NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1377038043|ref|NP_001349317|]
View 

telomerase reverse transcriptase isoform 3 [Mus musculus]

Protein Classification

telomerase reverse transcriptase( domain architecture ID 10320765)

telomerase reverse transcriptase is the catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme

EC:  2.7.7.49
Gene Ontology:  GO:0003721|GO:0003677
PubMed:  32770221|9110970

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
 277-391 3.01e-27

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


:

Pssm-ID: 238826  Cd Length: 119  Bit Score: 106.19  E-value: 3.01e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1377038043 277 DRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLF---AEVQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHG-VPEYGCM 352
Cdd:cd01648    11 PQYYRQKVGIPQGSPLSSLLCSLYYADLENKYLsflDVIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTF 90

                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 1377038043 353 INLQKTVVNFPVEpgtlggaapyQLPAHCLFPWCGLLLD 391
Cdd:cd01648    91 VNFDKTQINFSFA----------QLDSSDLIPWCGLLIN 119
Telomerase_RBD super family cl13446
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are ...
 1-46 8.48e-17

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


The actual alignment was detected with superfamily member smart00975:

Pssm-ID: 472503  Cd Length: 136  Bit Score: 77.30  E-value: 8.48e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 1377038043    1 MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLE 46
Cdd:smart00975  91 FDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
 
Name Accession Description Interval E-value
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
 277-391 3.01e-27

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


Pssm-ID: 238826  Cd Length: 119  Bit Score: 106.19  E-value: 3.01e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1377038043 277 DRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLF---AEVQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHG-VPEYGCM 352
Cdd:cd01648    11 PQYYRQKVGIPQGSPLSSLLCSLYYADLENKYLsflDVIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTF 90

                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 1377038043 353 INLQKTVVNFPVEpgtlggaapyQLPAHCLFPWCGLLLD 391
Cdd:cd01648    91 VNFDKTQINFSFA----------QLDSSDLIPWCGLLIN 119
Telomerase_RBD smart00975
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
 1-46 8.48e-17

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 214948  Cd Length: 136  Bit Score: 77.30  E-value: 8.48e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 1377038043    1 MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLE 46
Cdd:smart00975  91 FDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
Telomerase_RBD pfam12009
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are ...
 1-44 1.74e-16

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 463428  Cd Length: 133  Bit Score: 76.00  E-value: 1.74e-16
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 1377038043   1 MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQH 44
Cdd:pfam12009  90 FDSLLIPLIRSFFYVTESSTHRNRLFYFRHDVWRKLSEPFLRKL 133
RVT_1 pfam00078
Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually ...
 306-370 7.72e-03

Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses.


Pssm-ID: 395031 [Multi-domain]  Cd Length: 189  Bit Score: 38.05  E-value: 7.72e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1377038043 306 NKLFAEV-QRDGL-LLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNFPVEPGT-LG 370
Cdd:pfam00078 119 NELLRPLrKRAGLtLVRYADDILIFSKSEEEHQEALEEVLEWLKESGLKINPEKTQFFLKSKEVKyLG 186
 
Name Accession Description Interval E-value
TERT cd01648
TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that ...
 277-391 3.01e-27

TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at the chromosome ends protects against the erosion of gene-encoding DNA. Telomerase is not normally expressed in somatic cells. It has been suggested that exogenous TERT may extend the lifespan of, or even immortalize, the cell. However, recent studies have shown that telomerase activity can be induced by a number of oncogenes. Conversely, the oncogene c-myc can be activated in human TERT immortalized cells. Sequence comparisons place the telomerase proteins in the RT family but reveal hallmarks that distinguish them from retroviral and retrotransposon relatives.


Pssm-ID: 238826  Cd Length: 119  Bit Score: 106.19  E-value: 3.01e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1377038043 277 DRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLF---AEVQRDGLLLRFVDDFLLVTPHLDQAKTFLSTLVHG-VPEYGCM 352
Cdd:cd01648    11 PQYYRQKVGIPQGSPLSSLLCSLYYADLENKYLsflDVIDKDSLLLRLVDDFLLITTSLDKAIKFLNLLLRGfINQYKTF 90

                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 1377038043 353 INLQKTVVNFPVEpgtlggaapyQLPAHCLFPWCGLLLD 391
Cdd:cd01648    91 VNFDKTQINFSFA----------QLDSSDLIPWCGLLIN 119
Telomerase_RBD smart00975
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are ...
 1-46 8.48e-17

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organisms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 214948  Cd Length: 136  Bit Score: 77.30  E-value: 8.48e-17
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 1377038043    1 MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLE 46
Cdd:smart00975  91 FDCLVPPLLRSFFYVTESSGQKNKLLYFRHDVWKKLTRPALRRYLE 136
Telomerase_RBD pfam12009
Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are ...
 1-44 1.74e-16

Telomerase ribonucleoprotein complex - RNA binding domain; Telomeres in most organizms are comprised of tandem simple sequence repeats. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition. One major influence on telomere length is the enzyme telomerase. It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets. How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA.


Pssm-ID: 463428  Cd Length: 133  Bit Score: 76.00  E-value: 1.74e-16
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 1377038043   1 MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQH 44
Cdd:pfam12009  90 FDSLLIPLIRSFFYVTESSTHRNRLFYFRHDVWRKLSEPFLRKL 133
RT_Bac_retron_I cd01646
RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The ...
 320-358 4.34e-03

RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The polymerase reaction of this enzyme leads to the production of a unique RNA-DNA complex called msDNA (multicopy single-stranded (ss)DNA) in which a small ssDNA branches out from a small ssRNA molecule via a 2'-5'phosphodiester linkage. Bacterial retron RTs produce cDNA corresponding to only a small portion of the retron genome.


Pssm-ID: 238824 [Multi-domain]  Cd Length: 158  Bit Score: 38.08  E-value: 4.34e-03
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1377038043 320 RFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKT 358
Cdd:cd01646    87 RYVDDIRIFADSKEEAEEILEELKEFLAELGLSLNLSKT 125
RVT_1 pfam00078
Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually ...
 306-370 7.72e-03

Reverse transcriptase (RNA-dependent DNA polymerase); A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses.


Pssm-ID: 395031 [Multi-domain]  Cd Length: 189  Bit Score: 38.05  E-value: 7.72e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1377038043 306 NKLFAEV-QRDGL-LLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNFPVEPGT-LG 370
Cdd:pfam00078 119 NELLRPLrKRAGLtLVRYADDILIFSKSEEEHQEALEEVLEWLKESGLKINPEKTQFFLKSKEVKyLG 186
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH