6DG5


Conserved Protein Domain Family
IL2RB_N1
?
pfam18707: IL2RB_N1 (this model, PSSM-Id:376131 is obsolete and has been replaced by 465844)
Click on image for an interactive view with Cn3D
Interleukin-2 receptor subunit beta N-terminal domain 1
IL-2Rbeta is a member of the class I cytokine receptor superfamily. It carries a cytokine-binding homology region, which is divided in two fibronectin type-III (FN-III) domains termed D1 and D2. Each domain contains seven beta-strands that form a sandwich of two antiparallel beta-sheets. The N-terminal D1 domain of IL-2Rbeta includes two highly conserved disulfide bridges. This entry describes D1 of the N-terminal region of IL2Rbeta.
Links
?
Statistics
?
PSSM-Id: 376131
Aligned: 26 rows
Threshold Bit Score: 58.5251
Created: 21-Apr-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
6DG5_B         6 SHLECFYNSRANVSCMWSHE--EALNVTTCHVHAKSNLrh-------------wnKTC---ELt-Lv---RQASWACNLI 63  house mouse
9_pfamImport   1 SSLTCWYDSRAALLCDWNSG--RDLADAPCNLTISSIY-----------------KFC---DSiiV----ELCSISSRVL 54 
Q6UAP4        29 PGLLCVNDYISTLSCAWRGA--APARYASCSITGKMNIwir------------nhRSC---RLe-Qq---ENSPPGCSFA 87  spotted green p...
XP_007654791  35 SSLTCFYDSRANLSCTWVPA--ELPELRSCSLEARTNYrd-------------qtTVC---NLl-Pm---GSKSFSCNLI 92  platypus
XP_007578047  30 kSLTCYNDYNDVINCVWNSShvQNLTDDVCTVHAKHPKsy-------------ykASC---ELk-PidasNPALKNCSMK 92  Amazon molly
XP_019345232  30 SELACFYDSGVTLFCTWIPD--GTLTEVPCQLHAELQDps-------------pdHWCckgKCk-Lc---GVGPRRCDLA 90  American alligator
XP_015215089  39 PSLTCTNDYINNISCEWRSS--EAYSNTSCRVHLVRRRkq---------------fQC---DLi-As--dEPTVCSCSIQ 95  spotted gar
NP_001121739  27 GDLTCVNDYMTNISCVWWNY--SNFSNQQCELEVNCKIskmvlsvscngslisslhykpgrhiktqppdkpvvngsnvsw 104 zebrafish
KQK76490      51 SSLTCWYDSRAALFXDWTPG--KDLVEAPCQLEILYNLpfydkfs---flprkirXHC---EL--PkaehMTGLRGCIKT 120 blue-fronted am...
XP_005039842  30 SSLTCWYDSRAALFCDWDPG--RDLAEAPCQLEILSEKgfcdsllelhpspekrkKHC---KL--PkaehMTGLRRCIKT 102 collared flycat...

6DG5_B        64 LgsfpESQSLTSVDLL-DINVVCweekgwRRVKTCD 98  house mouse
9_pfamImport  55 LisrvKMQCFTSADSL-NMTVDCqig-enRSIPAQL 88 
Q6UAP4        88 F----ENQTFNAYTSIpSIRMEC------DGAVVEE 113 spotted green pufferfish
XP_007654791  93 LdpdvHAQALTVVEDV-SLKVTCen---wKGNVIEK 124 platypus
XP_007578047  93 Fs---RTFTFQSFHNL-TLDVSCmpskhrEVIYYKP 124 Amazon molly
XP_019345232  91 FnnktNIPALTYSDRL-TLTVSCqtgenwTMVKQEK 125 American alligator
XP_015215089  96 VtknaNTQSFTSVDEC-DIEVRCgdskepA-AKIKD 129 spotted gar
NP_001121739 105 skgsnfpksikkhefqlqfkdahtswemakpgqlsq 140 zebrafish
KQK76490     121 FsknnNTQYFTVADRL-TISVHCqigenrSIPVQIE 155 blue-fronted amazon
XP_005039842 103 FhqnvNNQCFTISDRL-SFSVHChtgekkNKIPVQI 137 collared flycatcher
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap