Conserved Protein Domain Family
Dynein_IC2
?
pfam11540: Dynein_IC2 (this model, PSSM-Id:371592 is obsolete and has been replaced by 463291)
Cytoplasmic dynein 1 intermediate chain 2
Intermediate chain IC 2 forms part of the complex cytoplasmic dynein 1 along with a heavy chain (HC), two light intermediate chains (LICs) and three light chains (LCs). The complex is responsible for hydrolysing ATP to generate force toward the minus end of microtubules. IC binds to the HC via the N terminal binding domain on the HC and ICs contain binding sites for the LCs. The ICs are responsible for binding to kinetochores and the Golgi apparatus through an interaction with the p150Glued subunit of dynactin which is another complex.
Links
?
Statistics
?
PSSM-Id: 371592
Aligned: 23 rows
Threshold Bit Score: 40.6266
Created: 2-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
EGG21460     101 KPTLSIQNlVIEFDIPPREIPTYTKATQTP 130 Cavenderia fasciculata
7_pfamImport   3 MPTLSVIS-VQATDIPPKEQISYNKQTQTT 31 
EFX81426      50 KPQLTKVS-VQATDIPPKETVTYAKQTQTV 78  common water flea
EDX18442     107 PLNLSVYN-VQATNIPPKETLVYTKQTQTT 135 Drosophila simulans
EEZ97487     107 APNLSVVQ-VQSTNIPPKETVLYTKQTQTT 135 red flour beetle
XP_012550157 108 PQELQVVF-VQSTDIPPKETVIYTKQTQTT 136 domestic silkworm
ETN64513     103 PVNLCLVS-VQATNIPPKETVSYSKQTQTN 131 Anopheles darlingi
P54703        98 RPTLTIQSlVIEHDFPPKEIPMYSKGTQTM 127 Dictyostelium discoideum
XP_018655040  99 RKRLGFSQ-INEINVPPKENISYSKITQTF 127 Schistosoma mansoni
XP_015794556 103 PISLALVN-VNEINIPPKESVTYNKQTQTT 131 two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap