 37 341590234
INV188 11 364532943
INV188 21 382080792
INV188 35 387100104
INV188 24 340374351
INV188 6 390070066
INV188 2 355024036
INV188 2 342960507
INV188 2 311494261
INV188 2 295519746
INV188 1 135025151
INV188 3 379490009
INV189 14 378464462
INV189 11 379372791
INV189 7 359888950
INV189 16 378789259
INV189 24 394107320
INV189 34 392989145
INV189 5 21585147
INV189 22 324895239
INV189 2 299186257
INV189 6 362460712
INV189 9 387111328
INV19 37320 262524560
INV190 38 390437780
INV190 11 368255149
INV190 7 355492621
INV190 2 292929496
INV190 3 371024363
INV190 6 379490557
INV190 20 390841565
INV190 18 386207184
INV190 22 382636201
INV190 20 361837808
INV190 3 116327985
INV191 20 259303673
INV191 11 374473831
INV191 15 350435315
INV191 5 353354685
INV191 9 376025838
INV191 22 394234238
INV191 9 294558694
INV191 3 302830112
INV191 4 392502765
INV191 4 347773011
INV191 5 368661550
INV192 35 382133951
INV192 3 265935754
INV192 2 347754842
INV192 3 382935602
INV192 4 342994718
INV192 3 276023194
INV192 2 276520271
INV192 13 383729738
INV192 6 132365555
INV192 22 376117024
INV192 21 384065815
INV193 38912 329097860
INV193 22 384355100
INV193 19 386550730
INV193 12 219074331
INV193 11 372633943
INV193 26 394076679
INV193 19 194735070
INV193 1 225226363
INV193 1 206506613
INV193 2 394396855
INV193 2 356850941
INV194 150888 102332908
INV194 2 319268338
INV194 2 306867190
INV194 2 284173246
INV194 2 273112872
INV194 3 356273435
INV194 26 393213294
INV194 15 343475066
INV194 4 393371353
INV194 16 386588044
INV194 20 390518809
INV195 33152 23772372
INV195 3 63486690
INV195 7 381885577
INV195 6 333293152
INV195 8 381680885
INV195 32 385557513
INV195 1 268738192
INV195 1 198165196
INV195 2 332727274
INV195 2 300381557
INV195 3 370469178
INV196 149053 103687585
INV196 19 387777686
INV196 10 178759522
INV196 16 316379498
INV196 2 313326125
INV196 2 290442673
INV196 2 268501743
INV196 2 265074071
INV196 1 131156662
INV196 3 369122587
INV196 3 354263792
INV197 152017 116270196
INV197 3 321235536
INV197 4 391689094
INV197 1 95440512
INV197 4 369504425
INV197 4 336085252
INV197 5 378466390
INV197 6 372816724
INV197 8 219343940
INV197 13 344941026
INV197 15 380996558
INV198 122371 84062369
INV198 23 275387129
INV198 3 347720517
INV198 6 343951003
INV198 8 370855222
INV198 13 378708468
INV198 15 377380168
INV198 12 390673203
INV198 3 185863584
INV198 7 376004104
INV198 18 289651850
INV199 154868 113573322
INV199 2 280521886
INV199 39 370507765
INV199 19 381996014
INV199 5 78439562
INV199 8 73497269
INV199 1 333366068
INV199 1 315088429
INV199 23 392086749
INV199 12 394366138
INV199 13 371312745
INV2 2292 316573060
INV20 129080 165753959
INV200 153312 120334655
INV200 7 118554082
INV200 1 540902015
INV200 1 497146285
INV200 2 330852102
INV200 2 307739636
INV200 24 393207303
INV200 13 310792642
INV200 7 372201851
INV200 9 379781793
INV200 2 75545352
INV201 54970 36684477
INV201 12 369904671
INV201 11 230690062
INV201 1 229430737
INV201 2 345099040
INV201 2 323143075
INV201 2 239411081
INV201 193 387416601
INV201 3 315203386
INV201 4 375274038
INV201 4 339765018
INV202 153084 110237138
INV202 13 368735014
INV202 15 388101236
INV202 15 386904996
INV202 4 350178401
INV202 5 327379525
INV202 4 293768589
INV202 8 390720175
INV202 11 350478746
INV202 6 372656319
INV202 8 372827652
INV203 153409 114899745
INV203 7 312827126
INV203 4 361968338
INV203 7 339834966
INV203 6 372062175
INV203 8 377486639
INV203 13 369569036
INV203 19 394219669
INV203 2 152436959
INV203 7 363134464
INV203 10 386347312
INV204 39199 33980745
INV204 3 335627890
INV204 11 389470032
INV204 5 385610870
INV204 2 300019394
INV204 2 265039893
INV204 3 373013123
INV204 3 328449850
INV204 5 379569712
INV204 4 338322175
INV204 2 139397890
INV205 141663 88564268
INV205 6 353558504
INV205 12 384314845
INV205 21 288502782
INV205 3 315914524
INV205 3 120094563
INV205 1 372685034
INV205 1 307400245
INV205 1 253737357
INV205 1 252426069
INV205 8 374880074
INV206 147687 93924004
INV206 26 382508937
INV206 3 377658906
INV206 19 392915017
INV206 22 303279447
INV206 29 384608396
INV206 15 211696759
INV206 1 311103460
INV206 1 307551131
INV206 9 388916524
INV206 15 260619519
INV207 44892 33924593
INV207 12 376072474
INV207 1 461908344
INV207 1 427865198
INV207 6 389250555
INV207 9 192108800
INV207 22 381300126
INV207 12 376387644
INV207 18 384659512
INV207 17 384031361
INV207 28 319884169
INV208 148164 97364723
INV208 1 76070991
INV208 6 348308341
INV208 15 394136312
INV208 22 382992187
INV208 12 357032699
INV208 17 390511797
INV208 16 379182564
INV208 14 348451180
INV208 15 376276846
INV208 8 384702289
INV209 139419 81636055
INV209 4 142595804
INV209 14 386059102
INV209 22 393487207
INV209 21 382000406
INV209 11 372882714
INV209 16 364444719
INV209 1 122546896
INV209 6 377956717
INV209 22 382460928
INV209 26 390282377
INV21 207 346774014
INV210 42868 25415260
INV210 20 317303269
INV210 17 382570375
INV210 9 331323617
INV210 2 343893327
INV210 5 369952675
INV210 1 71685601
INV210 22 385376258
INV210 26 352711703
INV210 7 394065018
INV210 30 377811522
INV211 138614 82881238
INV211 14 387559243
INV211 19 372702026
INV211 15 382221601
INV211 18 291199017
INV211 29 388601290
INV211 12 383509635
INV211 12 375548108
INV211 11 328422431
INV211 3 362647208
INV211 2 161837360
INV212 138424 82990551
INV212 10 371765599
INV212 11 236051395
INV212 1 316535607
INV212 1 268156038
INV212 1 266481161
INV212 1 217403395
INV212 24 383737014
INV212 19 380164404
INV212 14 358693904
INV212 11 389063827
INV213 52982 35049457
INV213 6 274604271
INV213 4 351378362
INV213 8 264020983
INV213 1 207417819
INV213 2 353449585
INV213 3 391801342
INV213 4 367022431
INV213 9 390256832
INV213 10 372688861
INV213 11 326542526
INV214 139289 83576609
INV214 3 343644368
INV214 1 264795841
INV214 1 260388659
INV214 3 187648385
INV214 1 332497885
INV214 1 246881801
INV214 1 241705591
INV214 1 233035232
INV214 8 373500108
INV214 14 393297487
INV215 135365 98978054
INV215 21 385893798
INV215 26 366214498
INV215 1 530134936
INV215 2 393930877
INV215 2 309944359
INV215 3 391793628
INV215 2 233312597
INV215 3 332336109
INV215 3 314101530
INV215 4 394293045
INV216 74607 58395598
INV216 31 378538997
INV216 6 88769108
INV216 20 388874814
INV216 18 315333486
INV216 2 297091254
INV216 3 371484263
INV216 1 104679623
INV216 4 333520379
INV216 3 387334624
INV216 1 266517024
INV217 142146 107853239
INV217 1 248291630
INV217 1 234708312
INV217 1 231279273
INV217 2 391687663
INV217 3 380107938
INV217 14 390955960
INV217 11 200080428
INV217 12 361936421
INV217 13 384895745
INV217 13 372934070
INV218 149502 121600365
INV218 14 307567254
INV218 27 391249785
INV218 1 309490030
INV218 1 208745215
INV218 2 349949719
INV218 3 181594157
INV218 1 213114244
INV218 13 390706337
INV218 18 390352182
INV218 20 391064963
INV219 155304 117910037
INV219 17 370370848
INV219 13 359247149
INV219 5 233195395
INV219 26 385532547
INV219 27 384434012
INV219 18 332432361
INV219 5 379406296
INV219 7 334065850
INV219 6 387228632
INV219 1 416981589
INV22 93 331307518
INV220 122381 174567319
INV220 1 411700809
INV220 1 374718084
INV220 1 371044941
INV220 1 365984801
INV220 1 352887774
INV220 1 342031869
INV220 1 318622295
INV220 1 293000873
INV220 1 292648081
INV220 1 276841339
INV221 39873 101192110
INV221 1 273120619
INV221 1 263802346
INV221 1 238685547
INV221 11 381347882
INV221 27 292340995
INV221 1 365315121
INV221 1 295723576
INV221 1 293424451
INV221 1 290278928
INV221 2 201180588
INV222 181112 235169059
INV222 1 352804369
INV222 1 335692043
INV222 1 263086104
INV222 1 216567736
INV222 14 372305493
INV222 27 387261075
INV222 3 31545372
INV222 17 197691260
INV222 1 269143606
INV222 1 261529156
INV223 218151 167649786
INV223 2 362612544
INV223 2 314308897
INV223 4 165657604
INV223 27 389528211
INV223 21 184663557
INV223 1 260819945
INV223 1 254310297
INV223 4 346159624
INV223 1 259880515
INV223 1 205072316
INV224 38629 187147326
INV224 2 387897589
INV224 5 391545896
INV224 5 358088864
INV224 3 176731733
INV224 7 364939484
INV224 2 37838460
INV224 1 525849209
INV224 1 480241822
INV224 1 479196665
INV224 1 472419714
INV225 800 42674647
INV225 1 437841927
INV225 1 433825958
INV225 1 428987597
INV225 1 389388581
INV225 1 381007749
INV225 1 348274448
INV225 1 322979321
INV225 1 321891989
INV225 1 316645346
INV225 1 301005785
INV226 566 40635863
INV226 7 388858315
INV226 10 164989793
INV226 14 154315916
INV226 1 382016842
INV226 1 354375104
INV226 1 298339950
INV226 1 279317925
INV226 11 368000574
INV226 11 372683164
INV226 11 238436650
INV227 8037 115580217
INV227 2 312736568
INV227 2 298933566
INV227 2 276750936
INV227 2 274749953
INV227 2 270733333
INV227 3 393991939
INV227 3 371168522
INV227 3 343383639
INV227 3 331951715
INV227 3 317855654
INV228 23265 332345847
INV228 3 303531066
INV228 4 390504887
INV228 4 358327236
INV228 2 161258937
INV228 5 374194520
INV228 12 376225043
INV228 16 382781894
INV228 10 312344892
INV228 3 346479552
INV228 7 360222895
INV229 23319 172531536
INV229 7 371444518
INV229 5 380658375
INV229 7 373393625
INV229 18 334055920
INV229 19 383711867
INV229 12 350773630
INV229 6 267559540
INV229 1 200011560
INV229 2 386963669
INV229 4 313852562
INV23 3 136766944
INV230 67585 303875862
INV230 1 126326439
INV230 3 350930075
INV230 6 393778613
INV230 1 693712867
INV230 1 690419613
INV230 1 688810701
INV230 1 639929110
INV230 1 625027500
INV230 1 623195831
INV230 1 617718696
INV231 121343 264933975
INV231 1 587611834
INV231 1 579867335
INV231 1 570975883
INV231 1 553997549
INV231 1 500834625
INV231 1 472070509
INV231 1 461332996
INV231 1 454322268
INV231 1 14271
INV231 6 379852134
INV232 66775 80327893
INV232 9 359769526
INV232 15 383100693
INV232 20 390343060
INV232 21 392824678
INV232 7 301782665
INV232 5 345594170
INV232 6 380136043
INV232 5 194942959
INV232 1 212714337
INV232 2 354279074
INV233 180562 231780487
INV233 4 345601582
INV233 6 375163100
INV233 9 383477264
INV233 5 199074271
INV233 5 365555370
INV233 11 382497727
INV233 19 387793109
INV233 20 380273396
INV233 15 347167974
INV233 21 374560346
INV234 41599 303967104
INV234 8 391676936
INV234 9 378336352
INV234 10 387572568
INV234 9 316779053
INV234 5 355290915
INV234 8 182974236
INV234 1 368254541
INV234 1 210857651
INV234 2 383968593
INV234 12 389608575
INV235 314 393292454
INV235 4 37106671
INV235 11 376651302
INV235 28 382539755
INV235 23 379355953
INV235 19 302733193
INV235 1 500415566
INV235 1 470534908
INV235 1 357693088
INV235 1 314807154
INV235 5 394125196
INV236 1015 105322314
INV236 17 385533773
INV236 20 354582908
INV236 9 192693427
INV236 1 256751940
INV236 1 252416835
INV236 1 239401621
INV236 1 227695852
INV236 1 226046865
INV236 1 216904698
INV236 1 212630555
INV237 2059 383654064
INV237 1 212420410
INV237 2 391271819
INV237 2 349936877
INV237 2 343277917
INV237 2 300647015
INV237 3 337654472
INV237 8 380584849
INV237 19 387104740
INV237 12 299597539
INV237 2 283707779
INV238 2 41011863
INV238 4 356833896
INV238 6 335112016
INV238 4 333927725
INV238 5 350658811
INV238 13 394239928
INV238 26 375177697
INV238 11 364858162
INV238 2 71048444
INV238 19 392043749
INV238 26 386637710
INV239 591 361654729
INV239 17 363568092
INV239 7 242682687
INV239 2 299965188
INV239 3 385937044
INV239 6 358651860
INV239 11 275532205
INV239 16 373371702
INV239 19 330530206
INV239 3 393218167
INV239 23 392890030
INV24 14 359428768
INV240 8 378508614
INV240 13 322719809
INV240 6 394385071
INV240 7 303524829
INV240 6 360998595
INV240 10 350686916
INV240 9 372424180
INV240 4 333822857
INV240 2 308909484
INV240 12 377249787
INV240 15 351819312
INV241 974 354275690
INV241 2 119938108
INV241 9 373164316
INV241 10 384583714
INV241 10 199858303
INV241 2 292527395
INV241 3 370685756
INV241 2 102671423
INV241 3 388648132
INV241 6 354386610
INV241 13 390558435
INV242 6 380479040
INV242 17 386058075
INV242 13 300042739
INV242 9 345076352
INV242 3 327456098
INV242 4 383120628
INV242 8 394600980
INV242 20 307473029
INV242 11 381286289
INV242 12 392811617
INV242 3 280207396
INV243 2 95552909
INV243 1 269568514
INV243 1 147079922
INV243 25 359567719
INV243 6 385710748
INV243 11 372518283
INV243 16 369696408
INV243 9 215537920
INV243 7 375467400
INV243 10 386632857
INV243 14 393279860
INV244 22 390382246
INV244 3 343925772
INV244 1 99977196
INV244 4 372532975
INV244 4 331465773
INV244 6 344851163
INV244 16 370008491
INV244 2 204305198
INV244 5 342506017
INV244 12 390795302
INV244 16 372744446
INV245 10036 362338941
INV245 11 344819483
INV245 17 392337105
INV245 5 373822918
INV245 6 374347171
INV245 15 385821377
INV245 2 80806228
INV245 13 373946632
INV245 14 388884333
INV245 3 349810089
INV245 1 253425051
INV246 376 361065125
INV246 1 192291135
INV246 2 367797560
INV246 2 300912613
INV246 4 264870547
INV246 8 371327938
INV246 16 380945155
INV246 2 42815412
INV246 15 368316233
INV246 6 365815154
INV246 8 367891023
INV247 200 339574406
INV247 8 364467632
INV247 22 250751733
INV247 20 377627858
INV247 12 231011654
INV247 1 442868002
INV247 1 416293306
INV247 1 378904118
INV247 1 378849418
INV247 3 373804301
INV247 6 370936332
INV248 28 363750328
INV248 9 372000882
INV248 18 380364635
INV248 15 256291129
INV248 8 372400586
INV248 10 285769792
INV248 2 328040175
INV248 3 371579434
INV248 5 388221128
INV248 2 270290477
INV248 3 357116672
INV249 25 362372590
INV249 3 315550310
INV249 4 363215280
INV249 7 367230423
INV249 7 387869069
INV249 6 244727908
INV249 4 350122895
INV249 5 340600640
INV249 7 362029520
INV249 7 386358330
INV249 8 371532205
INV25 9 363281720
INV250 18 224818646
INV250 3 175321154
INV250 3 330193299
INV250 4 386128953
INV250 4 342731255
INV250 6 371518052
INV250 7 228204125
INV250 2 384148414
INV250 2 371158735
INV250 2 298689172
INV250 3 337531854
INV251 552 321019135
INV251 8 383334215
INV251 32 389163326
INV251 10 308877735
INV251 4 370035584
INV251 8 364791053
INV251 9 391699459
INV251 18 382500240
INV251 9 108268135
INV251 1 468439176
INV251 1 472191871
INV252 2 371500015
INV252 1 465949720
INV252 1 462794763
INV252 1 453407184
INV252 1 429722027
INV252 1 412041099
INV252 1 370601896
INV252 1 361191451
INV252 1 295284678
INV252 1 287987902
INV252 1 282215724
INV253 2 289902239
INV253 1 268909579
INV253 1 255424980
INV253 213 394350305
INV253 11 72705422
INV253 23 374077214
INV253 11 379341267
INV253 13 370520558
INV253 16 389023589
INV253 6 73056617
INV253 2 285571836
INV254 2965 358959205
INV254 3 367720399
INV254 3 303257363
INV254 4 392359805
INV254 4 357874430
INV254 33 393085454
INV254 19 381110003
INV254 2 98271311
INV254 11 379939137
INV254 5 311894290
INV254 3 334025954
INV255 59309 333102202
INV255 3 299501991
INV255 4 393095154
INV255 4 372910076
INV255 14 387412155
INV255 21 381602035
INV255 10 392380997
INV255 14 377993322
INV255 21 385471787
INV255 8 371702929
INV255 20 394392347
INV256 34 383065485
INV256 1659 391646041
INV256 52777 104012353
INV257 19 393344928
INV258 14 327270017
INV259 27 393651567
INV26 52 355336707
INV260 32 390738662
INV261 24 383706815
INV262 25 382049854
INV263 31 378115211
INV264 13 297748085
INV265 18 387848062
INV266 24 381271345
INV267 36 390867092
INV268 34 389743485
INV269 26 391141334
INV27 14 371434550
INV270 19 292893418
INV271 11 371260264
INV272 19 391738075
INV273 12 391781067
INV274 13 372901688
INV275 32 389502535
INV276 22 330410978
INV277 29 389284801
INV278 38 387663352
INV279 17 367589223
INV28 78 134821644
INV280 12 387517245
INV281 17 362786034
INV282 10 320557524
INV283 13 376469258
INV284 35 380323776
INV285 26 392110960
INV286 24 388964019
INV287 21 391745060
INV288 22 309540561
INV289 27 392282931
INV29 6 384224499
INV290 24 388632304
INV291 12 375724207
INV292 16 393313708
INV293 13 392068868
INV294 10 277290815
INV295 15 358735036
INV296 11 386907833
INV297 40 377177573
INV298 21 392427759
INV299 5 215849302
INV3 104207 181560657
INV30 14 390998271
INV300 15 382505853
INV301 743 382889760
INV302 26 386022184
INV303 28 394591284
INV304 7 307846648
INV305 4 182170525
INV306 2 342421305
INV307 2 269826459
INV308 18 385786230
INV309 1901 346423954
INV31 25 372322353
INV310 8862 318236250
INV311 11615 311304128
INV312 29313 84782847
INV313 137005 98937413
INV314 129604 76456029
INV315 119657 73654253
INV316 151089 93753585
INV317 144097 102730522
INV318 68760 59330361
INV319 151276 123286643
INV32 19 385290616
INV320 150086 121704452
INV321 87352 71350285
INV322 149076 116311104
INV323 143134 122525125
INV324 103383 125193606
INV325 142136 131919290
INV326 143853 117370087
INV327 103139 176596556
INV328 1880 379192273
INV329 3223 263774757
INV33 27 390539373
INV330 96781 321023124
INV331 217342 232110336
INV332 60949 250981301
INV333 103988 292596017
INV334 28973 364551361
INV335 1764 378352969
INV336 2739 197024699
INV337 184144 268358078
INV338 1785 378880292
INV339 5583 374469857
INV34 34 346107857
INV340 20768 153711624
INV341 288223 205808194
INV342 1224 379793465
INV343 4515 373876603
INV344 92490 210334617
INV345 391527 140904810
INV346 109733 258294965
INV347 80040 286704883
INV348 3569 375757529
INV349 31480 357683960
INV35 4 251686535
INV350 16121 41281259
INV351 298725 199657065
INV352 214334 249067665
INV353 2226 377046597
INV354 19303 366955288
INV355 16948 41978773
INV356 298408 186907243
INV357 1355 379516794
INV358 3687 378313727
INV359 136930 300095839
INV36 3 241225934
INV360 38349 357698579
INV361 664 92151452
INV362 8529 370827851
INV363 197744 256830145
INV364 359558 128682792
INV365 93023 322972837
INV366 2568 378355489
INV367 61847 343439542
INV368 72069 24187260
INV369 120595 77017226
INV37 3 393880593
INV370 94952 39072123
INV371 95293 37117394
INV372 96302 35388473
INV373 95394 37384891
INV374 24011 12775723
INV375 95729 37221065
INV376 110869 72413124
INV377 138861 112768772
INV378 17377 14142808
INV379 141461 135500832
INV38 3 261336042
INV380 148155 115972046
INV381 132627 147941977
INV382 23 379895035
INV383 6 76972734
INV384 15 379655485
INV385 6 355188453
INV386 1 239744465
INV387 1 231634122
INV388 1 221096292
INV389 1 220877407
INV39 3 322765503
INV390 1 216720617
INV391 1 210676062
INV392 2 387811394
INV393 2 329972158
INV394 2 302384449
INV395 20 360081608
INV396 9 301825222
INV397 23 382490317
INV398 23 380735444
INV399 18 387931948
INV4 59786 271809546
INV40 2 265971290
INV400 33 390736486
INV401 795 381170065
INV402 20 391287680
INV403 2 32244328
INV404 27 388830496
INV405 21 386972019
INV406 9 351834369
INV407 5 163634948
INV408 1 292306469
INV409 1 164045107
INV41 4 328757598
INV410 2 318230244
INV411 868 391036523
INV412 30 390895475
INV413 25 383908286
INV414 25 388289419
INV415 3 49480870
INV416 25 384967191
INV417 26 391463882
INV418 22 392427991
INV419 26 383547221
INV42 5 378753109
INV420 26 265978999
INV421 6 371290168
INV422 13 374069663
INV423 19 385560269
INV424 15 373391572
INV425 13 350978987
INV426 22 386100611
INV427 24 386055502
INV428 23 389090030
INV429 31 366704932
INV43 5 371191486
INV430 12 307588661
INV431 24 393914970
INV432 16 362929629
INV433 8 361035446
INV434 13 369493806
INV435 13 384884009
INV436 18 390461886
INV437 22 394170044
INV438 11 336163521
INV439 6 353407420
INV44 4 376987297
INV440 7 372089599
INV441 3 84055545
INV442 9 390327029
INV443 19 393988728
INV444 11 137914990
INV445 1 346874609
INV446 1 248688513
INV447 1 195213701
INV448 21 389226046
INV449 16 380802157
INV45 4 293537168
INV450 17 384888603
INV451 24 390785021
INV452 14 272669524
INV453 19 394017224
INV454 17 391933486
INV455 7 291754234
INV456 2 360067285
INV457 1 158111693
INV458 5 390880948
INV459 1 269711166
INV46 4 373434888
INV460 1 265788494
INV461 5 389225578
INV462 8 84827761
INV463 32 385135770
INV464 29 391336068
INV465 26 380265073
INV466 8 257485661
INV467 20 383534134
INV468 18 388997674
INV469 13 372064491
INV47 42 369246043
INV470 12 246225518
INV471 18 394216238
INV472 18 380558243
INV473 10 378653212
INV474 35 286756574
INV475 57 386542022
INV476 41 394290459
INV477 30 391877099
INV478 23 388833300
INV479 17 384297034
INV48 71 345464815
INV480 310 391634117
INV481 26 381054851
INV482 8 105967983
INV483 29 389236155
INV484 23 387510109
INV485 25 393194949
INV486 29 393406758
INV487 10 389413895
INV488 12 256001243
INV489 25 382453876
INV49 11 126310825
INV490 25 387644779
INV491 17 390017898
INV492 13 185974631
INV493 1 252586203
INV494 2 382245123
INV495 1 170640157
INV496 3 172715237
INV497 1 265601162
INV498 1 235131548
INV499 8 377013040
INV5 86 394210993
INV50 33 389894099
INV500 18 389308576
INV501 6 76294397
INV502 2 316929497
INV503 5 371999024
INV504 13 377525467
INV505 22 380131966
INV506 4 94235370
INV507 20 386111019
INV508 10 330750052
INV509 8 388492156
INV51 24 300399380
INV510 29 385235322
INV511 3 68204675
INV512 1 375708846
INV513 177 377903380
INV514 3 72566929
INV515 18 393806697
INV516 12 375328864
INV517 13 388485421
INV518 17 389690952
INV519 10 355855682
INV52 7 368066952
INV520 12 388165924
INV521 5 66893570
INV522 2 334507981
INV523 2 271847796
INV524 9 384970046
INV525 14 380331769
INV526 17 331062789
INV527 4 353245537
INV528 5 361980503
INV529 1 66459093
INV53 17 353983817
INV530 6 375950524
INV531 11 380698960
INV532 13 393299321
INV533 16 371834617
INV534 4 107829629
INV535 16 390859621
INV536 35 393136677
INV537 18 389411089
INV538 80 348191458
INV539 10 366985680
INV54 7 374779506
INV540 18 382945053
INV541 3 55752453
INV542 23 351194891
INV543 4 361297550
INV544 19 383086968
INV545 16 391635138
INV546 22 382293034
INV547 15 196098011
INV548 12 326431359
INV549 3 345780114
INV55 1 208110490
INV550 4 385052575
INV551 6 392605260
INV552 17 135120912
INV553 1 319032388
INV554 1 282837000
INV555 1 278321370
INV556 1 265031889
INV557 1 264456228
INV558 1 255727343
INV559 1 255305493
INV56 2 302887577
INV560 1 230784347
INV561 9 392641003
INV562 28 356306819
INV563 2 278332741
INV564 8 361353987
INV565 10 379658367
INV566 13 380787037
INV567 8 386860579
INV568 6 361028373
INV569 3 168396230
INV57 3 341397147
INV570 7 375518624
INV571 10 375539956
INV572 5 355133492
INV573 12 346368422
INV574 4 128335036
INV575 18 344289019
INV576 6 343424801
INV577 6 355424926
INV578 9 361129815
INV579 1 209131117
INV58 3 306059974
INV580 2 365485920
INV581 2 326453370
INV582 2 310804349
INV583 3 355594170
INV584 7 341653095
INV585 49 372335313
INV586 6 201861407
INV587 19 385553829
INV588 11 389495243
INV589 41 318939638
INV59 4 375190511
INV590 7 359994759
INV591 11 363361177
INV592 18 352506103
INV593 2 121342079
INV594 11 370878851
INV595 38 392392993
INV596 39 383674587
INV597 29 392907305
INV598 24 381869223
INV599 13 164951452
INV6 84 293302731
INV60 4 333576383
INV600 41 380881169
INV601 15 386326246
INV602 9 137942415
INV603 1 410988561
INV604 2 347081175
INV605 2 60458881
INV606 1 429819325
INV607 1 230177572
INV608 2 394052085
INV609 35 354776612
INV61 5 348361494
INV610 7 318208416
INV611 5 336561253
INV612 7 357043306
INV613 7 262116983
INV614 1 170575982
INV615 2 287036945
INV616 2 275604705
INV617 3 367947227
INV618 3 342256987
INV619 5 256835876
INV62 14 387211070
INV620 13 321847088
INV621 5 332460113
INV622 95 319933371
INV623 12 328718900
INV624 9 217598510
INV625 20 352503315
INV626 9 379049671
INV627 14 374215308
INV628 15 347131978
INV629 3 328312092
INV63 13 392726641
INV630 4 369177951
INV631 3 246468438
INV632 5 376372316
INV633 11 376604103
INV634 17 381822991
INV635 22 391138986
INV636 6 54648714
INV637 12 377183847
INV638 30 388952266
INV639 3 326197890
INV64 66 317360954
INV640 3 271412684
INV641 6 360181556
INV642 18 382522482
INV643 24 379871629
INV644 21 312971658
INV645 22 381784561
INV646 21 380590911
INV647 13 371720425
INV648 17 390781836
INV649 3 78204341
INV65 4 328154363
INV650 17 377301939
INV651 12 357316205
INV652 6 368644317
INV653 9 270151474
INV654 12 189039214
INV655 1 244108438
INV656 1 210424776
INV657 2 347597490
INV658 2 286016373
INV659 2 120783828
INV66 3 230854823
INV660 22 392193755
INV661 13 360806743
INV662 11 375564408
INV663 9 362288897
INV664 3 377576368
INV665 4 158823784
INV666 12 376095937
INV667 6 372905819
INV668 7 388366567
INV669 7 351386075
INV67 5 362121003
INV670 12 377915288
INV671 10 168222845
INV672 21 336280653
INV673 11 387853015
INV674 17 383594904
INV675 12 371624632
INV676 4 205127384
INV677 1 255265360
INV678 1 230794410
INV679 2 372619140
INV68 211 385264302
INV680 2 311523487
INV681 13 393665610
INV682 24 199571394
INV683 2 323510804
INV684 12 381394394
INV685 12 281321844
INV686 6 301645505
INV687 3 327580854
INV688 2 283053804
INV689 4 358883688
INV69 55 389266884
INV690 3 313487646
INV691 12 372628339
INV692 11 296511468
INV693 12 205288598
INV694 1 329103898
INV695 1 266482116
INV696 1 255371252
INV697 1 249620899
INV698 11 381319634
INV699 28 382489592
INV7 170 364968923
INV70 16 251967525
INV700 15 383181010
INV701 13 350686833
INV702 1 90894639
INV703 5 367141834
INV704 4 355766912
INV705 6 390997169
INV706 1 283143227
INV707 7 385962722
INV708 18 390420686
INV709 14 352409616
INV71 24 388112032
INV710 3 310319640
INV711 1 94671628
INV712 4 375545906
INV713 2 330374624
INV714 9 385008187
INV715 36 348936130
INV716 7 362657616
INV717 12 375776805
INV718 21 386373372
INV719 28 385558874
INV72 39 380190174
INV720 2 30875957
INV721 30 377576257
INV722 16 383023174
INV723 25 385163881
INV724 20 289852567
INV725 11 387811488
INV726 13 388478264
INV727 20 388641472
INV728 37 387165660
INV729 14 208952549
INV73 33 379073437
INV730 33 393285708
INV731 13 364621498
INV732 12 378544770
INV733 14 393303348
INV734 17 283001740
INV735 25 393022599
INV736 6 259595995
INV737 2 306898484
INV738 22 392724989
INV739 11 81108636
INV74 87 331766739
INV740 1 334972678
INV741 1 327956322
INV742 4 369938243
INV743 10 387945021
INV744 6 333511012
INV745 3 390034570
INV746 6 388490213
INV747 37 293380102
INV748 3 330508129
INV749 3 304092200
INV75 20 393500649
INV750 4 386935527
INV751 16 364918260
INV752 10 392609098
INV753 30 381546124
INV754 2 331139274
INV755 5 390800394
INV756 2 93184197
INV757 9 363742103
INV758 11 374818742
INV759 13 353874383
INV76 19 386117294
INV760 29 353592845
INV761 6 313902203
INV762 2 325968719
INV763 2 326866526
INV764 2 294862287
INV765 2 277963616
INV766 1 135489923
INV767 5 389105293
INV768 21 334259074
INV769 19 374293438
INV77 20 393838616
INV770 21 257681977
INV771 15 378008119
INV772 18 345890599
INV773 9 374177525
INV774 13 282334662
INV775 13 367448714
INV776 14 383036237
INV777 9 337662876
INV778 4 285079875
INV779 13 380626621
INV78 9 185353717
INV780 20 391060643
INV781 17 236492487
INV782 1 253604678
INV783 1 244180387
INV784 2 385719063
INV785 2 323852856
INV786 3 391496974
INV787 69 343048078
INV788 3 58690555
INV789 1 427500052
INV79 16 368214362
INV790 1 280788551
INV791 1 231232069
INV792 2 365961697
INV793 2 306037738
INV794 2 294194033
INV795 8 383537417
INV796 10 382401646
INV797 15 373941744
INV798 2 278659155
INV799 5 350216916
INV8 5 352575630
INV80 17 373531597
INV800 5 342671345
INV801 7 377861791
INV802 14 385594223
INV803 25 241789371
INV804 2 304382108
INV805 5 380650692
INV806 6 108274197
INV807 30 387029729
INV808 27 330887562
INV809 3 314705854
INV81 17 378099553
INV810 4 344406745
INV811 5 389867528
INV812 5 353121931
INV813 14 392298773
INV814 2 53978732
INV815 17 382363442
INV816 13 374918202
INV817 15 379396417
INV818 103 385952128
INV819 20 386688731
INV82 11 222599361
INV820 18 382007266
INV821 57 153866701
INV822 5 219711870
INV823 2 319873814
INV824 6 380185718
INV825 3 381341903
INV826 1 111009446
INV827 5 379226736
INV828 12 393993623
INV829 22 391120037
INV83 17 378099553
INV830 20 316738233
INV831 1 263587734
INV832 2 374750442
INV833 2 338140745
INV834 2 298578205
INV835 5 384869169
INV836 30 387739996
INV837 13 296449972
INV838 18 279137441
INV839 2 322765580
INV84 18 381766905
INV840 3 390029089
INV841 4 345523436
INV842 2 287481868
INV843 3 368157705
INV844 4 330380185
INV845 2 273986171
INV846 11 380263283
INV847 21 357807916
INV848 12 391993231
INV849 8 369418028
INV85 18 381766905
INV850 9 378821074
INV851 10 378877305
INV852 2 122089777
INV853 7 366744808
INV854 22 393387120
INV855 28 374632208
INV856 17 380406226
INV857 10 104480107
INV858 1 298134333
INV859 6 372478433
INV86 11 244247504
INV860 7 273110839
INV861 1 174811163
INV862 1 246577358
INV863 3 380592957
INV864 8 336515494
INV865 5 388249994
INV866 7 360174377
INV867 8 393835422
INV868 7 326451249
INV869 18 390226185
INV87 18 381766905
INV870 4 212448392
INV871 2 361639366
INV872 11 389090510
INV873 24 261483440
INV874 20 187767331
INV875 1 300440965
INV876 1 255158195
INV877 1 235639307
INV878 1 234027751
INV879 5 364518894
INV88 18 381766905
INV880 1 52122333
INV881 17 394627877
INV882 24 372312688
INV883 5 353472817
INV884 6 348815087
INV885 3 142239958
INV886 10 371554285
INV887 10 389038857
INV888 15 393343847
INV889 354 351174080
INV89 17 378099553
INV890 61 370950558
INV891 13 377490054
INV892 17 362779264
INV893 1 215246178
INV894 1 179976030
INV895 2 326215908
INV896 12 393295794
INV897 17 355147463
INV898 7 364022270
INV899 8 232711543
INV9 7 383441747
INV90 10 214458835
INV900 10 320236834
INV901 5 374560279
INV902 5 347050153
INV903 6 365683735
INV904 8 350757240
INV905 8 330705725
INV906 7 319315304
INV907 8 294380847
INV908 8 300070536
INV909 5 296140165
INV91 17 373531597
INV910 7 321898042
INV911 8 344779364
INV912 5 204172647
INV913 8 363714706
INV914 8 335684798
INV915 7 325614821
INV916 8 343203705
INV917 8 295765726
INV918 4 296872836
INV919 1 277791574
INV92 17 376354888
INV920 2 374437900
INV921 3 384355230
INV922 4 287970803
INV923 8 310860357
INV924 1 87642240
INV925 3 322074102
INV926 5 350860081
INV927 3 341421742
INV928 3 303252646
INV929 3 274953531
INV93 17 378128112
INV930 5 354560190
INV931 4 293401691
INV932 5 291612199
INV933 6 363161146
INV934 7 367190402
INV935 1 63881323
INV936 7 369938164
INV937 24 385109501
INV938 29 371254400
INV939 3 369936174
INV94 11 244218945
INV940 3 324539581
INV941 4 365244967
INV942 5 389493350
INV943 6 394661900
INV944 13 382083182
INV945 31 381763837
INV946 28 392125926
INV947 4 128300843
INV948 4 359450428
INV949 5 357390477
INV95 18 377201651
INV950 10 360971319
INV951 10 388368184
INV952 12 376602273
INV953 78 347723211
INV954 3 159381941
INV955 8 277689252
INV956 2 308292894
INV957 4 378776770
INV958 3 224250587
INV959 2 353669327
INV96 19 384750213
INV960 3 365790299
INV961 5 373092601
INV962 25 383158187
INV963 13 390048803
INV964 10 389033966
INV965 13 387771417
INV966 15 383558849
INV967 8 145928775
INV968 16 387212131
INV969 17 373736547
INV97 19 386574986
INV970 10 387894809
INV971 13 380870662
INV972 36 385258928
INV973 13 163501620
INV974 28 381827489
INV975 22 374847337
INV976 2 310213387
INV977 4 223537066
INV978 1 311186714
INV979 4 305252952
INV98 11 217953999
INV980 1 117261666
INV981 4 325431757
INV982 5 343105299
INV983 8 390057518
INV984 11 390412576
INV985 18 344362951
INV986 4 389304644
INV987 8 374713972
INV988 4 67335450
INV989 1 354881887
INV99 18 390383119
INV990 1 306296502
INV991 2 379020699
INV992 10 369838626
INV993 2 26750373
INV994 1 249865697
INV995 3 387636064
INV996 14 388824602
INV997 16 387485480
INV998 8 379220830
INV999 6 382970618
MAM1 32376 323872706
MAM10 26814 24994146
MAM100 4 359964523
MAM101 4 383777488
MAM102 5 381968701
MAM103 4 345040697
MAM104 3 176472919
MAM105 6 356825309
MAM106 3 354814440
MAM107 3336 333279354
MAM108 67877 268551867
MAM109 99604 191348858
MAM11 13731 20581276
MAM110 38644 138145878
MAM111 1 179953079
MAM112 4 274800947
MAM113 4 294612101
MAM114 4 368804057
MAM115 5 360824188
MAM116 3 381844289
MAM117 4 323611747
MAM118 5 314441637
MAM119 278 273083750
MAM12 3445 7368868
MAM120 1 216965501
MAM121 1 210729441
MAM122 2 349064804
MAM123 2 311803703
MAM124 2 284093331
MAM125 3 348809871
MAM126 4 369368223
MAM127 5 363867118
MAM128 1 61486999
MAM129 391 303038843
MAM13 107 699953
MAM130 2 387082860
MAM131 2 304198725
MAM132 3 374133223
MAM133 3 326166110
MAM134 4 378433792
MAM135 4 343736516
MAM136 26 156134288
MAM137 2 295910882
MAM138 3 365955123
MAM139 3 347352947
MAM14 20 277696380
MAM140 3 322237442
MAM141 4 341689478
MAM142 5 362834364
MAM143 7 390905713
MAM144 3 258595851
MAM145 2 333773690
MAM146 3 387942990
MAM147 3 354718536
MAM148 2 226942227
MAM149 3 311333393
MAM15 1 249270926
MAM150 4 346893067
MAM151 5 358087510
MAM152 7 370527586
MAM153 266 52932980
MAM154 2 381699852
MAM155 2 379453767
MAM156 2 323756069
MAM157 3 363198547
MAM158 2 215864552
MAM159 4 373314142
MAM16 2 343930246
MAM160 5 370562270
MAM161 3 229138897
MAM162 2 357862388
MAM163 1 148378616
MAM164 2 277983130
MAM165 3 347551233
MAM166 3 317094091
MAM167 4 359797234
MAM168 5 367203739
MAM169 2 35182349
MAM17 3 325384739
MAM170 3 344892062
MAM171 3 310823791
MAM172 4 343820600
MAM173 5 380959867
MAM174 5 326724081
MAM175 2 125670854
MAM176 6 349136452
MAM177 5 249014812
MAM178 4 263893466
MAM179 2 255070854
MAM18 1 90795278
MAM180 2 283025985
MAM181 3 333227068
MAM182 3 347405297
MAM183 3 311786266
MAM184 3 370283980
MAM185 3 367382503
MAM186 3 376930704
MAM187 2 186941709
MAM188 1 212679785
MAM189 1 200210433
MAM19 4 322903327
MAM190 2 301321370
MAM191 2 204542634
MAM192 4 342554685
MAM193 6 373951174
MAM194 9 394516191
MAM195 1 178365832
MAM196 2 317576479
MAM197 3 382289813
MAM198 3 333151314
MAM199 4 387058184
MAM2 22271 277087027
MAM20 4 298795355
MAM200 1 88847605
MAM201 5 393069609
MAM202 5 297820775
MAM203 2 370199356
MAM204 2 296330659
MAM205 3 378321649
MAM206 3 341779801
MAM207 4 389646286
MAM208 3 260392119
MAM209 5 252937523
MAM21 6 353843759
MAM210 1 210889723
MAM211 2 390094915
MAM212 3 369279389
MAM213 1 134025529
MAM214 3 382647393
MAM215 3 348525342
MAM216 4 385414949
MAM217 8 367669076
MAM218 3 338644129
MAM219 4 384410696
MAM22 5 329700903
MAM220 4 321255648
MAM221 5 366955574
MAM222 2 129330055
MAM223 6 369468462
MAM224 7 368094007
MAM225 3 278321486
MAM226 2 356989359
MAM227 2 294642091
MAM228 3 374469516
MAM229 3 321593661
MAM23 2 289079565
MAM230 4 372512269
MAM231 5 394669051
MAM232 6 352162926
MAM233 3 338100906
MAM234 3 320896055
MAM235 4 391714968
MAM236 5 389929348
MAM237 161 346315705
MAM238 1 234112155
MAM239 1 222567163
MAM24 3 348530310
MAM240 2 360432915
MAM241 3 330590648
MAM242 4 366004254
MAM243 5 346781633
MAM244 18 241194090
MAM245 1 248793850
MAM246 1 230256221
MAM247 1 228110630
MAM248 2 379305370
MAM249 2 357708012
MAM25 4 336581445
MAM250 2 332346077
MAM251 8 383124560
MAM252 1 188105751
MAM253 2 350144535
MAM254 2 286698385
MAM255 3 356425192
MAM256 3 316253659
MAM257 4 371964282
MAM258 5 393252436
MAM259 4 100914822
MAM26 5 375256260
MAM260 1 217416870
MAM261 1 206141883
MAM262 2 387441900
MAM263 2 314669017
MAM264 2 288652274
MAM265 3 377887044
MAM266 1 108092423
MAM267 4 349510186
MAM268 5 186101589
MAM269 1 209197390
MAM27 6 373952570
MAM270 1 196764438
MAM271 2 292822034
MAM272 4 354472100
MAM273 5 333461393
MAM274 8 295257259
MAM275 3 320447314
MAM276 2 387241361
MAM277 4 374496829
MAM278 5 363097693
MAM279 6 296258101
MAM28 8 377813420
MAM280 42 341927000
MAM281 2 302500556
MAM282 2 245239052
MAM283 2 308701436
MAM284 2 284439369
MAM285 3 238578438
MAM286 2 389306359
MAM287 5 369816620
MAM288 3 332089460
MAM289 3 387381783
MAM29 5 379300313
MAM290 2 242812335
MAM291 3 336751953
MAM292 4 394670760
MAM293 4 337872094
MAM294 5 356954418
MAM295 7 371121970
MAM296 3 384043289
MAM297 1 202113133
MAM298 1 201284082
MAM299 2 383142327
MAM3 2 316219032
MAM30 1 38035513
MAM300 3 365726228
MAM301 6 360549912
MAM302 7 148771979
MAM303 2 365059240
MAM304 2 320264148
MAM305 3 385458195
MAM306 3 331738258
MAM307 4 389192595
MAM308 4 343432318
MAM309 5 237217393
MAM31 5 285741626
MAM310 1 285828854
MAM311 1 283024685
MAM312 1 272118962
MAM313 2 321584478
MAM314 3 338938976
MAM315 4 356492296
MAM316 5 350815716
MAM317 4 235575269
MAM318 4 286784425
MAM319 3 352570918
MAM32 5 342804543
MAM320 4 382692330
MAM321 5 314285930
MAM322 4 355174350
MAM323 6 373599730
MAM324 8 307740706
MAM325 1 127492700
MAM326 1 277742375
MAM327 2 275763996
MAM328 3 356884658
MAM329 3 327535230
MAM33 8 370485433
MAM330 4 374210751
MAM331 3 245385509
MAM332 5 340631299
MAM333 7 366764522
MAM334 12 362960749
MAM335 3 333986335
MAM336 4 379227081
MAM337 1 86234462
MAM338 5 346249165
MAM339 5 391590872
MAM34 6 316655225
MAM340 7 353830373
MAM341 5 274535835
MAM342 2 309838295
MAM343 2 233798732
MAM344 4 389932720
MAM345 5 321277221
MAM346 4 370617065
MAM347 6 378690181
MAM348 8 318905079
MAM349 9950 141323546
MAM35 4 238884849
MAM36 4 355768297
MAM37 6 355037276
MAM38 7 389945117
MAM39 6 319172640
MAM4 2 376685399
MAM40 5 323047396
MAM41 4 347221982
MAM42 5 288444151
MAM43 5 375232988
MAM44 5 248962388
MAM45 1 277956744
MAM46 1 154038104
MAM47 3 374028897
MAM48 2 298256496
MAM49 3 355148320
MAM5 2 295769989
MAM50 3 355658200
MAM51 3 369352591
MAM52 7 388919640
MAM53 1 59476289
MAM54 9 26809642
MAM55 54 7614329
MAM56 215 34073042
MAM57 431 71272130
MAM58 861 68509101
MAM59 1706 2411269
MAM6 2 385026516
MAM60 6879 6176592
MAM61 110526 193403794
MAM62 33191 281608286
MAM63 4 358286156
MAM64 5 387739617
MAM65 5 335893012
MAM66 6 364021592
MAM67 6 304412506
MAM68 10 386743576
MAM69 132487 153927560
MAM7 3 316699161
MAM70 117910 169420560
MAM71 8968 8089116
MAM72 1 716413629
MAM73 1 662751787
MAM74 1 611347268
MAM75 1 464895054
MAM76 1 288121652
MAM77 3 338107697
MAM78 1 223449203
MAM79 1 210645437
MAM8 5 343489620
MAM80 1 201318998
MAM81 1 197708286
MAM82 2 320231256
MAM83 2 293750401
MAM84 3 367535284
MAM85 4 351244600
MAM86 367 269065793
MAM87 1 203623556
MAM88 2 383513587
MAM89 4 383666147
MAM9 933 216317382
MAM90 5 381503248
MAM91 263 390074346
MAM92 2 265153725
MAM93 4 366992153
MAM94 5 369689861
MAM95 5 392803577
MAM96 6 298207437
MAM97 3 363734450
MAM98 1 118519168
MAM99 3 328935722
PAT1 420060 157354283
PAT10 304138 130867531
PAT100 352852 189327041
PAT101 310862 206556098
PAT102 261889 226571161
PAT103 130469 96637053
PAT104 304402 217824161
PAT105 276793 236021165
PAT106 255575 243191966
PAT107 219302 91982645
PAT108 185286 167791554
PAT109 193743 145685458
PAT11 236000 217102698
PAT110 99369 56253543
PAT111 244010 110313663
PAT112 143101 226372350
PAT113 78462 27199293
PAT114 88269 271848145
PAT115 224845 124890789
PAT116 225593 104788872
PAT117 1441 4528610
PAT118 247765 75673289
PAT119 230776 33741646
PAT12 83481 75660869
PAT120 94886 123403652
PAT121 98574 119749391
PAT122 81936 115812708
PAT123 202974 107720499
PAT124 26278 9055986
PAT125 203753 100524714
PAT126 183494 80758738
PAT127 117402 19496593
PAT128 249513 208801622
PAT129 384327 114594921
PAT13 242994 211781414
PAT130 54389 7593250
PAT131 283234 179644992
PAT132 123902 298028332
PAT133 110603 304050297
PAT134 393153 122355956
PAT135 289901 158315098
PAT136 13447 9055574
PAT137 287137 182628882
PAT138 409364 14056923
PAT139 496790 33315054
PAT14 328191 148438413
PAT140 525210 7878150
PAT141 153480 3896903
PAT142 377383 123749333
PAT143 245739 106353938
PAT144 259895 238802744
PAT145 4634 392128968
PAT146 190899 207809354
PAT147 308470 120437803
PAT148 140524 153724833
PAT149 6434 91722304
PAT15 63815 1595375
PAT150 177885 181303248
PAT151 71547 185116657
PAT152 75797 115786173
PAT153 75754 115775578
PAT154 46230 38674753
PAT155 245081 68541184
PAT156 202132 63183317
PAT157 264556 57807313
PAT158 309554 83973842
PAT159 458771 54678346
PAT16 197466 165309196
PAT160 227775 118065838
PAT161 359502 132218826
PAT162 288077 50680665
PAT163 154912 4648065
PAT164 228338 77240168
PAT165 228223 72940407
PAT166 281345 18592144
PAT167 65063 7149854
PAT168 153380 170208828
PAT169 73414 134988828
PAT17 217861 141775047
PAT170 74138 123431971
PAT171 137210 84284016
PAT172 175218 2628270
PAT173 233539 99258025
PAT174 198423 145045421
PAT175 229757 110454443
PAT176 105679 68107471
PAT177 80124 122466507
PAT178 260801 46028845
PAT179 294811 4422165
PAT18 217807 104611362
PAT180 7898 118470
PAT181 278538 10765362
PAT182 99587 135915370
PAT183 220908 105875885
PAT184 23922 35278744
PAT185 143999 206566501
PAT186 173285 186742155
PAT187 70129 243259642
PAT188 6542 8869371
PAT189 137168 133366031
PAT19 238917 105580979
PAT190 136588 204923041
PAT191 208570 98960207
PAT192 284101 31395281
PAT193 26294 42269676
PAT194 264589 66935450
PAT195 227269 82111943
PAT196 179588 5746816
PAT197 194345 81150973
PAT198 52348 9088648
PAT199 82690 146051882
PAT2 329678 203029667
PAT20 217484 131790664
PAT200 75930 116106222
PAT201 76058 115438165
PAT202 205771 85563217
PAT203 2801 56020
PAT204 342231 6844620
PAT205 341891 7168782
PAT206 341071 7503562
PAT207 331154 110021550
PAT208 268658 230373189
PAT209 282624 222310160
PAT21 295531 53374496
PAT210 192664 139614235
PAT211 276098 235021090
PAT212 188385 291326630
PAT213 137484 196232251
PAT214 247191 246690030
PAT215 11728 387687504
PAT216 313354 152356909
PAT217 244602 252477336
PAT218 160029 300870611
PAT219 215545 135077252
PAT22 146946 94872615
PAT220 172971 290885692
PAT221 266020 215702006
PAT222 351330 145811389
PAT223 304088 76036760
PAT224 317818 206630332
PAT225 43590 365712261
PAT226 151381 180550783
PAT227 338212 193787787
PAT228 332520 206353769
PAT229 155792 199233054
PAT23 196051 155681695
PAT230 249094 251157045
PAT231 209852 277995521
PAT232 184404 195925874
PAT233 326554 210405939
PAT234 203551 272092254
PAT235 99377 335866542
PAT236 108195 332037529
PAT237 262379 184432748
PAT238 10553 3893045
PAT239 223882 118359990
PAT24 279811 73243514
PAT240 272867 62593613
PAT241 204516 140753584
PAT242 283956 19296326
PAT243 274474 22246020
PAT244 281624 22162860
PAT245 286516 14626296
PAT246 287152 13483600
PAT247 96569 20012641
PAT248 263509 44902329
PAT249 293106 5569014
PAT25 228196 146710879
PAT250 337156 75444653
PAT251 207126 270199202
PAT252 330273 192780592
PAT253 253593 160160166
PAT254 145599 308869479
PAT255 133194 316274917
PAT256 287030 181324411
PAT257 278625 235758296
PAT258 444293 137538220
PAT259 56775 54041209
PAT26 208817 140778194
PAT260 353261 181172286
PAT261 365898 138658815
PAT262 95872 1821568
PAT263 256574 81412641
PAT264 243865 100043489
PAT265 212772 64503605
PAT266 207906 131282090
PAT267 210157 114857497
PAT268 310072 217434276
PAT269 81363 153171502
PAT27 63078 54091824
PAT28 304662 206975876
PAT29 321045 202870000
PAT3 50199 20266137
PAT30 69609 127456994
PAT31 217213 274043600
PAT32 399532 38379558
PAT33 255489 168747958
PAT34 232019 138092864
PAT35 62927 29393602
PAT36 159604 193117909
PAT37 187245 152012324
PAT38 211992 134514047
PAT39 97888 9820583
PAT4 329459 180384211
PAT40 349663 21561780
PAT41 269136 102155510
PAT42 166 390395449
PAT43 7284 386170254
PAT44 91554 5256927
PAT45 304606 19422510
PAT46 304621 19407682
PAT47 188127 183518372
PAT48 31168 33403072
PAT49 100015 274294276
PAT5 261751 200081584
PAT50 347902 22047460
PAT51 356635 6776065
PAT52 92449 1756531
PAT53 351467 15875870
PAT54 360979 6858601
PAT55 133572 2537868
PAT56 360626 6851894
PAT57 359974 6839506
PAT58 125418 2711844
PAT59 535700 100616524
PAT6 217875 164406081
PAT60 111356 330233433
PAT61 289774 158820679
PAT62 481490 50382866
PAT63 225648 89298259
PAT64 254276 194530926
PAT65 328258 204073801
PAT66 172120 140793304
PAT67 349862 190728733
PAT68 612603 75778089
PAT69 132887 40797313
PAT7 247415 122521643
PAT70 484033 127126269
PAT71 126354 109119371
PAT72 150168 307250321
PAT73 318626 211710240
PAT74 51881 214846609
PAT75 189165 289007376
PAT76 317843 207880789
PAT77 123868 129694058
PAT78 342751 192409991
PAT79 362616 180214431
PAT8 224236 103100293
PAT80 20467 17346132
PAT81 311143 212599739
PAT82 414691 138165335
PAT83 481148 57356648
PAT84 327470 49354827
PAT85 456810 82498320
PAT86 157644 116021307
PAT87 166938 185706898
PAT88 314966 151662901
PAT89 225065 179111834
PAT9 153367 78064676
PAT90 161503 40776365
PAT91 548289 10417491
PAT92 499577 9491963
PAT93 509421 32468072
PAT94 211222 45802544
PAT95 257666 203185753
PAT96 387961 140929435
PAT97 39821 44654582
PAT98 361773 186862184
PAT99 415062 154422395
PHG1 8932 217072470
PHG2 4732 226378616
PHG3 5295 215573904
PHG4 4752 231298811
PHG5 7206 228620565
PHG6 4325 226669850
PHG7 10122 151330556
PLN1 135591 171504469
PLN10 18946 157439113
PLN100 20 316869596
PLN100 1 758906661
PLN100 1 861141126
PLN100 1 642382296
PLN100 1 759893476
PLN100 1 689766370
PLN100 1 531462149
PLN100 1 714517032
PLN100 1 717288350
PLN100 1 586345039
PLN100 1 626266972
PLN101 5 284426683
PLN101 1 738085275
PLN101 1 505809789
PLN101 1 759124079
PLN101 1 751612808
PLN101 1 653055523
PLN101 7 358620060
PLN101 687 177292972
PLN101 1 478410592
PLN101 1 530843944
PLN101 1 529541203
PLN102 8 327303441
PLN102 1 616320322
PLN102 1 560314678
PLN102 1 552570299
PLN102 1 477706438
PLN102 1 464083788
PLN102 1 411577152
PLN102 1 461076154
PLN102 1 463363089
PLN102 1 481348281
PLN102 1 411112127
PLN103 61 76849044
PLN103 1 485809178
PLN103 1 525998845
PLN103 1 469027344
PLN103 1 409103995
PLN103 1 460274876
PLN103 1 476570508
PLN103 1 445971407
PLN103 1 490396672
PLN103 1 426632976
PLN103 1 538887009
PLN104 2 355063454
PLN104 1 574640544
PLN104 1 667652801
PLN104 1 573769737
PLN104 1 579564072
PLN104 1 506557729
PLN104 1 469999753
PLN104 1 516880681
PLN104 1 454437434
PLN104 1 415133431
PLN104 1 489887590
PLN105 1 333667882
PLN105 1 289026301
PLN105 1 490033736
PLN105 1 542991241
PLN105 1 484002173
PLN105 1 527161174
PLN105 1 513237590
PLN105 1 458108957
PLN105 1 448178421
PLN105 1 577845554
PLN105 1 529955746
PLN106 1 302574826
PLN106 1 534821622
PLN106 1 551069265
PLN106 1 588203704
PLN106 1 459891171
PLN106 1 555382095
PLN106 1 455803086
PLN106 1 509477500
PLN106 1 582703961
PLN106 1 567151184
PLN106 1 459232789
PLN107 1 296818136
PLN107 1 577255397
PLN107 1 441736736
PLN107 1 534335728
PLN107 19 2859863
PLN107 1 613662638
PLN107 1 794474755
PLN107 1 760111594
PLN107 1 769810128
PLN107 1 715684684
PLN107 1 623890083
PLN108 1 257455782
PLN108 1 755457679
PLN108 1 717109572
PLN108 1 817712742
PLN108 1 864624966
PLN108 1 701857263
PLN108 1 726425509
PLN108 1 738041677
PLN108 1 767912069
PLN108 1 504659958
PLN108 1 662526948
PLN109 1 252943167
PLN109 1 633282846
PLN109 1 534651777
PLN109 1 584285409
PLN109 1 507261758
PLN109 1 659687352
PLN109 1 224073253
PLN109 1 198628823
PLN109 1 322486422
PLN109 1 260047251
PLN109 1 262402055
PLN11 29376 278343654
PLN110 1 225803546
PLN110 1 330012911
PLN110 1 349800169
PLN110 1 354403191
PLN110 1 317988395
PLN110 1 376468909
PLN110 313 342168471
PLN110 5 315557653
PLN110 18 309282167
PLN110 10 333088290
PLN110 79 344751863
PLN111 1 219123305
PLN111 39 343075450
PLN111 5 325733636
PLN111 389 384262295
PLN111 10 375480087
PLN111 10 379071384
PLN111 9 351388705
PLN111 2 74237962
PLN111 1 472108912
PLN111 1 611709054
PLN111 1 571129681
PLN112 2 394302667
PLN112 1 563957086
PLN112 1 535211053
PLN112 1 496554540
PLN112 1 578502594
PLN112 143 369836079
PLN112 10 389503495
PLN112 10 374804231
PLN112 8 300501703
PLN112 10 369372075
PLN112 1042 169430586
PLN113 55 43040327
PLN113 1 605966608
PLN113 1 703076930
PLN113 1 495911329
PLN113 1 796169439
PLN113 1 779372321
PLN113 1 665561653
PLN113 1 757165295
PLN113 1 852704148
PLN113 1 623698249
PLN113 1 745048881
PLN114 15 305289289
PLN114 1 677947850
PLN114 1 524289323
PLN114 1 726838826
PLN114 1 701430346
PLN114 1 584133940
PLN114 1 622677745
PLN114 1 745712656
PLN114 1 490622797
PLN114 1 748850018
PLN114 1 753856519
PLN115 2 286029496
PLN115 1 643890519
PLN115 699 30235861
PLN115 1 593930347
PLN115 1 702775664
PLN115 1 494594617
PLN115 1 792837209
PLN115 1 812232696
PLN115 1 661835603
PLN115 1 750337041
PLN115 1 854463248
PLN116 2 307738366
PLN116 1 623248023
PLN116 1 749950614
PLN116 1 673746810
PLN116 1 520815567
PLN116 1 712547961
PLN116 1 703299309
PLN116 1 569771178
PLN116 1 620176429
PLN116 1 717542863
PLN116 1 493761083
PLN117 2 269669619
PLN117 1 746502734
PLN117 1 752612656
PLN117 1 648661963
PLN117 572 38290762
PLN117 1 540897063
PLN117 1 449127287
PLN117 1 425675180
PLN117 1 463192880
PLN117 1 485323027
PLN117 1 448461343
PLN118 1 157681923
PLN118 1 493511962
PLN118 1 462796039
PLN118 1 589118817
PLN118 1 638425132
PLN118 1 716105986
PLN118 1 613160974
PLN118 1 626220839
PLN118 1 551718542
PLN118 1 484215583
PLN118 1 532103454
PLN119 40 376080648
PLN119 1 480949782
PLN119 1 455353809
PLN119 1 499214392
PLN119 1 298028472
PLN119 1 528225653
PLN119 237 375880438
PLN119 6 375232671
PLN119 299 384945076
PLN119 9 251431714
PLN119 132 156051013
PLN12 2660 334399488
PLN120 33 389701062
PLN120 1 593930347
PLN120 1 702775664
PLN120 1 494594617
PLN120 1 792837209
PLN120 1 812232696
PLN120 1 661835603
PLN120 1 750337041
PLN120 1 854463248
PLN120 1 623248023
PLN120 1 749950614
PLN121 106 384154506
PLN121 1 673746810
PLN121 1 520815567
PLN121 1 712547961
PLN121 1 703299309
PLN121 1 569771178
PLN121 1 620176429
PLN121 1 717542863
PLN121 1 493761083
PLN121 1 746502734
PLN121 1 752612656
PLN122 55 188199075
PLN122 1 648661963
PLN122 53 362278903
PLN122 6681 233648974
PLN122 1 445829560
PLN122 1 657893865
PLN122 1 636117214
PLN122 1 520569408
PLN122 1 614738994
PLN122 1 536175046
PLN122 1 610578938
PLN123 2 324178388
PLN123 4 16378138
PLN123 58 389996895
PLN123 14 385024567
PLN123 30 368986150
PLN123 14 379761940
PLN123 14 388380456
PLN123 5 138123356
PLN123 14 386817082
PLN123 14 393670454
PLN123 28 388378543
PLN124 3 383186249
PLN124 21 371825237
PLN124 14 382705053
PLN124 5 137783507
PLN124 13 362021382
PLN124 14 384652328
PLN124 14 385328574
PLN124 14 387607699
PLN124 13 362161900
PLN124 7 192427420
PLN124 14 391787584
PLN125 2 268356222
PLN125 14 371741286
PLN125 10 360532952
PLN125 5 370119782
PLN125 8 393655910
PLN125 6 194621872
PLN125 23 318601285
PLN125 4 331833036
PLN125 6 383779503
PLN125 7 364418253
PLN125 6 168945745
PLN126 2 324123174
PLN126 11 364495457
PLN126 13 371343624
PLN126 14 390506009
PLN126 50 388504808
PLN126 129 388429313
PLN126 2 272777406
PLN126 3 366184951
PLN126 4 390049233
PLN126 24 380686187
PLN126 10 347834156
PLN127 3 363018427
PLN127 86 388181498
PLN127 4 325693820
PLN127 2 159399660
PLN127 5 345056615
PLN127 6 348214746
PLN127 7 349249048
PLN127 8 356243003
PLN127 3 198571596
PLN127 3 333480027
PLN127 53 388888259
PLN128 27 379124606
PLN128 222 363108809
PLN128 10 364192173
PLN128 1 291295799
PLN128 1 258385429
PLN128 1 310695138
PLN128 2 390386182
PLN128 1 268171085
PLN128 29 349658376
PLN128 6 349885803
PLN128 7 374035469
PLN129 19 134550855
PLN129 5 384499932
PLN129 3 317526865
PLN129 4 348522543
PLN129 121 392720692
PLN129 11 336203737
PLN129 2 287149637
PLN129 3 359070095
PLN129 10 373903616
PLN129 2 159588847
PLN129 5 371769032
PLN13 37 329935405
PLN130 57 390189770
PLN130 7 383050287
PLN130 9 373845120
PLN130 7 344699691
PLN130 187 262122807
PLN130 1 865431811
PLN130 1 841368522
PLN130 1 772393794
PLN130 1 766078222
PLN130 1 735900830
PLN130 1 693266847
PLN131 11 373036233
PLN131 1 690056233
PLN131 1 654671025
PLN131 1 681539918
PLN131 1 650134427
PLN131 1 643737533
PLN131 1 547487370
PLN131 1 545352555
PLN131 1 528421643
PLN131 1 538505002
PLN131 1 487455108
PLN132 8 357693623
PLN132 1 484156440
PLN132 1 426775217
PLN132 12 887903
PLN132 1 1574527093
PLN132 1 1805244829
PLN132 1 1716769615
PLN132 1 1637815978
PLN132 1 1645877737
PLN132 1 1365994436
PLN132 1 1520236431
PLN133 6 351635285
PLN133 8 34567157
PLN133 12 272825449
PLN133 1 517902124
PLN133 1 660114068
PLN133 1 623862790
PLN133 1 606413785
PLN133 1 599028035
PLN133 1 556887913
PLN133 1 627107635
PLN133 1 521079582
PLN134 12 293471641
PLN134 1 662966845
PLN134 1 626943711
PLN134 1 613583204
PLN134 1 592677528
PLN134 1 559914542
PLN134 1 632223043
PLN134 1 515585745
PLN134 1 656479363
PLN134 1 621609376
PLN134 1 611088072
PLN135 78 341267500
PLN135 1 589092785
PLN135 1 550920492
PLN135 1 633489054
PLN135 1 520725066
PLN135 1 661498744
PLN135 1 626053568
PLN135 1 608346219
PLN135 1 595508549
PLN135 1 556314873
PLN135 1 639402856
PLN136 128 309527386
PLN136 1 523218450
PLN136 1 661546608
PLN136 1 633922074
PLN136 1 612932250
PLN136 1 591516528
PLN136 1 554835331
PLN136 1 627854320
PLN136 1 530821096
PLN136 1 664715623
PLN136 1 631770265
PLN137 130 349102663
PLN137 1 613234972
PLN137 1 604325310
PLN137 1 582152544
PLN137 1 639225849
PLN137 1 519349950
PLN137 1 661621317
PLN137 1 626868012
PLN137 1 607094319
PLN137 1 595570096
PLN137 1 554304012
PLN138 122 254682704
PLN138 1 628899824
PLN138 1 520888013
PLN138 1 656602423
PLN138 1 622110859
PLN138 1 612883152
PLN138 1 589126655
PLN138 1 553403114
PLN138 1 637622183
PLN138 1 516612726
PLN138 1 656789389
PLN139 196 355571810
PLN139 1 625372561
PLN139 1 603451504
PLN139 1 589471550
PLN139 1 570259662
PLN139 1 634559682
PLN139 1 515709737
PLN139 1 657552530
PLN139 1 618447767
PLN139 1 613586716
PLN139 1 588664924
PLN14 46 124218893
PLN140 129 347273899
PLN140 1 555269530
PLN140 1 631620540
PLN140 1 521019562
PLN140 1 676241010
PLN140 1 632313166
PLN140 1 603807353
PLN140 1 592802360
PLN140 1 562524142
PLN140 1 627446003
PLN140 1 522966862
PLN141 99 327554070
PLN141 1 662000247
PLN141 1 633487160
PLN141 1 612164168
PLN141 1 594048367
PLN141 1 565074362
PLN141 1 631906770
PLN141 1 518331640
PLN141 1 660449817
PLN141 1 627269420
PLN141 1 602651360
PLN142 48 365833376
PLN142 1 589155630
PLN142 1 573351265
PLN142 1 625521901
PLN142 1 532974690
PLN142 1 664401522
PLN142 1 626503588
PLN142 1 611188438
PLN142 1 608423795
PLN142 1 562807231
PLN142 1 639824632
PLN143 60 352557038
PLN143 1 516520956
PLN143 1 657436430
PLN143 1 621715108
PLN143 1 610707416
PLN143 1 589489225
PLN143 1 558356414
PLN143 1 630762742
PLN143 1 520960447
PLN143 1 660500976
PLN143 1 634743673
PLN144 204 383855350
PLN144 1 616002081
PLN144 1 587037840
PLN144 1 563131288
PLN144 1 634603047
PLN144 1 518887001
PLN144 1 669356984
PLN144 1 631173187
PLN144 1 607766370
PLN144 1 585483089
PLN144 1 560323074
PLN145 137 390468270
PLN145 1 625985199
PLN145 1 517292502
PLN145 1 664077638
PLN145 1 624178744
PLN145 1 609451706
PLN145 1 590447534
PLN145 1 554191557
PLN145 1 631526965
PLN145 1 660034972
PLN145 1 625104971
PLN146 87 392025534
PLN146 1 608830648
PLN146 1 593636266
PLN146 1 553161090
PLN146 1 627960241
PLN146 1 519024526
PLN146 1 526310788
PLN146 1 664689228
PLN146 1 632403820
PLN146 1 613638454
PLN146 1 591698735
PLN147 112 383031127
PLN147 1 581262030
PLN147 1 626115335
PLN147 1 520902061
PLN147 1 660476038
PLN147 1 624334204
PLN147 1 613769411
PLN147 1 589927450
PLN147 1 557572468
PLN147 1 631025561
PLN147 1 517464799
PLN148 17 61341131
PLN148 1 663019822
PLN148 1 626669531
PLN148 1 612901747
PLN148 1 584301642
PLN148 1 565756020
PLN148 1 622534699
PLN148 1 535262788
PLN148 1 667210568
PLN148 1 635382001
PLN148 1 614569426
PLN149 69 334048427
PLN149 1 596886610
PLN149 1 572305800
PLN149 1 640929948
PLN149 1 522786484
PLN149 1 626973123
PLN149 1 611284754
PLN149 1 595906842
PLN149 1 554574222
PLN149 1 659290088
PLN149 1 630902477
PLN15 9 366014477
PLN150 15 374915998
PLN150 1 519834778
PLN150 1 660553991
PLN150 1 632999331
PLN150 1 616334843
PLN150 1 595538521
PLN150 1 579057524
PLN150 1 636085299
PLN150 1 523135642
PLN150 1 659217363
PLN150 1 627225202
PLN151 15 376631523
PLN151 1 611858135
PLN151 1 587395717
PLN151 1 576995797
PLN151 1 634448181
PLN151 1 517928713
PLN151 1 660591081
PLN151 1 627080904
PLN151 1 609113147
PLN151 1 586715499
PLN151 1 551946537
PLN152 117 268512615
PLN152 1 628475395
PLN152 1 525655293
PLN152 1 659787933
PLN152 1 626680366
PLN152 1 612118009
PLN152 1 587712295
PLN152 1 559096804
PLN152 1 630943643
PLN152 1 522820138
PLN152 1 662624081
PLN153 100 319711472
PLN153 1 626502968
PLN153 1 614857888
PLN153 1 596061397
PLN153 1 565632896
PLN153 1 633097160
PLN153 1 520045545
PLN153 1 669220190
PLN153 1 629226312
PLN153 1 613110551
PLN153 1 588732137
PLN154 22 387363813
PLN154 1 556172742
PLN154 1 637570351
PLN154 1 522666417
PLN154 1 658438119
PLN154 1 628047470
PLN154 1 612916554
PLN154 1 592600672
PLN154 1 551251939
PLN154 1 629663977
PLN154 1 521099473
PLN155 40 378828844
PLN155 1 657631428
PLN155 1 629616096
PLN155 1 610488678
PLN155 1 591047499
PLN155 1 554657029
PLN155 1 630750677
PLN155 1 517280455
PLN155 1 655385637
PLN155 1 626286153
PLN155 1 610690180
PLN156 7 361494327
PLN156 1 590980959
PLN156 1 550756125
PLN156 1 625691277
PLN156 1 519759058
PLN156 1 659936173
PLN156 1 627661034
PLN156 1 608478632
PLN156 1 598751202
PLN156 1 566136716
PLN156 1 630318266
PLN157 314 319348366
PLN157 1 527482853
PLN157 1 654540277
PLN157 1 624453744
PLN157 1 610565479
PLN157 1 592444850
PLN157 1 561781046
PLN157 1 629203537
PLN157 1 515443273
PLN157 1 661109612
PLN157 1 624188817
PLN158 53 377264056
PLN158 1 609603980
PLN158 1 590388879
PLN158 1 562718084
PLN158 1 625819277
PLN158 1 523454866
PLN158 1 657668641
PLN158 1 627263816
PLN158 1 611107145
PLN158 1 589117401
PLN158 1 554771185
PLN159 112 343386395
PLN159 1 633842266
PLN159 1 517633270
PLN159 1 659552134
PLN159 1 627284235
PLN159 1 612025601
PLN159 1 588480121
PLN159 1 559809231
PLN159 1 632533261
PLN159 1 522933788
PLN159 1 660627594
PLN16 2398 341031318
PLN160 6 326759735
PLN160 1 636764043
PLN160 1 612684114
PLN160 1 586202015
PLN160 1 586202737
PLN160 1 623708439
PLN160 1 520103116
PLN160 1 660087335
PLN160 1 626870575
PLN160 1 607666773
PLN160 1 586243134
PLN161 17 340023864
PLN161 1 573947504
PLN161 1 629731147
PLN161 1 521588016
PLN161 1 663157241
PLN161 1 626857742
PLN161 1 607587567
PLN161 1 590833548
PLN161 1 575584426
PLN161 1 631983138
PLN161 1 517909262
PLN162 115 393450449
PLN162 1 660726353
PLN162 1 625613366
PLN162 1 606853752
PLN162 1 591973374
PLN162 1 553461919
PLN162 1 627871618
PLN162 1 520737098
PLN162 1 659649991
PLN162 1 630477981
PLN162 1 612914000
PLN163 81 370027281
PLN163 1 592900278
PLN163 1 566194267
PLN163 1 634521465
PLN163 1 520869472
PLN163 1 657190419
PLN163 1 626766831
PLN163 1 610506001
PLN163 1 586056641
PLN163 1 553642618
PLN163 1 626388232
PLN164 29 394591747
PLN164 1 525410090
PLN164 1 659109138
PLN164 1 625619081
PLN164 1 605020174
PLN164 1 587821929
PLN164 1 556379494
PLN164 1 627107131
PLN164 1 523665466
PLN164 1 660123737
PLN164 1 626033862
PLN165 85 285066112
PLN165 1 611584699
PLN165 1 586378948
PLN165 1 560255346
PLN165 1 629468067
PLN165 1 561751373
PLN165 1 619785342
PLN165 1 634780758
PLN165 1 613857241
PLN165 1 590994522
PLN165 1 562529131
PLN166 1 137970533
PLN166 1 634372697
PLN166 1 523570906
PLN166 1 655608708
PLN166 1 630476109
PLN166 1 611734907
PLN166 1 585492234
PLN166 1 563342470
PLN166 1 633165930
PLN166 1 519860118
PLN166 1 660958633
PLN167 2 265995834
PLN167 1 628850999
PLN167 1 613418293
PLN167 1 593424848
PLN167 1 555705214
PLN167 1 632869554
PLN167 1 516360598
PLN167 1 662192201
PLN167 1 624651312
PLN167 1 607896916
PLN167 1 589026055
PLN168 3 380342000
PLN168 1 555707176
PLN168 1 627906795
PLN168 1 521007172
PLN168 1 659736604
PLN168 1 626336238
PLN168 1 607408596
PLN168 1 594348488
PLN168 1 555532898
PLN168 1 629181785
PLN168 1 527625328
PLN169 3 341478110
PLN169 1 662539114
PLN169 1 634696490
PLN169 1 614659814
PLN169 1 587540383
PLN169 1 567538777
PLN169 1 630541341
PLN169 1 520277344
PLN169 1 657222892
PLN169 1 629605540
PLN169 1 613053250
PLN17 1949 233857567
PLN170 4 364941990
PLN170 1 589424887
PLN170 1 555169479
PLN170 1 630615884
PLN170 1 522385343
PLN170 1 663034619
PLN170 1 623546353
PLN170 1 613383894
PLN170 1 586397192
PLN170 1 558702188
PLN170 1 631340553
PLN171 2 267241309
PLN171 6 169506233
PLN171 14 377335903
PLN171 14 378243710
PLN171 14 386520074
PLN171 14 381342717
PLN171 13 352824152
PLN171 1 158169978
PLN171 2 351634268
PLN171 1 279860179
PLN171 1 259520967
PLN172 3 377845747
PLN172 2 294703259
PLN172 1 238633233
PLN172 1 162496318
PLN172 1 420743833
PLN172 1 155907
PLN172 1 454733196
PLN172 1 446096000
PLN172 1 431552901
PLN172 1 379526086
PLN172 1 338376119
PLN173 2 218300262
PLN173 1 315777457
PLN173 4 356829234
PLN173 13 321943140
PLN173 1 77851525
PLN173 16 384723689
PLN173 11 328169402
PLN173 1 520479541
PLN173 1 655484837
PLN173 1 626855960
PLN173 1 604911185
PLN174 3 351455647
PLN174 1 592828626
PLN174 1 553427711
PLN174 1 632952271
PLN174 1 519862256
PLN174 1 631897805
PLN174 1 637173558
PLN174 1 641960388
PLN174 1 602818061
PLN174 1 573364513
PLN174 1 633728780
PLN175 3 282049637
PLN175 1 521760062
PLN175 1 660305412
PLN175 1 629753639
PLN175 1 609200707
PLN175 1 603021941
PLN175 1 572539457
PLN175 1 633965700
PLN175 1 521007160
PLN175 1 659208678
PLN175 1 627226266
PLN176 2 296748967
PLN176 1 603942392
PLN176 1 589029421
PLN176 1 556009491
PLN176 1 622798265
PLN176 1 519064071
PLN176 1 661554418
PLN176 1 627699516
PLN176 1 609498991
PLN176 1 588006371
PLN176 1 560132838
PLN177 2 276176029
PLN177 1 630178242
PLN177 47 358995759
PLN177 11 298931337
PLN177 30 62930933
PLN177 1 475425392
PLN177 1 592785984
PLN177 1 369077699
PLN177 1 639092456
PLN177 1 650132723
PLN177 1 502756319
PLN178 2 265406188
PLN178 1 616552515
PLN178 1 734473537
PLN178 1 475660819
PLN178 1 624362023
PLN178 1 589372991
PLN178 1 401580522
PLN178 1 568783180
PLN178 1 587942095
PLN178 1 429272691
PLN178 1 492611322
PLN179 3 366102397
PLN179 1 588888971
PLN179 1 366110095
PLN179 1 602817757
PLN179 1 637984644
PLN179 1 484660871
PLN179 14 393517910
PLN179 13 380754168
PLN179 7 360887511
PLN179 11 370515825
PLN179 7 255465082
PLN18 3 330514248
PLN180 3 310633103
PLN180 10 393847493
PLN180 16 394123581
PLN180 39 387990033
PLN180 40 384498328
PLN180 3 143841883
PLN180 41 297752645
PLN180 1 494422770
PLN180 1 646201372
PLN180 1 587623253
PLN180 1 663525381
PLN181 1 90243615
PLN181 1 626841358
PLN181 1 543353244
PLN181 1 664393216
PLN181 1 20213230
PLN181 1 525133463
PLN181 1 663523538
PLN181 1 635405230
PLN181 1 611936476
PLN181 1 591425152
PLN181 1 558728961
PLN182 2 339450567
PLN182 1 639057917
PLN182 1 522014794
PLN182 1 660736956
PLN182 1 627598042
PLN182 1 612187513
PLN182 1 594408327
PLN182 1 560662121
PLN182 1 627617921
PLN182 1 518127376
PLN182 1 673406957
PLN183 2 383562320
PLN183 1 630137118
PLN183 1 612939186
PLN183 1 591826921
PLN183 1 559508581
PLN183 1 635278407
PLN183 1 520353376
PLN183 1 657661460
PLN183 1 626889213
PLN183 1 610003100
PLN183 1 595851820
PLN184 2 318742289
PLN184 1 552676438
PLN184 1 626222545
PLN184 1 519806694
PLN184 1 662475302
PLN184 1 630354994
PLN184 1 612387238
PLN184 1 588087319
PLN184 1 567667584
PLN184 1 630313422
PLN184 1 518756967
PLN185 2 356433379
PLN185 1 653250953
PLN185 1 631324550
PLN185 1 609093722
PLN185 1 586821064
PLN185 1 562702819
PLN185 1 626718581
PLN185 1 518364809
PLN185 1 655260812
PLN185 1 634191159
PLN185 1 614681618
PLN186 2 302010261
PLN186 1 597998838
PLN186 1 574769137
PLN186 1 626583961
PLN186 1 526252571
PLN186 1 658721539
PLN186 1 626163282
PLN186 1 609194012
PLN186 1 589037043
PLN186 1 564342937
PLN186 1 639123221
PLN187 2 361337975
PLN187 1 523553505
PLN187 1 656359106
PLN187 1 622273932
PLN187 1 610730036
PLN187 1 596985997
PLN187 1 555033258
PLN187 1 629967781
PLN187 1 520365393
PLN187 1 657708949
PLN187 1 625240013
PLN188 41 389463936
PLN188 1 610861510
PLN188 1 581278401
PLN188 1 555013765
PLN188 1 630182139
PLN188 1 522172269
PLN188 1 657289215
PLN188 1 624169276
PLN188 1 611474174
PLN188 1 589543088
PLN188 1 562615538
PLN189 56 346155909
PLN189 1 625823540
PLN189 1 528855042
PLN189 1 664634244
PLN189 1 643202471
PLN189 1 617103718
PLN189 1 604603948
PLN189 1 556510820
PLN189 1 645264326
PLN189 1 518487512
PLN189 1 660262686
PLN19 37 343581774
PLN190 28 344950285
PLN190 1 634680428
PLN190 1 612896067
PLN190 1 590051029
PLN190 1 563934483
PLN190 1 633380624
PLN190 1 525747031
PLN190 1 658111403
PLN190 1 631828453
PLN190 1 612358733
PLN190 1 596986316
PLN191 74 110183622
PLN191 1 575641890
PLN191 1 634497571
PLN191 1 526546151
PLN191 1 661402595
PLN191 1 635870417
PLN191 1 617906818
PLN191 1 592339983
PLN191 1 562165821
PLN191 1 639539621
PLN191 1 522184041
PLN192 46 387316355
PLN192 1 666500271
PLN192 1 632086707
PLN192 1 607961820
PLN192 1 589088731
PLN192 1 584691581
PLN192 1 640065628
PLN192 18 340091012
PLN192 5 346876740
PLN192 9 390980959
PLN192 12 332062075
PLN193 26 388412848
PLN193 1 63050874
PLN193 9 376864900
PLN193 12 372511925
PLN193 9 378086189
PLN193 11 263651859
PLN193 1 199739593
PLN193 2 344461905
PLN193 3 374253733
PLN193 4 381821281
PLN193 4 318572652
PLN194 45 383275027
PLN194 83 393638492
PLN194 2 159167131
PLN194 6 388559936
PLN194 8 340431512
PLN194 15 383095456
PLN194 9 394035375
PLN194 12 352824577
PLN194 10 351790580
PLN194 9 389123571
PLN194 11 385826758
PLN195 3 296654434
PLN195 10 349341323
PLN195 12 386750055
PLN195 8 382846237
PLN195 4 317913936
PLN195 5 382620307
PLN195 5 361453536
PLN195 6 383120782
PLN195 6 325499506
PLN195 3 326992284
PLN195 3 309672594
PLN196 5 362932580
PLN196 2 199284186
PLN196 4 381810661
PLN196 4 368895169
PLN196 4 320171181
PLN196 5 360856103
PLN196 17 55384138
PLN196 11 382432891
PLN196 15 364788400
PLN196 9 365792098
PLN196 10 252904734
PLN197 3 174796239
PLN197 1 312506452
PLN197 1 298985297
PLN197 1 289954511
PLN197 1 267212794
PLN197 1 251527947
PLN197 1 246038259
PLN197 1 224067570
PLN197 2 394230861
PLN197 5 373151993
PLN197 1 88136734
PLN198 1 307467675
PLN198 5 375018439
PLN198 7 323770455
PLN198 4 345416027
PLN198 5 357817205
PLN198 24 297760884
PLN198 1 2143528264
PLN198 1 2138631366
PLN198 1 2132989935
PLN198 1 2142145023
PLN198 1 2142779784
PLN199 1 240644346
PLN199 1 124381055
PLN199 1 2112395848
PLN199 1 2144481838
PLN199 1 2133121580
PLN199 1 2141806609
PLN199 1 1870266305
PLN199 1 2134931027
PLN199 1 2108664250
PLN199 1 2146278775
PLN199 1 2117022170
PLN2 43088 277012490
PLN20 38 174497774
PLN200 1 237923589
PLN200 1 1576301307
PLN200 1 2067099338
PLN200 1 2134690998
PLN200 1 2136662657
PLN200 1 2140543523
PLN200 1 1531582847
PLN200 1 2146571508
PLN200 1 2138192289
PLN200 1 2101175359
PLN200 1 2146227213
PLN201 1 251400564
PLN201 1 621086779
PLN201 1 2138605540
PLN201 1 2083688238
PLN201 1 2144314009
PLN201 1 2139184679
PLN201 1 172723629
PLN201 1 2132146989
PLN201 1 2133919239
PLN201 1 2133305249
PLN201 1 2100933269
PLN202 1 222005600
PLN202 1 143347570
PLN202 1 2134142781
PLN202 1 2145201137
PLN202 1 2137733646
PLN202 1 1914313492
PLN202 1 2145479601
PLN202 1 2114166385
PLN202 2 3701885723
PLN202 1 2141253099
PLN202 1 2119186544
PLN203 2 353275669
PLN203 1 2142175433
PLN203 1 1498831827
PLN203 1 1020192845
PLN203 10 321674204
PLN203 3 372349544
PLN203 6 295982055
PLN203 4 344625596
PLN203 16 346344238
PLN203 16 348075690
PLN203 1 454441500
PLN204 1 180355996
PLN204 1 579809636
PLN204 1 550374318
PLN204 1 490948109
PLN204 1 518445003
PLN204 1 441130372
PLN204 1 551897936
PLN204 1 453240013
PLN204 1 569675999
PLN204 1 567007916
PLN204 1 496544637
PLN205 18 373335959
PLN205 1 522841693
PLN205 1 441744131
PLN205 1 573537543
PLN205 1 136709
PLN205 1 440949504
PLN205 1 581077694
PLN205 1 538841055
PLN205 1 486522400
PLN205 1 495793880
PLN205 1 435262547
PLN206 173 286692338
PLN206 1 535192930
PLN206 1 434100415
PLN206 1 544199803
PLN206 1 519958927
PLN206 1 477159420
PLN206 1 491531377
PLN206 1 429947770
PLN206 1 549923787
PLN206 1 136692
PLN206 1 448723479
PLN207 91 329588214
PLN207 1 594308209
PLN207 1 551310461
PLN207 1 480566411
PLN207 1 514909529
PLN207 1 428171329
PLN207 1 554483852
PLN207 1 446514975
PLN207 1 595495573
PLN207 1 561532561
PLN207 1 478334130
PLN208 7 345877761
PLN208 1 526451923
PLN208 1 430213863
PLN208 1 555327081
PLN208 1 136650
PLN208 1 447395284
PLN208 1 567447976
PLN208 1 561370202
PLN208 1 507274784
PLN208 1 511274163
PLN208 1 437061773
PLN209 7 386032874
PLN209 1 446215483
PLN209 1 433531554
PLN209 1 581715996
PLN209 1 545854294
PLN209 1 487585716
PLN209 1 502853016
PLN209 1 435966324
PLN209 1 439683703
PLN209 1 136703
PLN209 1 445299727
PLN21 9 363687061
PLN210 27 388696142
PLN210 1 546259763
PLN210 1 492972200
PLN210 1 449037107
PLN210 1 491835565
PLN210 1 414293664
PLN210 1 509203637
PLN210 1 427060722
PLN210 1 517747186
PLN210 1 411139572
PLN210 1 463043347
PLN211 2 278500643
PLN211 1 472050116
PLN211 1 404594180
PLN211 1 525771240
PLN211 1 434184414
PLN211 1 556619333
PLN211 1 449827353
PLN211 1 435193785
PLN211 1 487657026
PLN211 1 420799321
PLN211 1 506847538
PLN212 1 146154786
PLN212 1 424111539
PLN212 1 529336321
PLN212 1 512598572
PLN212 1 464949005
PLN212 1 478050655
PLN212 1 405189081
PLN212 1 503245410
PLN212 1 136621
PLN212 1 433027506
PLN212 1 561888103
PLN213 2 291596214
PLN213 1 543643859
PLN213 1 465101524
PLN213 1 479577933
PLN213 1 370652462
PLN213 1 470832587
PLN213 1 444863034
PLN213 1 549613361
PLN213 1 475614129
PLN213 1 378582797
PLN213 1 484181993
PLN214 2 284209818
PLN214 1 428463662
PLN214 1 456054156
PLN214 1 406795410
PLN214 1 551691529
PLN214 1 469885103
PLN214 1 412545700
PLN214 1 437461740
PLN214 1 367632597
PLN214 1 503019622
PLN214 1 409096790
PLN215 3 380361118
PLN215 1 553356059
PLN215 1 527086346
PLN215 1 439832876
PLN215 1 463419122
PLN215 1 412842520
PLN215 1 433607908
PLN215 1 136684
PLN215 1 438715154
PLN215 1 558432928
PLN215 1 525597199
PLN216 1 146314651
PLN216 1 499105699
PLN216 1 476315696
PLN216 1 404753456
PLN216 1 165207278
PLN216 1 428166829
PLN216 1 531985519
PLN216 1 528375571
PLN216 1 469190473
PLN216 1 499943225
PLN216 1 426883771
PLN217 1 262573928
PLN217 1 518242728
PLN217 1 452485612
PLN217 1 524598351
PLN217 1 551958270
PLN217 1 484316636
PLN217 1 477529720
PLN217 1 418513176
PLN217 1 253507736
PLN217 1 433963092
PLN217 1 546085745
PLN218 1 278118176
PLN218 1 545226034
PLN218 1 468073191
PLN218 1 460900303
PLN218 1 399389643
PLN218 2 147912467
PLN218 1 419675113
PLN218 1 529511041
PLN218 1 505002105
PLN218 1 493534736
PLN218 1 480438381
PLN219 1 249859997
PLN219 1 323037461
PLN219 1 513746860
PLN219 1 436583560
PLN219 1 553766941
PLN219 1 538205655
PLN219 1 496559787
PLN219 1 498664620
PLN219 1 420173649
PLN219 1 553712854
PLN219 1 444660800
PLN22 10 361166576
PLN220 1 281481746
PLN220 1 548162194
PLN220 1 475391106
PLN220 1 422040451
PLN220 1 492582937
PLN220 1 315874374
PLN220 1 520872272
PLN220 1 432790581
PLN220 1 561166410
PLN220 1 497612547
PLN220 1 454958861
PLN221 1 187643412
PLN221 1 475241834
PLN221 1 398551120
PLN221 1 496364735
PLN221 1 136702
PLN221 1 445660949
PLN221 1 488646431
PLN221 1 501478063
PLN221 1 418342823
PLN221 1 491021198
PLN221 1 413178521
PLN222 1 272110166
PLN222 1 469438496
PLN222 1 410203331
PLN222 1 486823465
PLN222 1 532902629
PLN222 1 470057954
PLN222 1 477986613
PLN222 1 395248899
PLN222 1 540739613
PLN222 1 436072789
PLN222 1 565481604
PLN223 1 256679836
PLN223 1 530643946
PLN223 1 474248680
PLN223 1 489943422
PLN223 1 380851109
PLN223 1 488893700
PLN223 1 397601223
PLN223 1 542784013
PLN223 1 546813442
PLN223 1 410174162
PLN223 1 481229106
PLN224 1 252477622
PLN224 1 412422822
PLN224 1 503641832
PLN224 1 136682
PLN224 1 642634776
PLN224 1 827770304
PLN224 1 819590567
PLN224 1 657919172
PLN224 1 735222392
PLN224 1 640551262
PLN224 1 792951870
PLN225 1 253096925
PLN225 1 57931760
PLN225 1 641523445
PLN225 1 830702509
PLN225 1 817725293
PLN225 1 657518596
PLN225 1 728079018
PLN225 1 637620844
PLN225 1 792621069
PLN225 1 48899630
PLN225 1 424301551
PLN226 1 292374568
PLN226 1 363314422
PLN226 1 547589534
PLN226 1 457898396
PLN226 1 471623726
PLN226 1 398746676
PLN226 1 519419467
PLN226 1 435505876
PLN226 1 371211504
PLN226 1 505934463
PLN226 1 434488449
PLN227 1 178437200
PLN227 1 481399899
PLN227 1 415263271
PLN227 1 536522644
PLN227 1 437373607
PLN227 1 539223252
PLN227 1 520659461
PLN227 1 460375097
PLN227 1 458164519
PLN227 1 395065095
PLN227 1 530797330
PLN228 19 385138080
PLN228 1 437410857
PLN228 1 553413267
PLN228 1 511954845
PLN228 1 448722544
PLN228 1 479483748
PLN228 1 420024747
PLN228 1 540111372
PLN228 28 390225068
PLN228 6 385962772
PLN228 6 350186990
PLN229 8 385802779
PLN229 11 349705202
PLN229 8 347249232
PLN229 33 386614164
PLN229 18 95282903
PLN229 21 351552576
PLN229 4 384166153
PLN229 4 344265953
PLN229 11 326991722
PLN229 33 361903520
PLN229 4 358580834
PLN23 11 366621684
PLN230 236 371756449
PLN230 11 386226479
PLN230 10 369658764
PLN230 10 368726946
PLN230 5 320294089
PLN230 1 111907482
PLN230 4 375566199
PLN230 41 387391471
PLN230 9 367321953
PLN230 13 366444366
PLN230 18 394655795
PLN231 12 374568910
PLN231 14 383489795
PLN231 26 303745916
PLN231 4 345833962
PLN231 7 390299593
PLN231 25 384889311
PLN231 3 306485407
PLN231 2 189065850
PLN231 4 358881874
PLN231 5 387850373
PLN231 28 383892895
PLN232 7 208424149
PLN232 22 386079901
PLN232 16 375590392
PLN232 16 388553366
PLN232 9 263771989
PLN232 7 393683767
PLN232 9 333578025
PLN232 7 386485134
PLN232 9 368572858
PLN232 10 318630395
PLN232 2 159213959
PLN233 5 294376703
PLN233 5 335851561
PLN233 4 117295204
PLN233 2 3545513960
PLN233 1 1499997841
PLN233 1 1493209057
PLN233 1 1187610474
PLN233 1 943684407
PLN233 1 688362222
PLN233 6 387891258
PLN233 4 332482390
PLN234 5 302707417
PLN234 6 386679750
PLN234 1 44600615
PLN234 26 370453233
PLN234 20 390354097
PLN234 14 362813163
PLN234 5 338125458
PLN234 10 371781707
PLN234 20 393326515
PLN234 15 392260518
PLN234 14 385262693
PLN235 7 303689386
PLN235 17 392108721
PLN235 11 202846913
PLN235 18 361104560
PLN235 12 365240599
PLN235 10 386385344
PLN235 18 322855589
PLN235 1 614431332
PLN235 1 495016746
PLN235 1 767071137
PLN235 1 671256291
PLN236 1 594546470
PLN236 1 670741101
PLN236 1 671191297
PLN236 1 771176557
PLN236 1 643128204
PLN236 1 694350238
PLN236 1 641290954
PLN236 1 585824631
PLN236 1 589079669
PLN236 1 745638687
PLN236 1 692654486
PLN237 1 587543788
PLN237 5 330718620
PLN237 4 299227853
PLN237 17 388136052
PLN237 12 322122200
PLN237 4 324805835
PLN237 7 320111657
PLN237 4 332805262
PLN237 5 384383892
PLN237 5 354028846
PLN237 6 369699941
PLN238 1 587190583
PLN238 21 393215063
PLN238 16 259453723
PLN238 1 314009907
PLN238 1 276062833
PLN238 1 325849051
PLN238 1 243773284
PLN238 1 174422329
PLN238 1 286409356
PLN238 2 294313319
PLN238 1 307615467
PLN239 1 583925327
PLN239 1 281688668
PLN239 1 334621887
PLN239 1 251295635
PLN239 1 177041146
PLN239 1 282264073
PLN239 4 394456916
PLN239 7 294552474
PLN239 38 378009978
PLN239 16 350211631
PLN239 9 350668717
PLN24 158 378806980
PLN240 1 527343613
PLN240 1 255808591
PLN240 1 238725289
PLN240 1 242286659
PLN240 1 217711359
PLN240 1 216482974
PLN240 1 222991778
PLN240 1 191492741
PLN240 1 196860274
PLN240 2 375509859
PLN240 2 360158230
PLN241 1 513337126
PLN241 2 312325071
PLN241 2 386523408
PLN241 1 228357935
PLN241 1 227991009
PLN241 1 217148095
PLN241 1 212042709
PLN241 1 211849564
PLN241 1 226572831
PLN241 1 207533968
PLN241 2 361941678
PLN242 1 453691697
PLN242 2 359610575
PLN242 2 308330841
PLN242 1 156451178
PLN242 1 246005224
PLN242 1 241208020
PLN242 1 228685204
PLN242 1 226440888
PLN242 1 202811886
PLN242 1 212066696
PLN242 1 202875806
PLN243 37 334786838
PLN243 2 388663172
PLN243 2 322368536
PLN243 2 315656612
PLN243 2 281208831
PLN243 1 956684326
PLN243 1 561974515
PLN243 1 718270646
PLN243 1 682093502
PLN243 1 700447244
PLN243 1 683485999
PLN244 8 340070582
PLN244 1 723946829
PLN244 1 751391258
PLN244 1 651249186
PLN244 1 600211227
PLN244 1 575512124
PLN244 1 573054857
PLN244 1 563790525
PLN244 1 521910117
PLN244 35 369135219
PLN244 35 389171560
PLN245 9 390483320
PLN245 6 240325932
PLN245 16 393108004
PLN245 32 368939935
PLN245 23 331705735
PLN245 4 296118519
PLN245 6 380860026
PLN245 6 350208117
PLN245 16636 358389847
PLN245 83375 199312005
PLN246 7 343029522
PLN247 8 390116206
PLN248 15 370780628
PLN249 12 385801156
PLN25 1 337042926
PLN250 25 392653048
PLN251 14 282141355
PLN252 15 349421970
PLN253 9 359340843
PLN254 9 376777002
PLN255 58 376930268
PLN256 15 368724759
PLN257 2 56138460
PLN258 16 390767870
PLN259 23 356914980
PLN26 1 177533547
PLN260 6 394536461
PLN261 6 379300625
PLN262 4 282458791
PLN263 48 381927407
PLN264 16 259608471
PLN265 4 351020507
PLN266 9 394649745
PLN267 3 133976330
PLN268 13 382257900
PLN269 11 361288517
PLN27 1 292038349
PLN270 18 388332312
PLN271 46 337489092
PLN272 6 335533055
PLN273 2 103073804
PLN274 59 331002847
PLN275 43 389108210
PLN276 44 389602100
PLN277 12 35826761
PLN278 1 494422770
PLN279 1 646201372
PLN28 1 253125799
PLN280 1 587623253
PLN281 1 663525381
PLN282 1 626841358
PLN283 1 543353244
PLN284 1 664393216
PLN285 17 391878458
PLN286 37 367085549
PLN287 4 335506921
PLN288 41 353999455
PLN289 14 388729336
PLN29 1 251194792
PLN290 6 363338195
PLN291 5 342832310
PLN292 5 384145100
PLN293 5 343940327
PLN294 31 389356264
PLN295 14 379066498
PLN296 8 219047659
PLN297 14 379049311
PLN298 13 362610461
PLN299 14 381170151
PLN3 3691 380136672
PLN30 1 253267520
PLN300 14 386467556
PLN301 14 386854991
PLN302 10 270029117
PLN303 14 388645158
PLN304 14 374436503
PLN305 14 381134403
PLN306 14 393815785
PLN307 14 394693729
PLN308 8 219270458
PLN309 14 385209295
PLN31 1 267785325
PLN310 14 386765768
PLN311 15 390393298
PLN312 62 363568203
PLN313 9 329435467
PLN314 1 51237036
PLN315 1 338584084
PLN316 1 361675512
PLN317 1 385644068
PLN318 1 439677103
PLN319 1 445134990
PLN32 1 175912755
PLN320 1 446362846
PLN321 1 472276189
PLN322 1 513951721
PLN323 1 528637745
PLN324 7 198246599
PLN325 13 380242521
PLN326 12 248724944
PLN327 1 338461504
PLN328 1 361521394
PLN329 1 385473225
PLN33 1 266007691
PLN330 1 439507296
PLN331 1 444939869
PLN332 1 446172849
PLN333 1 472104924
PLN334 1 513745672
PLN335 1 528418227
PLN336 11 375070239
PLN337 4 321932444
PLN338 4 341653648
PLN339 1 78546334
PLN34 1 244603042
PLN340 5 350183166
PLN341 7 379152752
PLN342 6 283534392
PLN343 4 360934024
PLN344 9 320625087
PLN345 4 344830342
PLN346 45 353910605
PLN347 10 369403290
PLN348 10 372125698
PLN349 10 378404333
PLN35 1 277312646
PLN350 5 198317301
PLN351 10 361822102
PLN352 10 383642544
PLN353 10 377070722
PLN354 8 349624307
PLN355 6 390662733
PLN356 3 325042636
PLN357 5 367911468
PLN358 55 365935374
PLN359 10 378383316
PLN36 118 388802600
PLN360 10 373333687
PLN361 22 381515733
PLN362 96 222356226
PLN363 36 375753221
PLN364 37 319602800
PLN365 15 327238823
PLN366 6 331780152
PLN367 7 275787757
PLN368 10 379997613
PLN369 35 357606881
PLN37 28 377679233
PLN370 11 394131762
PLN371 13 324514045
PLN372 4 246028233
PLN373 3 360351661
PLN374 2 310670494
PLN375 2 291191153
PLN376 2 278207141
PLN377 2 264415078
PLN378 6 366441300
PLN379 3 105607113
PLN38 31 364870370
PLN380 11 378920689
PLN381 78 362822770
PLN382 10 387989492
PLN383 9 348889311
PLN384 10 388298968
PLN385 13 365926394
PLN386 13 374893407
PLN387 13 370043026
PLN388 29 382808953
PLN389 65 306101464
PLN39 5 331403583
PLN390 37 16871
PLN391 149 79314
PLN392 2469 93786416
PLN393 7181 18795412
PLN394 14346 29953091
PLN395 96796 208650157
PLN396 130372 90767575
PLN397 158757 148037020
PLN398 162645 146385234
PLN399 58047 31866791
PLN4 3521 387668889
PLN40 8 355064647
PLN400 181507 123928997
PLN401 49962 254174135
PLN402 41545 288268410
PLN403 72045 110649218
PLN404 98644 85504671
PLN405 49729 72847341
PLN406 25060 110564695
PLN407 13561 89764040
PLN408 1 774434471
PLN409 8305 28494037
PLN41 14549 335956745
PLN410 1861 361385154
PLN411 5 372618381
PLN412 6 372447772
PLN413 6 368295254
PLN414 2 132503639
PLN415 498 311771607
PLN416 8 327823341
PLN417 6 343447962
PLN418 1 66465249
PLN419 1 474651383
PLN42 5168 6202713
PLN420 1 612216829
PLN421 1 571018318
PLN422 1 574020038
PLN423 1 538550714
PLN424 1 514282554
PLN425 1 575541767
PLN426 134 336045988
PLN427 13675 307007082
PLN428 174189 123954464
PLN429 24771 16089538
PLN43 96584 101383193
PLN430 148179 156064469
PLN431 149380 145717812
PLN432 87069 72017983
PLN433 154392 132576506
PLN434 163866 118476937
PLN435 25401 27610534
PLN436 148070 133561222
PLN437 126453 157684206
PLN438 167369 121298172
PLN439 116304 121244244
PLN44 113437 117621940
PLN440 134918 148962698
PLN441 102480 122621291
PLN442 135558 149992417
PLN443 126494 162954214
PLN444 120498 166540957
PLN445 21374 19345477
PLN446 124166 164073406
PLN447 112843 172580761
PLN448 86183 159282387
PLN449 118846 171990169
PLN45 57311 72144580
PLN450 110646 197005174
PLN451 57806 222596852
PLN452 808 371274420
PLN453 18820 41235315
PLN454 19737 363518883
PLN455 10232 333664247
PLN456 302 288936846
PLN457 5 324373291
PLN458 1670 369972731
PLN459 1620 2256477
PLN46 28689 28922869
PLN460 1384 387002570
PLN461 8 179149947
PLN462 1282 232633870
PLN463 1 522466905
PLN464 1 675310294
PLN465 1 628753756
PLN466 1 624247919
PLN467 1 599018945
PLN468 1 573247234
PLN469 1 634667502
PLN47 2648 194594881
PLN470 8563 149646365
PLN471 1 727344967
PLN472 1 946003158
PLN473 1 965754312
PLN474 1 906459801
PLN475 1 876148008
PLN476 1 885153844
PLN477 1 899925126
PLN478 1 528437893
PLN479 4156 344360411
PLN48 344 254550430
PLN480 10 362580157
PLN481 4 120184706
PLN482 129 363594612
PLN483 404 366581476
PLN484 9 335385998
PLN485 130 308977848
PLN486 206 92200731
PLN487 16 383095167
PLN488 47 120890229
PLN489 1 541700351
PLN49 400 261235914
PLN490 1 696809892
PLN491 1 655542733
PLN492 1 648987779
PLN493 1 622068216
PLN494 1 583456046
PLN495 1 654005093
PLN496 130 298375
PLN497 1 522466905
PLN498 1 675310294
PLN499 1 628753756
PLN5 97871 212329023
PLN50 198 168828441
PLN500 1 624247919
PLN501 1 599018945
PLN502 1 573247234
PLN503 1 634667502
PLN504 344 95023900
PLN505 1 521073757
PLN506 1 672273650
PLN507 1 634137895
PLN508 1 624121443
PLN509 1 607506942
PLN51 298 258873545
PLN510 1 564293627
PLN511 1 632401812
PLN512 1 520603772
PLN513 1 661076038
PLN514 1 626572591
PLN515 1 612852138
PLN516 1 598896166
PLN517 1 570629545
PLN518 1 623813090
PLN519 1 513014082
PLN52 339 265493888
PLN520 1 653624577
PLN521 1 616219606
PLN522 1 610044819
PLN523 1 583417444
PLN524 1 550735148
PLN525 1 620104558
PLN526 1 536602846
PLN527 1 685423969
PLN528 1 640667275
PLN529 1 639123876
PLN53 485 350911896
PLN530 1 612949391
PLN531 1 577192767
PLN532 1 641629864
PLN533 1 500012378
PLN534 1 648922534
PLN535 1 604770208
PLN536 1 597403059
PLN537 1 576456374
PLN538 1 556080982
PLN539 1 603311816
PLN54 112 80604200
PLN540 1 512023576
PLN541 1 652551272
PLN542 1 615767531
PLN543 1 605571303
PLN544 1 592249714
PLN545 1 549757368
PLN546 1 616509610
PLN547 2 1184
PLN548 1 550024188
PLN549 1 710194481
PLN55 455 379563194
PLN550 1 661081403
PLN551 1 659460550
PLN552 1 630572514
PLN553 1 598618390
PLN554 1 658974642
PLN555 1 559656399
PLN556 1 717517502
PLN557 1 672450454
PLN558 1 665297378
PLN559 1 636785599
PLN56 143 364543151
PLN560 1 599706080
PLN561 1 675658265
PLN562 1 523168208
PLN563 1 671211297
PLN564 1 630677708
PLN565 1 623428415
PLN566 1 604298040
PLN567 1 558526623
PLN568 1 628419988
PLN569 1 495661851
PLN57 92 268011045
PLN570 1 640830439
PLN571 1 597781253
PLN572 1 600363860
PLN573 1 570178053
PLN574 1 534998810
PLN575 1 616598997
PLN576 1 537457279
PLN577 1 685947972
PLN578 1 649921694
PLN579 1 641099225
PLN58 108 325736871
PLN580 1 611845738
PLN581 1 581041262
PLN582 1 655783664
PLN583 1 521174834
PLN584 1 667717957
PLN585 1 631819663
PLN586 1 624692602
PLN587 1 597351075
PLN588 1 561737938
PLN589 1 629651422
PLN59 17 390428741
PLN590 1 524514255
PLN591 1 670202054
PLN592 1 631946783
PLN593 1 626743494
PLN594 1 600801835
PLN595 1 566971015
PLN596 1 629827058
PLN597 1 522114480
PLN598 1 671530377
PLN599 1 631910401
PLN6 111630 128054636
PLN60 246 346776993
PLN600 1 622474059
PLN601 1 598240357
PLN602 1 562137082
PLN603 1 633805855
PLN604 1 525723083
PLN605 1 684336246
PLN606 1 636053469
PLN607 1 629969872
PLN608 1 604087610
PLN609 1 568600391
PLN61 155 383508558
PLN610 1 640498578
PLN611 1 519546829
PLN612 1 665715246
PLN613 1 624683667
PLN614 1 621078253
PLN615 1 600910593
PLN616 1 558953701
PLN617 1 626840912
PLN618 1 543344542
PLN619 1 697540743
PLN62 85 329381794
PLN620 1 655862368
PLN621 1 646765634
PLN622 1 618540729
PLN623 1 587963859
PLN624 1 658085510
PLN625 449 378687213
PLN626 15 312691008
PLN627 20 111531882
PLN628 1 596211899
PLN629 1 705338699
PLN63 15 388403916
PLN630 1 493450010
PLN631 1 804285258
PLN632 1 810734643
PLN633 1 673981989
PLN634 1 754496630
PLN635 1 855759449
PLN636 1 614042580
PLN637 1 743847818
PLN638 1 673340788
PLN639 1 515668560
PLN64 22 360710420
PLN640 1 713320806
PLN641 1 703598484
PLN642 1 570159854
PLN643 1 625793224
PLN644 1 721110502
PLN645 1 459355444
PLN646 1 745201001
PLN647 1 749284433
PLN648 1 643344672
PLN649 1 595297365
PLN65 6 376299569
PLN650 1 688905267
PLN651 1 491807393
PLN652 1 769338634
PLN653 1 671568023
PLN654 1 635285330
PLN655 1 745618965
PLN656 1 839470345
PLN657 1 646400022
PLN658 1 747589525
PLN659 1 665179885
PLN66 1 65870126
PLN660 1 506585010
PLN661 1 703962928
PLN662 1 702438406
PLN663 1 568126671
PLN664 1 610851963
PLN665 1 707596419
PLN666 1 465558328
PLN667 1 734536914
PLN668 1 738743901
PLN669 1 636778132
PLN67 93 388494695
PLN670 1 602900890
PLN671 1 697493198
PLN672 1 490518203
PLN673 1 784661008
PLN674 1 810500911
PLN675 1 655314739
PLN676 1 752710991
PLN677 1 890847171
PLN678 1 621781073
PLN679 1 743084022
PLN68 15 373888800
PLN680 1 676741658
PLN681 1 509452426
PLN682 1 710124532
PLN683 1 480767623
PLN684 1 578021311
PLN685 1 620140791
PLN686 1 716573881
PLN687 1 476726550
PLN688 1 756324664
PLN689 1 977471539
PLN69 9 363551984
PLN690 1 642207261
PLN691 1 502612092
PLN692 1 646234737
PLN693 1 605172934
PLN694 1 593744788
PLN695 1 571972453
PLN696 1 545472572
PLN697 1 607667504
PLN698 1 590561804
PLN699 1 685720839
PLN7 64213 184495944
PLN70 60 374148929
PLN700 1 490910922
PLN701 1 782694893
PLN702 1 796420183
PLN703 1 650274702
PLN704 1 739889549
PLN705 1 848590828
PLN706 1 610626473
PLN707 1 738023571
PLN708 1 667607564
PLN709 1 506274898
PLN71 14 212654302
PLN710 1 701434008
PLN711 1 690770133
PLN712 1 567265955
PLN713 1 612987783
PLN714 1 704156067
PLN715 1 475327881
PLN716 1 732118298
PLN717 1 733931846
PLN718 1 636796232
PLN719 1 599764323
PLN72 74 124609184
PLN720 1 691313424
PLN721 1 493357854
PLN722 1 782685093
PLN723 1 786410271
PLN724 1 648139033
PLN725 1 744407562
PLN726 1 835583350
PLN727 1 623221719
PLN728 1 741299132
PLN729 1 669032550
PLN73 8 358353307
PLN730 1 517040482
PLN731 1 711661679
PLN732 1 708205786
PLN733 1 573398137
PLN734 1 583494258
PLN735 1 707105489
PLN736 1 471251328
PLN737 1 737453356
PLN738 1 736349413
PLN739 1 639162162
PLN74 3 347496433
PLN740 1 586755746
PLN741 1 704478343
PLN742 1 492109999
PLN743 1 791475352
PLN744 1 785940626
PLN745 1 661246824
PLN746 1 756990402
PLN747 1 858776195
PLN748 1 621195942
PLN749 1 754256086
PLN75 4 370651368
PLN750 1 670301833
PLN751 1 509263899
PLN752 1 708234589
PLN753 1 725120110
PLN754 1 575129590
PLN755 1 620883766
PLN756 1 727285804
PLN757 1 479660269
PLN758 1 745978486
PLN759 1 750160716
PLN76 2 271593360
PLN760 1 642428577
PLN761 1 591313643
PLN762 1 705330581
PLN763 1 495656580
PLN764 1 803232604
PLN765 1 790745243
PLN766 1 657494025
PLN767 1 759305888
PLN768 1 856542542
PLN769 1 628321883
PLN77 1 150766190
PLN770 1 754364263
PLN771 1 697113365
PLN772 1 504254270
PLN773 1 715354979
PLN774 1 713929667
PLN775 1 572943128
PLN776 1 626959190
PLN777 1 715714221
PLN778 1 483823121
PLN779 1 742917797
PLN78 2 288204953
PLN780 1 748536659
PLN781 1 643784981
PLN782 1 600654286
PLN783 1 685083685
PLN784 1 486317123
PLN785 1 794150360
PLN786 1 799857935
PLN787 1 655329108
PLN788 1 749763888
PLN789 1 838116175
PLN79 2 286787940
PLN790 1 610468321
PLN791 1 736551279
PLN792 1 666328382
PLN793 1 504826275
PLN794 1 702606209
PLN795 1 467876140
PLN796 1 566465558
PLN797 1 614421429
PLN798 1 698878671
PLN799 1 480431564
PLN8 21754 107220939
PLN80 2 295931502
PLN800 1 735408736
PLN801 1 969998116
PLN802 1 635024734
PLN803 10 3368
PLN804 1 595339094
PLN805 1 698605642
PLN806 1 499102108
PLN807 1 791748890
PLN808 1 797311483
PLN809 1 656817438
PLN81 64 355204210
PLN810 1 753360318
PLN811 1 845838138
PLN812 1 619661694
PLN813 1 752772853
PLN814 1 689709469
PLN815 1 509595892
PLN816 1 712797596
PLN817 1 710493282
PLN818 1 570643040
PLN819 1 619886155
PLN82 8 357495982
PLN820 1 705533140
PLN821 1 484551304
PLN822 1 740148362
PLN823 1 757233630
PLN824 1 642499559
PLN825 1 594006513
PLN826 1 693261537
PLN827 1 492948387
PLN828 1 781462734
PLN829 1 802944975
PLN83 2 99419683
PLN830 1 650275864
PLN831 1 756841830
PLN832 1 850623622
PLN833 1 614136911
PLN834 1 723255126
PLN835 1 669876730
PLN836 1 507533340
PLN837 1 712168462
PLN838 1 712339524
PLN839 1 564869106
PLN84 7 376229618
PLN840 1 619418949
PLN841 1 715454519
PLN842 1 478264344
PLN843 1 734693445
PLN844 1 749685439
PLN845 1 633598967
PLN846 1 782818162
PLN847 1 1022071454
PLN848 1 971920087
PLN849 1 827198496
PLN85 6 342806685
PLN850 1 867619200
PLN851 1 806566123
PLN852 1 1015700474
PLN853 1 742303966
PLN854 1 956173857
PLN855 1 916702776
PLN856 1 874517040
PLN857 1 816294110
PLN858 1 750216944
PLN859 1 862608691
PLN86 6 347730275
PLN860 20 4493
PLN861 175 140763171
PLN862 1 516505932
PLN863 1 665585731
PLN864 1 621516506
PLN865 1 610333535
PLN866 1 588218686
PLN867 1 561794515
PLN868 1 632540561
PLN869 118 87991
PLN87 6 350661716
PLN870 1 313789095
PLN871 1 248068439
PLN872 1 241454477
PLN873 1 251811976
PLN874 1 225452224
PLN875 1 173806927
PLN876 2 370152128
PLN877 168 374290347
PLN878 603 391598667
PLN879 10 362580157
PLN88 43 144640005
PLN880 7 281547701
PLN881 1 314258027
PLN882 1 394306295
PLN883 1 325599754
PLN884 1 288763641
PLN885 1 187311108
PLN886 1 277174932
PLN887 1 235078182
PLN888 15 332895745
PLN889 16436 36185494
PLN89 144 326417895
PLN890 5636 1862075
PLN891 5224 2478918
PLN892 1 563502314
PLN893 833 298337632
PLN894 1194 92707173
PLN895 1 594102056
PLN896 1 689851870
PLN897 1 495453186
PLN898 1 780798557
PLN899 1 801256715
PLN9 35208 291130285
PLN90 7 298887356
PLN900 1 651852609
PLN901 1 750843639
PLN902 1 830829764
PLN903 1 615552423
PLN904 1 744588157
PLN905 1 673617499
PLN906 1 509857067
PLN907 1 709773743
PLN908 1 713149757
PLN909 1 566080677
PLN91 6 332369654
PLN910 1 618079260
PLN911 1 720988478
PLN912 1 473592718
PLN913 1 736706236
PLN914 1 750620385
PLN915 1 638686055
PLN916 1 480980714
PLN917 6684 330577769
PLN918 3760 370633860
PLN919 10098 326491459
PLN92 50 340388796
PLN920 1753 12315783
PLN921 1 585266722
PLN922 1 681112512
PLN923 1 775448786
PLN924 1 790338525
PLN925 1 746673839
PLN926 1 836514780
PLN927 1 736872137
PLN928 1 676292951
PLN929 1 669155517
PLN93 72 344929940
PLN930 1 701372996
PLN931 1 615672275
PLN932 1 698614761
PLN933 1 728031845
PLN934 1 722970987
PLN935 12302 8480478
PLN936 94681 142561266
PLN937 109090 181641064
PLN938 87279 199564020
PLN939 84129 200954349
PLN94 5 245775000
PLN940 96868 192943678
PLN941 103865 188895047
PLN942 102009 189116977
PLN943 15491 37541448
PLN944 88832 206698701
PLN945 83936 206559176
PLN946 73571 223530394
PLN947 45437 143389388
PLN948 68341 231927489
PLN949 70009 218588942
PLN95 202 322775705
PLN950 62974 240203405
PLN951 2845 15946229
PLN952 65293 235301936
PLN953 48558 247902789
PLN954 46176 247748960
PLN955 26973 81557532
PLN956 63570 234641446
PLN957 53703 243438720
PLN958 49848 249206620
PLN959 52150 261769668
PLN96 6 336790634
PLN960 56871 240638114
PLN961 18140 61770163
PLN962 54302 252904792
PLN963 60680 234291415
PLN964 54347 244356414
PLN965 54824 194576642
PLN966 57087 241813713
PLN967 37920 261634113
PLN968 39457 279390503
PLN969 43859 261215907
PLN97 5 336035871
PLN970 8155 42475962
PLN971 55139 255039441
PLN972 84862 208194190
PLN973 59760 247411821
PLN974 31618 144930376
PLN975 50274 251596424
PLN976 68065 227279730
PLN977 55183 245989791
PLN978 3159 373245447
PLN979 5 248779719
PLN98 6 326965702
PLN980 1 528447123
PLN981 1 678170541
PLN982 1 639558213
PLN983 1 629672760
PLN984 1 608467472
PLN985 1 565695744
PLN986 1 634886329
PLN987 1 532083992
PLN988 1 684376481
PLN989 1 642597466
PLN99 5 304407451
PLN990 1 631979072
PLN991 1 607115911
PLN992 1 582960187
PLN993 1 640026769
PLN994 1 608979116
PLN995 1 720972993
PLN996 1 501257520
PLN997 1 804602427
PLN998 1 808121247
PLN999 1 649118519
PRI1 23047 60053106
PRI10 2265 387936439
PRI11 4375 381717987
PRI12 2068 191950792
PRI13 2459 391017609
PRI14 17344 243217043
PRI15 27929 79132073
PRI16 96050 166265556
PRI17 11025 363947920
PRI18 3741 383223079
PRI19 15303 353911286
PRI2 23840 319341223
PRI20 2239 172855211
PRI21 1 250749103
PRI22 1 238414537
PRI23 2 387789264
PRI24 2 351926207
PRI25 2 301224727
PRI26 2 270924633
PRI27 3 376243325
PRI28 4 374251276
PRI29 5 290585290
PRI3 2613 370370379
PRI30 42294 314449515
PRI31 19027 23602325
PRI32 53141 193817517
PRI33 4 351860731
PRI34 5 337827736
PRI35 3 297245061
PRI36 3 382019003
PRI37 2 285375381
PRI38 2 306826759
PRI39 2 354172067
PRI4 2409 360399901
PRI40 2 394680893
PRI41 1 242696752
PRI42 1 248387328
PRI43 4 371167820
PRI44 2 290544102
PRI45 2 335697777
PRI46 2 374932259
PRI47 1 201098049
PRI48 3 342821652
PRI49 3 371410816
PRI5 2593 353874487
PRI50 4 353958876
PRI51 2 221992011
PRI52 2 268816427
PRI53 3 329857110
PRI54 2 306891344
PRI55 2 363287609
PRI56 2 393898061
PRI57 3 335616699
PRI58 1 67035426
PRI59 3 394194787
PRI6 2112 282951291
PRI60 4 380502592
PRI61 3 376790148
PRI62 4 383911555
PRI63 4 342693529
PRI64 3 384141413
PRI65 2 278974018
PRI66 2 263254124
PRI67 2 330993517
PRI68 2 383734792
PRI69 2 373687171
PRI7 2729 356953890
PRI70 1 203129947
PRI71 15168 359633645
PRI72 115045 180133353
PRI73 49464 97857466
PRI74 74331 199953923
PRI75 54422 215579299
PRI76 34648 144367010
PRI77 69722 214218592
PRI78 97880 190622378
PRI79 1501 237911116
PRI8 3181 362167571
PRI80 1 190673448
PRI81 9368 358512524
PRI82 48933 210767481
PRI83 61478 143044439
PRI84 50503 254665362
PRI85 59986 242473060
PRI86 56714 294628503
PRI87 323 7289753
PRI9 2423 385530941
ROD1 38463 309689602
ROD10 15053 352243468
ROD100 5 331474410
ROD101 2 318539651
ROD102 3 346986554
ROD103 2 195914539
ROD104 3 320471619
ROD105 2 303502892
ROD106 2 280790320
ROD107 3 392932004
ROD108 4 351698734
ROD109 2 368221265
ROD11 1336 2453179
ROD110 2 303625032
ROD111 2 292706097
ROD112 2 278161066
ROD113 3 373049758
ROD114 3 349653794
ROD115 3 308876130
ROD116 4 238660990
ROD117 2 379622902
ROD118 2 334811729
ROD119 2 307236712
ROD12 22213 347967024
ROD120 2 287806543
ROD121 3 391762678
ROD122 3 360814732
ROD123 3 314134467
ROD124 4 239932575
ROD125 2 373193903
ROD126 1 157584965
ROD127 2 299783671
ROD128 2 295158694
ROD129 3 388896513
ROD13 1002 157743814
ROD130 3 359745676
ROD131 3 334741362
ROD132 5 333237167
ROD133 2 317726462
ROD134 1 118876157
ROD135 3 341713382
ROD136 4 374029993
ROD137 3 389445867
ROD138 2 291998396
ROD139 2 278095263
ROD14 53466 238707702
ROD140 4 390852856
ROD141 2 370533799
ROD142 2 304047488
ROD143 2 292691026
ROD144 2 276929041
ROD145 3 372795034
ROD146 3 347692711
ROD147 3 308420172
ROD148 4 236625227
ROD149 2 370341452
ROD15 21658 310382782
ROD150 2 307760277
ROD151 2 294424009
ROD152 2 281871870
ROD153 3 372472209
ROD154 3 349207861
ROD155 2 214783614
ROD156 5 332654019
ROD157 2 367229262
ROD158 2 304331769
ROD159 2 288798215
ROD16 228306 97098819
ROD160 2 275554257
ROD161 2 251405689
ROD162 3 354090641
ROD163 3 326613543
ROD164 5 331013327
ROD165 2 368057253
ROD166 2 306226071
ROD167 1 147422267
ROD168 2 291393309
ROD169 3 385188841
ROD17 97458 65701988
ROD170 3 355338747
ROD171 3 326750920
ROD172 5 331081197
ROD173 1 196977572
ROD174 2 340285783
ROD175 2 310111918
ROD176 2 296020819
ROD177 2 268302591
ROD178 3 367814812
ROD179 3 354083518
ROD18 40589 251998774
ROD180 4 377434897
ROD181 2 58596888
ROD182 2 316597187
ROD183 3 346141334
ROD184 3 309646819
ROD185 3 235883790
ROD186 2 332395505
ROD187 2 297647048
ROD188 2 282771228
ROD189 4 393253035
ROD19 2 383374219
ROD190 2 311845466
ROD191 3 332317170
ROD192 4 331904146
ROD193 2 328442178
ROD194 2 293393805
ROD195 1 133371210
ROD196 2 271974197
ROD197 2 251802734
ROD198 13 271995219
ROD199 2 270496589
ROD2 1810 346955540
ROD20 2 353017828
ROD200 3 366902997
ROD201 3 316563723
ROD202 2 193388464
ROD203 4 334716799
ROD204 5 351324292
ROD205 7 371849360
ROD206 6 366049425
ROD207 3 376938858
ROD208 3 338808579
ROD209 4 381108299
ROD21 2 317259772
ROD210 4 323564818
ROD211 6 393907859
ROD212 8 351603620
ROD213 8 357587743
ROD214 1 188060799
ROD215 2 341922886
ROD216 2 316883888
ROD217 2 280377800
ROD218 3 347137656
ROD219 3 315189109
ROD22 2 289653994
ROD220 3 271011851
ROD221 5 354922138
ROD222 5 294688320
ROD223 2 387647059
ROD224 2 325165809
ROD225 2 311669100
ROD226 2 279641759
ROD227 3 378019186
ROD228 3 366857421
ROD229 4 391937005
ROD23 1 140975125
ROD230 3 259447828
ROD231 2 338914351
ROD232 1 159396618
ROD233 2 300967943
ROD234 2 278090573
ROD235 3 382029770
ROD236 3 346788880
ROD237 4 341355724
ROD238 3 299539788
ROD239 2 384716882
ROD24 3 385591618
ROD240 2 334812016
ROD241 2 317562325
ROD242 2 297867706
ROD243 3 391596307
ROD244 3 375850127
ROD245 3 319077903
ROD246 1 96079412
ROD247 4 372403099
ROD248 2 339353113
ROD249 2 291476052
ROD25 4 335044383
ROD250 3 361948668
ROD251 3 323820154
ROD252 4 334059592
ROD253 2 135967815
ROD254 6 388732520
ROD255 2 384840810
ROD256 2 325715141
ROD257 2 293400725
ROD258 3 361928079
ROD259 3 312575313
ROD26 5 356599364
ROD260 4 339307352
ROD261 6 387071614
ROD262 3 323777831
ROD263 2 323038558
ROD264 2 290396403
ROD265 3 353192969
ROD266 2 176309395
ROD267 4 317700958
ROD268 5 354035076
ROD269 5 364586500
ROD27 2 394024503
ROD270 2 377919911
ROD271 2 322351463
ROD272 2 275598125
ROD273 3 359387094
ROD274 4 359114848
ROD275 5 381796720
ROD276 5 291605963
ROD277 2 349406529
ROD278 2 332414924
ROD279 1 154951719
ROD28 2 369416674
ROD280 2 276957429
ROD281 3 340415119
ROD282 4 344898844
ROD283 5 391338277
ROD284 5 302617006
ROD285 2 360867642
ROD286 2 323987561
ROD287 2 295177884
ROD288 3 353085942
ROD289 4 349381944
ROD29 2 335852806
ROD290 5 391992857
ROD291 6 346362378
ROD292 2 318921425
ROD293 2 329179204
ROD294 1 153606186
ROD295 3 389462371
ROD296 3 321351180
ROD297 4 331856423
ROD298 6 392378592
ROD299 4 297015981
ROD3 1885 351998373
ROD30 2 300392300
ROD300 2 343527564
ROD301 3 385070196
ROD302 3 320857378
ROD303 4 353697838
ROD304 5 370381281
ROD305 6 372002468
ROD306 6 198546824
ROD307 1 239886027
ROD308 2 370791914
ROD309 2 305296299
ROD31 2 283621167
ROD310 3 391064350
ROD311 3 347656586
ROD312 3 320467346
ROD313 5 376772270
ROD314 7 266426420
ROD315 3 364883269
ROD316 3 327896669
ROD317 4 388546352
ROD318 1 97315161
ROD319 5 392290651
ROD32 3 348161973
ROD320 6 378764355
ROD321 8 385917731
ROD322 3 388132291
ROD323 2 221032399
ROD324 3 325123266
ROD325 4 364878457
ROD326 5 393396691
ROD327 6 385454209
ROD328 8 384738797
ROD329 2 389695544
ROD33 5 386542915
ROD330 4 389252158
ROD331 5 367225846
ROD332 6 358950715
ROD333 7 366763757
ROD334 135 372516827
ROD335 1 200613070
ROD336 2 346645949
ROD337 2 327907555
ROD338 2 291370549
ROD339 3 359406685
ROD34 154 237877425
ROD340 3 316625883
ROD341 4 340925316
ROD342 6 362634820
ROD343 25268 85438509
ROD35 1 193958709
ROD36 2 350925653
ROD37 2 319642044
ROD38 2 276360533
ROD39 3 382322699
ROD4 1944 361078959
ROD40 3 366447402
ROD41 84 375321811
ROD42 2 329179204
ROD43 2 290564596
ROD44 3 362508543
ROD45 3 304367499
ROD46 5 385423505
ROD47 6 342729329
ROD48 3 325864489
ROD49 4 358685719
ROD5 1990 363733749
ROD50 4 302148481
ROD51 5 337904903
ROD52 6 385168143
ROD53 6 347801590
ROD54 6 283624907
ROD55 86515 225801977
ROD56 11390 220046248
ROD57 2 307631349
ROD58 2 273205312
ROD59 2 272523522
ROD6 306 57843793
ROD60 3 367476852
ROD61 3 318205593
ROD62 5 305035074
ROD63 2 318173246
ROD64 2 308990189
ROD65 2 273361793
ROD66 3 387778067
ROD67 3 350884214
ROD68 4 388911322
ROD69 4 237246301
ROD7 1975 368354297
ROD70 2 368078907
ROD71 2 295232279
ROD72 2 276158786
ROD73 3 370764878
ROD74 3 367374895
ROD75 5 389069045
ROD76 100 129934266
ROD77 2 318742393
ROD78 3 344928637
ROD79 4 373808507
ROD8 1990 369693686
ROD80 3 390678500
ROD81 2 278778348
ROD82 2 267696443
ROD83 2 294192228
ROD84 3 240341385
ROD85 2 368562428
ROD86 2 305746062
ROD87 2 295306346
ROD88 2 279190114
ROD89 1 126990816
ROD9 1959 368016559
ROD90 3 364697793
ROD91 3 342498328
ROD92 4 374582747
ROD93 3 249713888
ROD94 2 330770236
ROD95 2 292927924
ROD96 2 286762350
ROD97 3 381058419
ROD98 3 353678059
ROD99 3 326328631
STS1 170409 86845107
STS10 202241 61367008
STS11 167006 59450871
STS2 143555 63324543
STS3 8291 4867412
STS4 108725 63673512
STS5 110380 70041358
STS6 106165 81422843
STS7 122522 86626105
STS8 198951 60928175
STS9 8743 2376203
SYN1 54444 100627167
SYN10 2 382762979
SYN11 2 332214168
SYN12 4 386933112
SYN13 1 271050050
SYN14 2 294093621
SYN15 3 329883353
SYN16 4 353920981
SYN17 2 328712085
SYN18 4 357672913
SYN19 1 207870274
SYN2 1 271050050
SYN20 2 382762979
SYN21 2 332214168
SYN22 8 392789107
SYN23 99 283919894
SYN24 5268 259690287
SYN25 61160 179548013
SYN26 9183 352928592
SYN27 17230 334487459
SYN28 109337 160831254
SYN29 33276 99733669
SYN3 2 294093621
SYN30 22183 296511032
SYN4 3 329883353
SYN5 4 353920981
SYN6 1 64242768
SYN7 3 371658272
SYN8 2 250483958
SYN9 1 207870274
TSA1 233360 79647647
TSA10 168556 151807723
TSA100 63252 114802277
TSA101 79841 41351312
TSA102 82721 28609319
TSA103 67721 19747702
TSA104 84021 22863253
TSA105 84236 21912832
TSA106 84446 20981295
TSA107 134042 46621688
TSA108 156378 149913811
TSA109 183785 102062896
TSA11 157777 129834268
TSA110 46582 106286710
TSA111 136867 166252974
TSA112 166495 124901244
TSA113 97423 237859520
TSA114 99257 234633653
TSA115 12708 5978473
TSA116 134189 172362066
TSA117 127781 180160426
TSA118 129595 177105775
TSA119 121186 168272985
TSA12 97090 81392351
TSA120 161588 123667649
TSA121 122311 187541168
TSA122 147961 145186533
TSA123 94592 61300137
TSA124 136202 168455642
TSA125 159235 124954199
TSA126 156460 125810552
TSA127 123500 121448801
TSA13 143803 166125438
TSA14 181274 128537289
TSA15 66503 19953423
TSA16 206960 109167065
TSA17 187291 103573225
TSA18 49603 65723896
TSA19 154594 149438301
TSA2 222146 88664556
TSA20 216430 100054673
TSA21 205490 102782849
TSA22 23776 14252292
TSA23 157937 126687163
TSA24 173072 148399453
TSA25 214206 84411561
TSA26 107859 75824864
TSA27 170344 70732329
TSA28 221651 89477532
TSA29 29733 20452936
TSA3 74968 22652895
TSA30 203801 105213489
TSA31 180099 145440715
TSA32 69822 31097770
TSA33 187392 125238542
TSA34 147367 170573228
TSA35 162061 143463244
TSA36 151566 162792015
TSA37 167242 151938086
TSA38 140834 133825444
TSA39 170040 156652284
TSA4 197157 115804961
TSA40 69540 96684132
TSA41 171682 122074705
TSA42 189724 128201705
TSA43 179004 130074585
TSA44 75912 43109145
TSA45 179829 148956459
TSA46 157580 110411669
TSA47 134660 95403465
TSA48 183454 131877937
TSA49 208660 102956314
TSA5 214836 133894002
TSA50 80586 111968754
TSA51 191615 109275606
TSA52 179810 117228216
TSA53 113652 119320342
TSA54 155201 136003572
TSA55 161488 91817237
TSA56 130889 143855858
TSA57 137079 81286772
TSA58 155441 162401639
TSA59 162373 156460053
TSA6 19260 21470091
TSA60 193151 120607701
TSA61 58953 96808413
TSA62 173239 118026196
TSA63 151994 161916401
TSA64 61517 124800188
TSA65 201330 152320116
TSA66 185417 143496051
TSA67 162494 121036165
TSA68 181441 137352733
TSA69 171437 97550710
TSA7 193237 53106267
TSA70 41533 39009849
TSA71 119065 123313318
TSA72 131964 141438855
TSA73 151655 115933671
TSA74 830 251943
TSA75 153005 102368390
TSA76 156511 143520695
TSA77 40571 33632062
TSA78 176683 138455592
TSA79 161599 158562361
TSA8 156250 122191293
TSA80 11806 9816655
TSA81 185669 115791752
TSA82 143260 147547562
TSA83 177228 144669069
TSA84 158729 177360001
TSA85 18209 12701058
TSA86 168396 128972709
TSA87 156485 150537294
TSA88 194540 124973144
TSA89 32593 22930994
TSA9 101489 69225839
TSA90 195904 138162133
TSA91 113368 113467451
TSA92 98986 206634893
TSA93 87112 229168164
TSA94 77344 247719367
TSA95 30093 107285833
TSA96 141033 144555977
TSA97 106053 76615758
TSA98 74413 65471527
TSA99 33768 32853514
UNA1 769 4547944
VRL1 131569 138894771
VRL10 72928 93412453
VRL100 9795 222894634
VRL100 12704 377383509
VRL100 11005 326905059
VRL100 12701 377344883
VRL100 12731 377820619
VRL100 12740 378056851
VRL100 13981 367611615
VRL100 2023 60413061
VRL100 12174 363492409
VRL100 12166 363174877
VRL100 12167 363247246
VRL101 10136 221723406
VRL101 12166 363224933
VRL101 2464 73649255
VRL101 12081 361112133
VRL101 12144 363017548
VRL101 12243 365758146
VRL101 9064 270726767
VRL101 12253 365988387
VRL101 12191 364194554
VRL101 12193 364253756
VRL101 12192 364228103
VRL102 3449 91082311
VRL102 3904 116628647
VRL102 12199 364432918
VRL102 12194 364284949
VRL102 12195 364311625
VRL102 12196 364344136
VRL102 12206 364633281
VRL102 2531 75613725
VRL102 12190 364142810
VRL102 12194 364288192
VRL102 12198 364404453
VRL103 9650 221588341
VRL103 12197 364371943
VRL103 7501 224086702
VRL103 12170 363577169
VRL103 12171 363631709
VRL103 12071 360731545
VRL103 7688 229799096
VRL103 12099 361553960
VRL103 12036 358875297
VRL103 11949 355733738
VRL103 11972 356420071
VRL104 11778 218869079
VRL104 12097 360564261
VRL104 4354 129886834
VRL104 11949 355721224
VRL104 12094 355995729
VRL104 11981 356795341
VRL104 4439 132151081
VRL104 12173 359695926
VRL104 12211 364622123
VRL104 12252 365767417
VRL104 12651 369747947
VRL105 9455 221344361
VRL105 10941 326739433
VRL105 12529 373768611
VRL105 12512 373692115
VRL105 12494 373157930
VRL105 12498 373298889
VRL105 6675 199371337
VRL105 12368 369502588
VRL105 11993 358430988
VRL105 11971 357718699
VRL105 11954 357163824
VRL106 3926 112500422
VRL106 11949 357022292
VRL106 2379 71081792
VRL106 11929 356424413
VRL106 11944 356873064
VRL106 12017 359107647
VRL106 4107 122733379
VRL106 12152 363181376
VRL106 12085 361144370
VRL106 14799 364549667
VRL106 12179 361564551
VRL107 7740 222413091
VRL107 12415 363149841
VRL107 7959 176981963
VRL107 7773 223400067
VRL107 7934 224141563
VRL107 11190 221038789
VRL107 6359 157054649
VRL107 7915 223518166
VRL107 8075 224331166
VRL107 9121 224451456
VRL107 4203 118988184
VRL108 9253 221857005
VRL108 9919 222714717
VRL108 7739 224499882
VRL108 10421 222049549
VRL108 2980 61147173
VRL108 12729 220158320
VRL108 21071 210375945
VRL108 9867 224824706
VRL108 5211 64368534
VRL108 18253 217399877
VRL108 14423 219349366
VRL109 7809 221674567
VRL109 14651 212691442
VRL109 8765 63570859
VRL109 9103 222843865
VRL109 7527 223765790
VRL109 8627 222511631
VRL109 50022 131690819
VRL11 120961 144235782
VRL110 8275 198201474
VRL111 7547 222351449
VRL112 8008 221562610
VRL113 7869 221743555
VRL114 2191 65297472
VRL115 8465 221484293
VRL116 7710 221269212
VRL117 10236 220766080
VRL118 7766 222257182
VRL119 174 5185343
VRL12 43854 307766420
VRL120 7825 219494238
VRL121 7362 217947535
VRL122 8228 221900094
VRL123 3876 115020512
VRL124 7642 221204272
VRL125 7468 222605611
VRL126 8350 222718674
VRL127 7445 219700261
VRL128 158 4680085
VRL129 7990 218389264
VRL13 115980 144609275
VRL130 8956 221307070
VRL131 7510 220577308
VRL132 7362 217947954
VRL133 5507 161821308
VRL134 12345 369032529
VRL135 12370 369697978
VRL136 12372 369939371
VRL137 12364 369688221
VRL138 12362 369613714
VRL139 5694 170227962
VRL14 23230 82109795
VRL140 12371 369781020
VRL141 12373 369792803
VRL142 12375 369826375
VRL143 8053 240653467
VRL144 12388 370186985
VRL145 12383 370039801
VRL146 12371 369530068
VRL147 5929 175935992
VRL148 7438 221720425
VRL149 8140 222155693
VRL15 113804 144617802
VRL150 7765 221293296
VRL151 2946 83655703
VRL152 7942 222816214
VRL153 7470 221831148
VRL154 8023 221748161
VRL155 9140 220633913
VRL156 3899 115600600
VRL157 7575 220443196
VRL158 7401 219629478
VRL159 7406 219532528
VRL16 112032 147827613
VRL160 3637 104745014
VRL161 7431 218929276
VRL162 7906 222150305
VRL163 7706 219545819
VRL164 7640 222818655
VRL165 4272 119373144
VRL166 8010 221376536
VRL167 7446 221334576
VRL168 7356 217836218
VRL169 8076 221009370
VRL17 27186 44775593
VRL170 3657 102101919
VRL171 7436 221704344
VRL172 7410 220394033
VRL173 7571 220559196
VRL174 5270 151251118
VRL175 7594 221660605
VRL176 7478 221621778
VRL177 7587 219155405
VRL178 1998 59113996
VRL179 7585 221735125
VRL18 90437 158855355
VRL180 7825 221774298
VRL181 7427 220819814
VRL182 2346 68509657
VRL183 8076 222756930
VRL184 7940 222724721
VRL185 7838 223110568
VRL186 7628 218210704
VRL187 7357 217798071
VRL188 7620 221860214
VRL189 7628 222849873
VRL19 96099 150066351
VRL190 7935 222614648
VRL191 111 3306166
VRL192 7439 221651602
VRL193 7682 222021648
VRL194 7603 221247265
VRL195 2635 78589590
VRL196 7594 221755119
VRL197 7380 218829625
VRL198 7520 220151146
VRL199 7492 222660467
VRL2 126082 150987682
VRL20 62231 101189790
VRL200 4430 119383423
VRL201 7684 222455370
VRL202 7756 221970237
VRL203 8868 221773053
VRL204 7736 218194664
VRL205 4230 124556162
VRL206 8143 222118020
VRL207 7511 221472177
VRL208 7658 224114337
VRL209 9453 223793297
VRL21 92195 165746519
VRL210 4799 139324692
VRL211 7778 221939633
VRL212 8946 222539688
VRL213 7483 221572525
VRL214 7389 218445357
VRL215 4264 126966021
VRL216 7730 221768471
VRL217 8227 221663692
VRL218 8241 224040126
VRL219 7931 223166239
VRL22 90967 163599188
VRL220 4181 119700551
VRL221 7677 221727657
VRL222 7552 222965042
VRL223 7350 217830294
VRL224 8163 223062940
VRL225 4342 126419141
VRL226 7958 222343966
VRL227 9532 219763888
VRL228 8556 221891762
VRL229 7446 221412869
VRL23 54339 121543406
VRL230 4178 123763074
VRL231 7431 220439583
VRL232 7593 222276558
VRL233 7837 222399555
VRL234 7434 221582922
VRL235 4423 121925836
VRL236 7929 222176848
VRL237 7761 221641221
VRL238 7723 221883481
VRL239 7388 219609882
VRL24 83025 172220824
VRL240 3540 105091412
VRL241 7432 221490436
VRL242 7537 222032585
VRL243 8151 222521755
VRL244 7669 222610990
VRL245 3936 117093658
VRL246 7574 222770999
VRL247 8806 222543505
VRL248 7410 219746483
VRL249 7424 221266771
VRL25 85546 166895551
VRL250 3925 117003284
VRL251 7424 221004936
VRL252 8380 222232357
VRL253 7644 221172283
VRL254 7559 221906285
VRL255 4016 117132872
VRL256 7980 220734403
VRL257 7386 219283530
VRL258 7783 221314684
VRL259 2048 61046862
VRL26 70044 119982540
VRL260 9072 220397573
VRL261 8253 221900950
VRL262 8798 221891752
VRL263 2173 64735180
VRL264 7463 221769723
VRL265 7462 222264480
VRL266 7402 220051865
VRL267 7636 221552696
VRL268 8063 221905076
VRL269 7619 222827814
VRL27 82594 167339145
VRL270 3658 109021120
VRL271 7466 221888492
VRL272 8021 220969558
VRL273 7694 222344146
VRL274 7808 222313633
VRL275 3781 112702688
VRL276 7527 221461366
VRL277 7745 220864075
VRL278 7737 222384070
VRL279 7502 221857431
VRL28 83162 166422124
VRL280 4725 116944828
VRL281 7510 220262506
VRL282 7486 221844509
VRL283 7595 222163951
VRL284 7466 221334941
VRL285 6226 184574828
VRL286 7451 221948430
VRL287 7446 221941433
VRL288 7491 222054544
VRL289 2481 73963232
VRL29 50806 113098957
VRL290 7519 222265703
VRL291 7667 222371933
VRL292 7519 222801965
VRL293 3392 101114242
VRL294 7541 218788614
VRL295 7641 221623371
VRL296 7446 221429004
VRL297 4656 137549576
VRL298 7455 230678110
VRL299 7680 220306131
VRL3 93532 168060424
VRL30 90654 178588276
VRL300 7770 222848711
VRL301 4082 119607224
VRL302 7972 221579339
VRL303 7382 219925223
VRL304 7526 221517245
VRL305 5550 165290465
VRL306 7504 221885756
VRL307 8205 222928193
VRL308 7441 220245299
VRL309 5817 171715446
VRL31 34123 302875051
VRL310 7513 222403973
VRL311 7601 223191798
VRL312 7559 222946757
VRL313 7472 220369275
VRL314 377 11231463
VRL315 7865 220324747
VRL316 7514 220301134
VRL317 7492 222701928
VRL318 4238 120052508
VRL319 13128 228485496
VRL32 77874 184388680
VRL320 7415 219048485
VRL321 8319 221528474
VRL322 3745 111430642
VRL323 7779 222427509
VRL324 7586 221187702
VRL325 7527 220775836
VRL326 2508 73321851
VRL327 7800 221583677
VRL328 8142 221615902
VRL329 8612 221100362
VRL33 60959 147425106
VRL330 8711 220054088
VRL331 1049 31248870
VRL332 7853 220693310
VRL333 7435 219775426
VRL334 7416 220390680
VRL335 7248 203105310
VRL336 20449 210572516
VRL337 7440 220960934
VRL338 8441 219147308
VRL339 7683 220128958
VRL34 67608 181934689
VRL340 34 1013669
VRL341 7340 218437065
VRL342 7517 221971863
VRL343 7531 221073709
VRL344 10947 221157812
VRL345 2216 65973623
VRL346 9184 220799700
VRL347 7828 222148265
VRL348 7400 219474138
VRL349 3082 83056403
VRL35 77880 184815065
VRL350 7485 220684760
VRL351 7660 219868450
VRL352 7626 220669528
VRL353 6828 200274547
VRL354 7578 221737035
VRL355 7529 221550216
VRL356 7383 218633333
VRL357 3423 98618833
VRL358 7596 222361948
VRL359 7675 221563923
VRL36 66619 159461653
VRL360 7399 220313944
VRL361 5495 160014237
VRL362 7820 221568143
VRL363 7525 221084119
VRL364 7419 219871130
VRL365 8190 219578851
VRL366 2304 68629377
VRL367 8928 217968848
VRL368 7999 220769513
VRL369 7460 221243634
VRL37 74528 192221569
VRL370 7385 219162957
VRL371 7732 220641119
VRL372 7482 219844968
VRL373 7878 221136455
VRL374 7565 220521556
VRL375 9909 218782899
VRL376 7844 222143459
VRL377 7468 221413584
VRL378 4938 123750203
VRL379 7658 219781629
VRL38 83875 169583772
VRL380 7551 222101387
VRL381 8042 221512432
VRL382 4539 115826637
VRL383 7595 221636930
VRL384 8229 220498062
VRL385 8477 221313062
VRL386 3562 104684083
VRL387 8068 221144032
VRL388 9371 219994695
VRL389 8349 219962552
VRL39 73101 148527195
VRL390 4589 133546685
VRL391 7619 223791272
VRL392 8855 223159050
VRL393 8018 222816370
VRL394 3673 98908472
VRL395 8975 220382463
VRL396 7626 222741779
VRL397 7751 222543139
VRL398 2684 72400598
VRL399 8469 221665726
VRL4 12053 222457284
VRL40 78305 176710707
VRL400 7529 222867640
VRL401 8068 222921415
VRL402 3511 103625228
VRL403 8724 221586329
VRL404 7540 222593665
VRL405 8394 222166937
VRL406 6942 203100840
VRL407 8249 223295751
VRL408 7888 222961332
VRL409 7674 221779668
VRL41 70465 179207354
VRL410 6811 184476500
VRL411 7873 222439223
VRL412 7882 222344915
VRL413 7541 223579550
VRL414 2852 84712584
VRL415 7573 223520412
VRL416 8879 219519426
VRL417 7706 222082073
VRL418 3919 107635063
VRL419 7832 220656189
VRL42 43948 197406569
VRL420 7895 223377518
VRL421 7613 221172600
VRL422 3279 93639546
VRL423 11932 217456494
VRL424 7657 221038515
VRL425 7730 220705079
VRL426 6937 178542043
VRL427 8707 222109765
VRL428 7558 223852914
VRL429 7728 221143983
VRL43 21244 138869597
VRL430 4727 132388134
VRL431 7820 219976645
VRL432 7519 222458098
VRL433 7384 218780069
VRL434 5849 167601166
VRL435 10549 219333938
VRL436 7710 222351573
VRL437 8921 218464746
VRL438 7817 220526427
VRL439 1887 54218419
VRL44 25055 217763452
VRL440 8131 222993387
VRL441 8250 222795973
VRL442 7670 224466742
VRL443 3171 93752799
VRL444 8381 221312902
VRL445 7525 220205402
VRL446 7625 222512972
VRL447 7938 222521779
VRL448 9663 223384609
VRL449 5989 177512443
VRL45 15136 218683822
VRL450 10206 221711088
VRL451 7531 222839087
VRL452 7457 222234031
VRL453 4548 123559243
VRL454 8028 220609338
VRL455 8183 219945858
VRL456 8657 220640976
VRL457 2487 73935070
VRL458 7743 225062862
VRL459 10157 217494212
VRL46 33788 207520730
VRL460 7700 221647396
VRL461 6261 169645128
VRL462 9489 225067854
VRL463 7792 219926719
VRL464 8438 222670077
VRL465 9679 223991122
VRL466 4569 123035592
VRL467 7877 224461783
VRL468 7760 220225115
VRL469 10775 220173152
VRL47 11365 129036868
VRL470 4115 122105870
VRL471 8301 224632793
VRL472 7536 220511234
VRL473 7902 223697392
VRL474 5336 150637614
VRL475 8047 220491182
VRL476 9236 221194044
VRL477 9041 219045374
VRL478 4631 125048012
VRL479 9787 220236604
VRL48 18951 217642108
VRL480 8019 221725831
VRL481 8693 219189816
VRL482 6434 126399760
VRL483 11930 216616123
VRL484 7433 219824600
VRL485 7821 221847340
VRL486 7394 202787004
VRL487 8045 220685919
VRL488 8045 221263397
VRL489 7908 221232564
VRL49 25259 214632337
VRL490 8466 205691712
VRL491 10204 222165513
VRL492 7696 220866804
VRL493 7567 221354902
VRL494 7729 222439928
VRL495 7762 222854389
VRL496 7605 220206476
VRL497 3582 105422037
VRL498 11967 218775844
VRL499 9914 221523141
VRL5 5487 9189768
VRL50 17134 217891465
VRL500 8280 223517542
VRL501 7420 220428526
VRL502 5150 116588094
VRL503 7521 223085922
VRL504 8362 222420875
VRL505 8105 220203671
VRL506 4162 123822105
VRL507 8027 220700155
VRL508 6799 227673871
VRL509 8721 220722135
VRL51 10659 156831400
VRL510 2556 86026104
VRL511 7933 223239839
VRL512 7906 220992356
VRL513 8472 222621040
VRL514 3763 99748509
VRL515 10173 219553112
VRL516 6649 228067841
VRL517 8175 219907464
VRL518 2798 109974996
VRL519 8015 222580358
VRL52 13629 220381406
VRL520 7819 223134889
VRL521 7979 224556048
VRL522 8210 223213873
VRL523 4939 151483975
VRL524 7557 223200900
VRL525 10374 220210222
VRL526 11137 214728875
VRL527 12704 220172605
VRL528 5859 148133620
VRL529 9451 222300383
VRL53 10376 219234428
VRL530 7723 221872355
VRL531 8625 224479074
VRL532 9653 220696992
VRL533 6749 191114348
VRL534 8511 220364900
VRL535 8546 223217772
VRL536 14699 215656924
VRL537 5326 139093121
VRL538 8465 219879309
VRL539 7355 227807669
VRL54 10147 221033028
VRL540 9557 220870304
VRL541 5838 157093426
VRL542 8433 222895648
VRL543 11390 217673900
VRL544 11383 219775555
VRL545 8433 220986262
VRL546 3418 80462275
VRL547 8328 220963135
VRL548 9788 219226027
VRL549 7876 219571898
VRL55 5727 126349438
VRL550 3387 100902308
VRL551 7932 223179020
VRL552 7677 221964082
VRL553 8533 221171612
VRL554 6021 137608301
VRL555 7723 222528551
VRL556 11446 219456099
VRL557 9925 219037682
VRL558 3539 98090076
VRL559 11639 218239635
VRL56 8939 223188128
VRL560 11377 217117045
VRL561 12923 216952061
VRL562 5386 89517221
VRL563 8140 221683716
VRL564 8105 222305994
VRL565 8484 221809508
VRL566 2708 76631504
VRL567 11329 218180057
VRL568 8454 221663103
VRL569 8276 222663700
VRL57 9713 220570663
VRL570 3171 93990521
VRL571 7601 223860255
VRL572 8287 221192926
VRL573 11624 224043181
VRL574 2232 145519660
VRL575 7682 226013759
VRL576 8443 223516268
VRL577 8666 223889715
VRL578 7655 168917636
VRL579 8855 221436987
VRL58 8662 222022397
VRL580 7801 221314004
VRL581 8374 221962046
VRL582 3131 88333979
VRL583 19536 210541861
VRL584 9479 222303510
VRL585 11783 220821602
VRL586 10192 185020675
VRL587 8718 224237779
VRL588 8320 225286626
VRL589 15580 216871515
VRL59 10142 221362831
VRL590 16530 217043843
VRL591 268 7935422
VRL592 8721 221748863
VRL593 7800 223452579
VRL594 7569 223568855
VRL595 2689 79429670
VRL596 9884 220416664
VRL597 22800 218227429
VRL598 14258 217303018
VRL599 11692 181746884
VRL6 93703 148000355
VRL60 3740 86774371
VRL600 8449 224629934
VRL601 12630 221918933
VRL602 11910 220763037
VRL603 10047 214277710
VRL604 12291 219873331
VRL605 9485 223499217
VRL606 12023 224627273
VRL607 8530 223036538
VRL608 2546 42574538
VRL609 7449 222050186
VRL61 10252 221317455
VRL610 7448 222049612
VRL611 7445 221826711
VRL612 2213 63674476
VRL613 9299 224607514
VRL614 12501 220213076
VRL615 12413 223287366
VRL616 5397 92474063
VRL617 10727 220801619
VRL618 9397 221961153
VRL619 8018 221823151
VRL62 13533 217731827
VRL620 3966 85666302
VRL621 13052 218033584
VRL622 10310 222556695
VRL623 13222 219778350
VRL624 2669 69858415
VRL625 16732 219496891
VRL626 11598 221261768
VRL627 10380 221546131
VRL628 5837 81928736
VRL629 9199 222654205
VRL63 8993 220470436
VRL630 8409 222783239
VRL631 7900 223037080
VRL632 10225 220311800
VRL633 3103 88553922
VRL634 12227 365289108
VRL635 12325 368313892
VRL636 6297 188087927
VRL637 1904 56895892
VRL638 12391 370252025
VRL639 12593 375872798
VRL64 11192 219164729
VRL640 12622 376617188
VRL641 6402 190822693
VRL642 12618 376375108
VRL643 12711 378788647
VRL644 12720 379050405
VRL645 7071 210913275
VRL646 12683 378032374
VRL647 12621 376515872
VRL648 12463 372108084
VRL649 4385 130881012
VRL65 2913 82299962
VRL650 12487 372570636
VRL651 12526 373795899
VRL652 12566 374816528
VRL653 3672 109697863
VRL654 12471 372279880
VRL655 12411 370816826
VRL656 12385 370092114
VRL657 6455 192829868
VRL658 12399 370295335
VRL659 12384 370112732
VRL66 7481 220718827
VRL660 12372 369777172
VRL661 3505 104760027
VRL662 12444 371585092
VRL663 12422 371006390
VRL664 12188 367344437
VRL665 2967 88674279
VRL666 3626 108345075
VRL667 12533 374033673
VRL668 12394 370328985
VRL669 12135 361916853
VRL67 8116 221893665
VRL670 3077 91965120
VRL671 12402 370569546
VRL672 12241 365853241
VRL673 12364 369448773
VRL674 11636 347775069
VRL675 12354 368959500
VRL676 12405 369442689
VRL677 12361 369463608
VRL678 3562 106470947
VRL679 12270 366781694
VRL68 9175 219150853
VRL680 12489 372406490
VRL681 12347 368667305
VRL682 8901 266036794
VRL683 12350 368951698
VRL684 12383 369943743
VRL685 12538 374215279
VRL686 12350 369107637
VRL687 6907 206120230
VRL688 12335 368607449
VRL689 12414 370808444
VRL69 18463 212788176
VRL690 12350 369120146
VRL691 12418 370890906
VRL692 1404 41924092
VRL693 12281 367037689
VRL694 12355 369223656
VRL695 12353 369167640
VRL696 9985 298422907
VRL697 12385 370126990
VRL698 12335 368658957
VRL699 12334 368612870
VRL7 86711 143039034
VRL70 2444 68464306
VRL700 8841 264200894
VRL701 12372 369711446
VRL702 12344 368933144
VRL703 12353 369197678
VRL704 6111 182640523
VRL705 12070 360742551
VRL706 11865 354610114
VRL707 12257 366337685
VRL708 7774 232348838
VRL709 12389 370108432
VRL71 7825 220313598
VRL710 12352 369160805
VRL711 12237 365479875
VRL712 7117 212707893
VRL713 12336 368685684
VRL714 12269 366371284
VRL715 12367 369586431
VRL716 7148 213231773
VRL717 12621 376192384
VRL718 12392 370220839
VRL719 12483 372625354
VRL72 7777 220691622
VRL720 7201 215101258
VRL721 12378 369843501
VRL722 12246 365820026
VRL723 12456 371790520
VRL724 7139 213357797
VRL725 12340 368749870
VRL726 12344 368927014
VRL727 12421 370120372
VRL728 6907 206428316
VRL729 12296 367498256
VRL73 8144 220353623
VRL730 12248 366038633
VRL731 12442 372129165
VRL732 12540 373980303
VRL733 3409 101887034
VRL734 12366 369584171
VRL735 12381 370012499
VRL736 12359 369375604
VRL737 12363 369469223
VRL738 1948 58190281
VRL739 12281 366786435
VRL74 6587 182464490
VRL740 12528 373622973
VRL741 12531 373794912
VRL742 12516 373424280
VRL743 2472 73740642
VRL744 12511 373317579
VRL745 12417 370921926
VRL746 12411 370713753
VRL747 2932 87629297
VRL748 12414 370859460
VRL749 12239 365608522
VRL75 7893 221311927
VRL750 12281 366779971
VRL751 3198 95503906
VRL752 12389 370027978
VRL753 12463 371877239
VRL754 12458 371736014
VRL755 3210 95853682
VRL756 12484 372491339
VRL757 12389 369902373
VRL758 12421 370850328
VRL759 12416 370735519
VRL76 8408 220098191
VRL760 3864 115229529
VRL761 12385 369714210
VRL762 12340 368683545
VRL763 12363 369226423
VRL764 6420 191784589
VRL765 12374 369602677
VRL766 12344 368677922
VRL767 12362 369271877
VRL768 12423 370805020
VRL769 7875 235009520
VRL77 8627 218882918
VRL770 12407 370351983
VRL771 12364 369293567
VRL772 12265 366456082
VRL773 9827 293612294
VRL774 12287 367084198
VRL775 12314 367799365
VRL776 12265 366434093
VRL777 12309 367617260
VRL778 12336 368310951
VRL779 12367 369156641
VRL78 6092 160584138
VRL780 3173 94670275
VRL781 12421 370381742
VRL782 12471 372009482
VRL783 12371 369292216
VRL784 12387 369774056
VRL785 12324 368142839
VRL786 11775 351748607
VRL787 12329 368300282
VRL788 12323 368080815
VRL789 12313 367812242
VRL79 12595 218625028
VRL790 12336 368489238
VRL791 9671 288886614
VRL792 12345 368738853
VRL793 12367 369426509
VRL794 12332 368366126
VRL795 12404 370579163
VRL796 2016 60229555
VRL797 12585 371232953
VRL798 12587 376136404
VRL799 12343 368686875
VRL8 91434 144081888
VRL80 8520 219154612
VRL800 12364 369322786
VRL801 12404 370541532
VRL802 8137 243102804
VRL803 12496 373365842
VRL804 12432 371399948
VRL805 12347 368784251
VRL806 12345 368711538
VRL807 9089 271464899
VRL808 12336 368408718
VRL809 12339 368518437
VRL81 8507 221330859
VRL810 12359 369096817
VRL811 12364 369244387
VRL812 595 17768358
VRL813 12381 369696945
VRL814 12374 369501082
VRL815 12379 369644695
VRL816 12369 369361792
VRL817 559 16693996
VRL818 12369 369334319
VRL819 12319 367883423
VRL82 5225 145495902
VRL820 11977 357823472
VRL821 12189 364090905
VRL822 1157 34548722
VRL823 12410 370392096
VRL824 12353 368814433
VRL825 12368 369260664
VRL826 12369 369253976
VRL827 270 8061056
VRL828 12368 369226825
VRL829 12366 369159314
VRL83 7487 220569357
VRL830 12359 368944008
VRL831 6005 179251803
VRL832 12374 369400888
VRL833 12366 369123428
VRL834 12398 370174224
VRL835 12412 370600813
VRL836 1291 38537124
VRL837 12366 369127168
VRL838 12367 369150031
VRL839 12462 371495742
VRL84 7756 222081357
VRL840 12608 375399077
VRL841 1512 45062470
VRL842 12503 372903703
VRL843 12545 374851085
VRL844 12445 371631592
VRL845 4763 142249867
VRL846 12423 370936414
VRL847 12484 372907724
VRL848 12489 373040331
VRL849 4692 140179365
VRL85 7732 222582337
VRL850 12326 368003805
VRL851 12357 368963039
VRL852 12438 371485547
VRL853 4886 146029693
VRL854 12457 371960700
VRL855 12070 360256200
VRL856 11939 356294173
VRL857 5354 159780884
VRL858 12308 367394797
VRL859 12105 361326031
VRL86 809 19987537
VRL860 11914 355237809
VRL861 5524 163959206
VRL862 12538 371903410
VRL863 12591 375430613
VRL864 12558 374548591
VRL865 4880 144920184
VRL866 12639 376713378
VRL867 12655 376553425
VRL868 12555 374447869
VRL869 4942 147491721
VRL87 8446 221799654
VRL870 12541 374002589
VRL871 12655 376277562
VRL872 12646 376463564
VRL873 12651 376010820
VRL874 12587 375090299
VRL875 5286 157447544
VRL876 12554 373766796
VRL877 12634 376058990
VRL878 12672 376416507
VRL879 9395 280019540
VRL88 7794 221823639
VRL880 12589 375044030
VRL881 12627 376412349
VRL882 12616 375952502
VRL883 2976 88570591
VRL884 12667 377031073
VRL885 12460 371429938
VRL886 12367 369022583
VRL887 7720 230064788
VRL888 12689 377040785
VRL889 12696 377435664
VRL89 7414 220726320
VRL890 12564 375068053
VRL891 12421 370661452
VRL892 12556 374506757
VRL893 12559 375397390
VRL894 1985 59310040
VRL895 12563 375268346
VRL896 12493 373092601
VRL897 12544 376479221
VRL898 7193 214852674
VRL899 12208 364524330
VRL9 130922 139330909
VRL90 3112 82363030
VRL900 11870 354290693
VRL901 12426 366602335
VRL902 12465 372204456
VRL903 4809 143349099
VRL904 12575 375508602
VRL905 12547 374776214
VRL906 12526 374129811
VRL907 12453 371821049
VRL908 3728 111382956
VRL909 12536 374510811
VRL91 7987 221802828
VRL910 12522 373995879
VRL911 12553 375021905
VRL912 12550 374886399
VRL913 12515 373703906
VRL914 45 1343589
VRL915 12373 369521193
VRL916 12333 368446726
VRL917 12422 370851181
VRL918 10550 315017672
VRL919 12459 373079805
VRL92 9309 221496928
VRL920 12419 371360929
VRL921 12428 371345506
VRL922 4986 148899678
VRL923 12242 369489762
VRL924 12317 367592887
VRL925 12174 365156432
VRL926 4053 115032319
VRL927 12716 367457814
VRL928 12532 367814176
VRL929 12762 364368269
VRL93 7822 220695101
VRL930 12516 362023021
VRL931 10181 295000835
VRL932 12261 364246493
VRL933 11983 358129926
VRL934 11992 358281709
VRL935 11970 357626813
VRL936 8265 246937176
VRL937 11985 358078812
VRL938 11989 358195256
VRL939 12156 363313606
VRL94 3557 86349708
VRL940 6489 193956712
VRL941 12177 363892164
VRL942 12137 362742033
VRL943 12131 362591479
VRL944 3657 109292202
VRL945 12028 359490869
VRL946 12169 363409112
VRL947 12161 363033450
VRL948 12058 360081778
VRL949 12080 360896706
VRL95 9355 218778672
VRL950 12014 358872295
VRL951 2730 81547016
VRL952 12189 364192061
VRL953 12163 363192710
VRL954 12165 363203605
VRL955 12155 362921616
VRL956 12158 362938293
VRL957 12161 363091473
VRL958 2684 80138103
VRL959 12166 363165165
VRL96 8379 221600861
VRL960 12166 363241275
VRL961 12170 363353847
VRL962 12156 362931637
VRL963 12160 363069167
VRL964 12172 363405368
VRL965 4051 120940847
VRL966 12163 363155849
VRL967 12161 363080282
VRL968 12159 363040526
VRL969 12167 363291692
VRL97 8460 222826395
VRL970 8121 242458743
VRL971 12179 363588312
VRL972 12288 366296193
VRL973 12230 364766866
VRL974 12230 364839180
VRL975 7809 232891999
VRL976 12517 372202470
VRL977 12314 367044713
VRL978 12278 366328806
VRL979 12245 365344345
VRL98 4327 101914676
VRL980 11804 352066227
VRL981 12261 365697368
VRL982 12496 371789496
VRL983 12719 377385868
VRL984 12715 377344810
VRL985 1217 36116332
VRL986 12713 377392716
VRL987 12718 377715037
VRL988 12722 377819305
VRL989 3915 116278053
VRL99 10055 222318712
VRL990 12719 377541904
VRL991 12718 377586495
VRL992 12684 377060528
VRL993 8611 255698002
VRL994 12709 377317035
VRL995 12707 377302448
VRL996 12704 377157720
VRL997 6978 207185151
VRL998 12712 377452061
VRL999 12713 377484768
VRT1 70127 272336515
VRT10 37396 74041240
VRT100 1 252032905
VRT101 1 217689105
VRT102 1 199443007
VRT103 1 198537509
VRT104 2 368166310
VRT105 2 330550494
VRT106 1 146904662
VRT107 3 319096504
VRT108 7 379783228
VRT109 11 374771935
VRT11 18698 27611025
VRT110 13 379441801
VRT111 3 70710155
VRT112 16 344076996
VRT113 10 385210617
VRT114 15 392781064
VRT115 22 370094349
VRT116 1 839681426
VRT117 1 825560060
VRT118 1 595904407
VRT119 1 486875112
VRT12 5986 380511905
VRT120 1 387033265
VRT121 1 371528181
VRT122 1 313513962
VRT123 1 277530821
VRT124 1 268302114
VRT125 3 319484498
VRT126 5 386368861
VRT127 7 393936069
VRT128 7 384166854
VRT129 1 46063367
VRT13 3363 217068541
VRT130 7 344525641
VRT131 6 384186008
VRT132 8 388949147
VRT133 332 334400544
VRT134 1 222115097
VRT135 3 377547369
VRT136 10 383496928
VRT137 33 389650655
VRT138 6 59236435
VRT139 1 772932187
VRT14 4685 4674270
VRT140 1 662004353
VRT141 1 535506559
VRT142 1 376147139
VRT143 1 364230008
VRT144 1 346409914
VRT145 1 311292523
VRT146 1 247732340
VRT147 1 228143320
VRT148 1 221182781
VRT149 2 321892640
VRT15 1171 26255719
VRT150 490 332426844
VRT151 12 378048109
VRT152 9 378909870
VRT153 6 345737823
VRT154 2 137693511
VRT155 7 385107928
VRT156 8 360581972
VRT157 10 364952837
VRT158 4 133261911
VRT159 8 359905961
VRT16 293 13983146
VRT160 5 370674748
VRT161 9 378247816
VRT162 6 166907986
VRT163 14 379842153
VRT164 15 375595384
VRT165 41 289507176
VRT166 11 366984719
VRT167 14 374291772
VRT168 10 185283047
VRT169 1 550518975
VRT17 37 392789976
VRT170 1 529596002
VRT171 1 413748038
VRT172 1 326378286
VRT173 1 272612222
VRT174 1 260396842
VRT175 1 197956435
VRT176 2 384149701
VRT177 2 288058306
VRT178 4 353983664
VRT179 461 371881983
VRT18 13 392458500
VRT180 2 310725315
VRT181 2 280326572
VRT182 3 371471404
VRT183 3 354148189
VRT184 3 303679844
VRT185 4 341249946
VRT186 598 371557989
VRT187 13 392880011
VRT188 13 164097178
VRT189 1 313568160
VRT19 12 379958897
VRT190 1 289498315
VRT191 1 277254249
VRT192 1 244324502
VRT193 1 233859027
VRT194 1 225974235
VRT195 1 211674833
VRT196 1 199962141
VRT197 2 390673241
VRT198 2 334991523
VRT199 2 324316137
VRT2 72833 271627158
VRT20 11 316368323
VRT200 2 292002398
VRT201 1 133841611
VRT202 3 336899598
VRT203 28 389500106
VRT204 6 332993899
VRT205 6 378599539
VRT206 1 47256133
VRT207 6 330076811
VRT208 7 362796652
VRT209 8 365387335
VRT21 13 385338369
VRT210 20 273534543
VRT211 9 378632578
VRT212 11 392575991
VRT213 205 341394663
VRT214 7 347210350
VRT215 7 370650631
VRT216 8 391548385
VRT217 6 385659507
VRT218 7 341110862
VRT219 1 55350661
VRT22 14 372163844
VRT220 8 387616857
VRT221 3 259325358
VRT222 5 392602723
VRT223 41 394037361
VRT224 3 148003845
VRT225 7 387415360
VRT226 7 365756282
VRT227 6 352657526
VRT228 5 346047628
VRT229 2 134650353
VRT23 14 352781625
VRT230 5 356250620
VRT231 6 374573269
VRT232 6 364137996
VRT233 7 343458516
VRT234 2 121348818
VRT235 7 358240592
VRT236 8 383435354
VRT237 8 365970383
VRT238 6 357597984
VRT239 7 355728138
VRT24 19 384683297
VRT240 8 362648569
VRT241 7 390172982
VRT242 8 391413434
VRT243 8 377681388
VRT244 1 42933508
VRT245 100 376541917
VRT246 20 391000381
VRT247 13 383659375
VRT248 58 386123281
VRT249 11 394338841
VRT25 16 379729070
VRT250 11 274288418
VRT251 1 843366180
VRT252 1 842558404
VRT253 1 707956555
VRT254 1 635713434
VRT255 1 567300182
VRT256 1 439630435
VRT257 1 236595445
VRT258 1 231667822
VRT259 2 382351630
VRT26 16 381718727
VRT260 2 103223822
VRT261 1 690654357
VRT262 1 541439571
VRT263 1 495417988
VRT264 1 481763206
VRT265 1 429350720
VRT266 1 224823088
VRT267 1 212589178
VRT268 2 374746477
VRT269 2 318111367
VRT27 2 51507477
VRT270 32 270969991
VRT271 2 352563619
VRT272 7 386835620
VRT273 4317 352826229
VRT274 19 370712563
VRT275 15986 152828107
VRT276 139086 132684752
VRT277 144321 126138212
VRT278 137848 133203156
VRT279 7177 8573810
VRT28 6 344600068
VRT280 128041 142650795
VRT281 130350 142477718
VRT282 127212 136589973
VRT283 49019 108085992
VRT284 3 351846198
VRT285 5 374381301
VRT286 16 387558511
VRT287 48 262478695
VRT288 14 376657571
VRT289 16 394062851
VRT29 7 384846875
VRT290 16 377073984
VRT291 8 278699154
VRT292 13 345916081
VRT293 3 386677656
VRT294 5 363840571
VRT295 25 336198071
VRT296 10 365551181
VRT297 392 383359217
VRT298 3 345650541
VRT299 4 347682430
VRT3 9032 335126292
VRT30 7 359521465
VRT300 8 375481157
VRT301 12 376742698
VRT302 33 366827136
VRT303 11 349043615
VRT304 35 386781479
VRT305 3 345588977
VRT306 4 349532575
VRT307 6 304738240
VRT308 7 374752607
VRT309 9 383055365
VRT31 6 265537261
VRT310 13 380263163
VRT311 17 345430885
VRT312 9 382470915
VRT313 10 392600820
VRT314 9 279911807
VRT315 9 254611438
VRT316 4 93451292
VRT317 92 46093787
VRT318 1 427870202
VRT319 1 378320336
VRT32 2 352172328
VRT320 1 361305601
VRT321 1 335235059
VRT322 1 330123935
VRT323 1 263823987
VRT324 2 310916606
VRT325 2 280963255
VRT326 2 253397968
VRT327 29 196709870
VRT328 14 353408674
VRT329 9 362327333
VRT33 4 299372801
VRT330 12 386562662
VRT331 37 393359699
VRT332 1 197209046
VRT333 4 354626559
VRT334 14 388834320
VRT335 19 380393320
VRT336 6 393746332
VRT337 3 88205163
VRT338 142 344732119
VRT339 5 347463485
VRT34 33 361630329
VRT340 7 380950384
VRT341 7 382163289
VRT342 1 41123832
VRT343 1534 370418439
VRT344 13 372631033
VRT345 41 382643657
VRT346 14 376221586
VRT347 27 384724785
VRT348 24 309028163
VRT349 1 359753992
VRT35 2 87752637
VRT350 1 294454259
VRT351 2 339959923
VRT352 4 389503140
VRT353 17 386338679
VRT354 15 391956294
VRT355 9 391549346
VRT356 8 381532502
VRT357 10 359729387
VRT358 16 366027269
VRT359 14 376088571
VRT36 1 317477549
VRT360 7 235869622
VRT361 2 242903655
VRT362 1 103130777
VRT363 2 195276619
VRT364 3 251633161
VRT365 5 300573695
VRT366 66 301934620
VRT367 25 392090725
VRT368 2 90346900
VRT369 10 381757438
VRT37 1 272440768
VRT370 13 384001666
VRT371 18 378998104
VRT372 14 354514736
VRT373 15 389607510
VRT374 7 359846472
VRT375 10 392276936
VRT376 11 351492602
VRT377 12 385397876
VRT378 11 360161366
VRT379 6 387856588
VRT38 2 394160013
VRT380 6 342298758
VRT381 7 364180089
VRT382 6 278597912
VRT383 4 383566318
VRT384 4 341682881
VRT385 5 369366758
VRT386 1 168556870
VRT387 4 366711607
VRT388 12 382161691
VRT389 284 370923374
VRT39 2 283573173
VRT390 16 348486879
VRT391 8 306781019
VRT392 16 388050719
VRT393 11 367388364
VRT394 14 365878669
VRT395 12 375095837
VRT396 1 25932624
VRT397 24 353612648
VRT398 6 369805903
VRT399 7 384607923
VRT4 3 141387178
VRT40 7 391094812
VRT400 8 368212165
VRT401 5 378213586
VRT402 5 365493039
VRT403 33 331537940
VRT404 2 361339847
VRT405 5 387184689
VRT406 27 349981705
VRT407 2 365371943
VRT408 3 264326299
VRT409 27 376036092
VRT41 15 377074715
VRT410 12 388111625
VRT411 15 355427980
VRT412 9 359004013
VRT413 14 370674190
VRT414 6 357293315
VRT415 9 392750267
VRT416 19 345301356
VRT417 2 270081366
VRT418 3 337747199
VRT419 4 372760969
VRT42 16 378051631
VRT420 6 374441870
VRT421 2 91343234
VRT422 12 365458181
VRT423 14 381904327
VRT424 10 379659381
VRT425 12 335882457
VRT426 9 338107238
VRT427 11 341554810
VRT428 6 306672347
VRT429 3 364841512
VRT43 16 393985227
VRT430 1 78184682
VRT431 13 391321309
VRT432 29 394238386
VRT433 11 392187451
VRT434 12 390891610
VRT435 4 124618305
VRT436 13 374791117
VRT437 7 346762788
VRT438 3 331274494
VRT439 5 372585365
VRT44 3 86805314
VRT440 14 232250556
VRT441 2 330011643
VRT442 3 358143180
VRT443 11 388706206
VRT444 24 346842850
VRT445 6 345978928
VRT446 7 376870570
VRT447 9 387109889
VRT448 11 379427132
VRT449 15 388456477
VRT45 14 389494801
VRT450 5 157396317
VRT451 14 377957244
VRT452 8 345961660
VRT453 6 347102316
VRT454 7 364305083
VRT455 11 385521663
VRT456 3 81529282
VRT457 19 381211211
VRT458 10 368005998
VRT459 14 324630407
VRT46 9 384839466
VRT460 7 384040912
VRT461 7 235089840
VRT462 9 338687749
VRT463 3 346419818
VRT464 4 380278921
VRT465 6 383580844
VRT466 7 343415827
VRT467 4 389369168
VRT468 11 380910127
VRT469 7 98500808
VRT47 6 336995308
VRT470 19 254956808
VRT471 2 291755981
VRT472 3 360820401
VRT473 4 344804531
VRT474 6 391793029
VRT475 8 391276700
VRT476 10 368423877
VRT477 6 157808144
VRT478 19 379169371
VRT479 16 364202069
VRT48 7 350849012
VRT480 12 386705760
VRT481 13 306516285
VRT482 4 349398949
VRT483 2 133605418
VRT484 6 347628123
VRT485 9 341764128
VRT486 6 365068972
VRT487 6 342787609
VRT488 6 308617737
VRT489 10 384491294
VRT49 5 366382703
VRT490 14 389301294
VRT491 11 368401372
VRT492 10 374526855
VRT493 7 233168748
VRT494 12 387903636
VRT495 12 273005563
VRT496 3 388044281
VRT497 6 366621651
VRT498 296 393199124
VRT499 2 80871223
VRT5 8 354279535
VRT50 29 124536891
VRT500 11 373748625
VRT501 14 366822435
VRT502 11 365008097
VRT503 10 274733604
VRT504 20 383991608
VRT505 18 374257048
VRT506 11 380849608
VRT507 13 372589174
VRT508 16 380034294
VRT509 3 272249881
VRT51 147 10842596
VRT510 1 252427829
VRT511 1 232456983
VRT512 1 205008019
VRT513 2 392288911
VRT514 2 351830105
VRT515 2 288333877
VRT516 3 333388282
VRT517 1 80635905
VRT518 5 365305650
VRT519 6 369739140
VRT52 586 15797052
VRT520 10 283558167
VRT521 1 218912229
VRT522 3 384030580
VRT523 7 389337170
VRT524 27 323834034
VRT525 5 384750338
VRT526 3 211675779
VRT527 5 331936094
VRT528 6 376936920
VRT529 8 379921315
VRT53 2343 67436863
VRT530 7 351187556
VRT531 8 356255842
VRT532 2 81521057
VRT533 6 356448109
VRT534 2 300042709
VRT535 4 343155882
VRT536 27 372183258
VRT537 2 82892496
VRT538 11 391249070
VRT539 14 393981192
VRT54 19198 357652178
VRT540 12 392610122
VRT541 11 247118506
VRT542 2 362356944
VRT543 1 119285422
VRT544 8 389337057
VRT545 29 266592469
VRT546 2 386396328
VRT547 3 309996050
VRT548 8 384942504
VRT549 24 351207841
VRT55 54117 304769938
VRT550 9 367245368
VRT551 10 316384480
VRT552 1 323290686
VRT553 1 233753858
VRT554 1 214419092
VRT555 1 209264451
VRT556 1 208108668
VRT557 2 373417761
VRT558 2 309104008
VRT559 2 271054822
VRT56 158586 137240898
VRT560 2 260221955
VRT561 3 342061807
VRT562 5 386286873
VRT563 4 369183200
VRT564 6 363973728
VRT565 1 34755123
VRT566 10 261792696
VRT567 2 366392779
VRT568 5 391744418
VRT569 35 388463791
VRT57 18257 13430736
VRT570 4 271170584
VRT571 8 364917051
VRT572 10 370973542
VRT573 12 388922986
VRT574 12 380991864
VRT575 26748 124910215
VRT58 117663 200715195
VRT59 84324 68322007
VRT6 11 387350249
VRT60 156210 129529828
VRT61 40549 26960978
VRT62 185395 123424073
VRT63 149940 106568691
VRT64 168276 113417753
VRT65 8563 7336686
VRT66 133023 105741590
VRT67 156317 117973785
VRT68 142306 87473811
VRT69 188485 120062689
VRT7 11 393947221
VRT70 103272 61402986
VRT71 157458 119340880
VRT72 160403 124687386
VRT73 8144 373921756
VRT74 326 389273252
VRT75 1595 387372006
VRT76 93755 270827182
VRT77 145106 21008965
VRT78 75789 25336814
VRT79 13375 365641119
VRT8 30744 333424138
VRT80 20 379347618
VRT81 269 392772876
VRT82 3056 391160250
VRT83 3483 231235844
VRT84 6925 378855996
VRT85 16 388667304
VRT86 16 378559418
VRT87 12 379509384
VRT88 7 285874095
VRT89 12 385137967
VRT9 74952 70629379
VRT90 18 367776429
VRT91 16 386329687
VRT92 229 277860126
VRT93 17 367327734
VRT94 15 385834222
VRT95 7 149460915
VRT96 1 356776219
VRT97 1 350268637
VRT98 1 316334699
VRT99 1 337490635
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 260.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
8798641 261765900426 Severe acute respiratory syndrome coronavirus 2
1943737 241123815056 Triticum aestivum
111961 205666444201 Hordeum vulgare
1347585 126087260773 Hordeum vulgare subsp. vulgare
520 106587373982 Hordeum bulbosum
164 93011095388 Viscum album
29875 92980158068 Hordeum vulgare subsp. spontaneum
10047949 43636846379 Mus musculus
27805521 34339908455 Homo sapiens
174296 23455595392 Escherichia coli
29719 21127974414 Avena sativa
2640644 19850191551 Arabidopsis thaliana
2243693 16210139196 Bos taurus
33120 15955010198 Klebsiella pneumoniae
1732291 13758449255 Danio rerio
195 11554711366 Sambucus nigra
28766 11286173222 Vicia faba
14811 10342955286 Triticum monococcum
23130 9981582961 Triticum turgidum subsp. durum
704 9808543625 Heterocephalus glaber
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivery for Feb 2024
260 Apr 2024 3213818003787 250803006
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivery for Feb 2024
260 Apr 2024 27225116587937 3333621823
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivery for Feb 2024
260 Apr 2024 689648317082 741066498
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivery for Feb 2024
260 Apr 2024 53492243256 135115766
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
April 15 2024
NCBI-GenBank Flat File Release 260.0
Bacterial Sequences (Part 1)
102016 loci, 184379131 bases, from 102016 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
Volume 52, Issue D1, January 2024, pp. D134-D137.
PMID: 37889039
PMCID: PMC10767886
DOI: 10.1093/nar/gkad903
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
