NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS27538.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27538.1 Reviewed, update pending Mus musculus 15 Ly6e 23 108 98 CCDS HistoryNCBI Gene:17069Re-query CCDS DB by CCDS ID:27538.1Re-query CCDS DB by GeneID:17069See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 27538.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000051698.13 ENSMUSP00000056703.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051698.13Link to Ensembl Protein Viewer:ENSMUSP00000056703.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000051698Re-query CCDS DB by Protein ID:ENSMUSP00000056703
Original member Current member EBI ENSMUST00000169343.7 ENSMUSP00000132081.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169343.7Link to Ensembl Protein Viewer:ENSMUSP00000132081.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000169343Re-query CCDS DB by Protein ID:ENSMUSP00000132081
Original member Current member EBI ENSMUST00000187606.6 ENSMUSP00000139471.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000187606.6Link to Ensembl Protein Viewer:ENSMUSP00000139471.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000187606Re-query CCDS DB by Protein ID:ENSMUSP00000139471
Original member Current member EBI ENSMUST00000191436.6 ENSMUSP00000139549.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000191436.6Link to Ensembl Protein Viewer:ENSMUSP00000139549.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000191436Re-query CCDS DB by Protein ID:ENSMUSP00000139549
Original member Current member EBI ENSMUST00000188866.6 ENSMUSP00000140145.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000188866.6Link to Ensembl Protein Viewer:ENSMUSP00000140145.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000188866Re-query CCDS DB by Protein ID:ENSMUSP00000140145
Original member Current member EBI ENSMUST00000187284.6 ENSMUSP00000140553.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000187284.6Link to Ensembl Protein Viewer:ENSMUSP00000140553.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000187284Re-query CCDS DB by Protein ID:ENSMUSP00000140553
Original member Current member EBI ENSMUST00000188042.1 ENSMUSP00000141059.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000188042.1Link to Ensembl Protein Viewer:ENSMUSP00000141059.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000188042Re-query CCDS DB by Protein ID:ENSMUSP00000141059
Original member Current member EBI ENSMUST00000185861.6 ENSMUSP00000141145.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000185861.6Link to Ensembl Protein Viewer:ENSMUSP00000141145.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000185861Re-query CCDS DB by Protein ID:ENSMUSP00000141145
Original member NCBI NM_001164036.1 NP_001157508.1 Updated not alive Link to Nucleotide Sequence:NM_001164036.1Link to Protein Sequence:NP_001157508.1Re-query CCDS DB by Nucleotide ID:NM_001164036Re-query CCDS DB by Protein ID:NP_001157508
Current member NCBI NM_001164036.2 NP_001157508.2 Pending alive Link to Nucleotide Sequence:NM_001164036.2Link to Protein Sequence:NP_001157508.2Re-query CCDS DB by Nucleotide ID:NM_001164036Re-query CCDS DB by Protein ID:NP_001157508Link to BLAST:NP_001157508.2
Original member NCBI NM_001164037.1 NP_001157509.1 Updated not alive Link to Nucleotide Sequence:NM_001164037.1Link to Protein Sequence:NP_001157509.1Re-query CCDS DB by Nucleotide ID:NM_001164037Re-query CCDS DB by Protein ID:NP_001157509
Current member NCBI NM_001164037.2 NP_001157509.2 Pending alive Link to Nucleotide Sequence:NM_001164037.2Link to Protein Sequence:NP_001157509.2Re-query CCDS DB by Nucleotide ID:NM_001164037Re-query CCDS DB by Protein ID:NP_001157509Link to BLAST:NP_001157509.2
Original member NCBI NM_001164038.1 NP_001157510.1 Updated not alive Link to Nucleotide Sequence:NM_001164038.1Link to Protein Sequence:NP_001157510.1Re-query CCDS DB by Nucleotide ID:NM_001164038Re-query CCDS DB by Protein ID:NP_001157510
Current member NCBI NM_001164038.2 NP_001157510.2 Pending alive Link to Nucleotide Sequence:NM_001164038.2Link to Protein Sequence:NP_001157510.2Re-query CCDS DB by Nucleotide ID:NM_001164038Re-query CCDS DB by Protein ID:NP_001157510Link to BLAST:NP_001157510.2
Original member NCBI NM_001164039.1 NP_001157511.1 Updated not alive Link to Nucleotide Sequence:NM_001164039.1Link to Protein Sequence:NP_001157511.1Re-query CCDS DB by Nucleotide ID:NM_001164039Re-query CCDS DB by Protein ID:NP_001157511
Current member NCBI NM_001164039.2 NP_001157511.2 Pending alive Link to Nucleotide Sequence:NM_001164039.2Link to Protein Sequence:NP_001157511.2Re-query CCDS DB by Nucleotide ID:NM_001164039Re-query CCDS DB by Protein ID:NP_001157511Link to BLAST:NP_001157511.2
Original member NCBI NM_001164040.1 NP_001157512.1 Updated not alive Link to Nucleotide Sequence:NM_001164040.1Link to Protein Sequence:NP_001157512.1Re-query CCDS DB by Nucleotide ID:NM_001164040Re-query CCDS DB by Protein ID:NP_001157512
Current member NCBI NM_001164040.2 NP_001157512.2 Pending alive Link to Nucleotide Sequence:NM_001164040.2Link to Protein Sequence:NP_001157512.2Re-query CCDS DB by Nucleotide ID:NM_001164040Re-query CCDS DB by Protein ID:NP_001157512Link to BLAST:NP_001157512.2
Current member NCBI NM_001374138.1 NP_001361067.1 Candidate alive Link to Nucleotide Sequence:NM_001374138.1Link to Protein Sequence:NP_001361067.1Re-query CCDS DB by Nucleotide ID:NM_001374138Re-query CCDS DB by Protein ID:NP_001361067Link to BLAST:NP_001361067.1
Original member NCBI NM_008529.3 NP_032555.1 Updated not alive Link to Nucleotide Sequence:NM_008529.3Link to Protein Sequence:NP_032555.1Re-query CCDS DB by Nucleotide ID:NM_008529Re-query CCDS DB by Protein ID:NP_032555
Current member NCBI NM_008529.4 NP_032555.2 Pending alive Link to Nucleotide Sequence:NM_008529.4Link to Protein Sequence:NP_032555.2Re-query CCDS DB by Nucleotide ID:NM_008529Re-query CCDS DB by Protein ID:NP_032555Link to BLAST:NP_032555.2

Chromosomal Locations for CCDS 27538.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 74957808 74957877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74958269 74958388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 74958493 74958713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (411 nt):
ATGTCTGCCACTTCCAACATGAGAGTCTTCCTGCCTGTGCTGTTGGCAGCCCTTCTGGGCATGGAGCAAG
TT
CATTCCCTGATGTGCTTCTCATGTACCGATCAGAAGAACAATATAAACTGCCTGTGGCCAGTTTCATG
C
CAGGAGAAAGACCATTACTGTATCACGTTATCTGCCGCTGCGGGCTTTGGGAATGTCAACCTTGGCTAC
ACC
CTGAACAAGGGCTGCTCCCCGATCTGCCCCAGTGAAAATGTCAATCTCAATCTCGGTGTGGCGTCCG
TG
AACAGCTACTGCTGCCAAAGCTCCTTCTGCAACTTCAGCGCAGCTGGCCTCGGACTTCGTGCCAGTAT
C
CCACTACTGGGCCTTGGACTCCTGCTTAGCTTGTTGGCTCTGCTGCAGCTGAGCCCCTGA


Translation (136 aa):
MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGY
T
LNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser