NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7886.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7886.1 Public Homo sapiens 11 CD59 24 110 108 CCDS HistoryNCBI Gene:966Re-query CCDS DB by CCDS ID:7886.1See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 7886.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000351554.8 ENSP00000340210.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000351554.8Link to Ensembl Protein Viewer:ENSP00000340210.3Re-query CCDS DB by Nucleotide ID:ENST00000351554Re-query CCDS DB by Protein ID:ENSP00000340210
Original member Current member EBI ENST00000395850.9 ENSP00000379191.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395850.9Link to Ensembl Protein Viewer:ENSP00000379191.3Re-query CCDS DB by Nucleotide ID:ENST00000395850Re-query CCDS DB by Protein ID:ENSP00000379191
Original member Current member EBI ENST00000445143.6 ENSP00000403511.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000445143.6Link to Ensembl Protein Viewer:ENSP00000403511.2Re-query CCDS DB by Nucleotide ID:ENST00000445143Re-query CCDS DB by Protein ID:ENSP00000403511
Original member Current member EBI ENST00000415002.7 ENSP00000404822.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000415002.7Link to Ensembl Protein Viewer:ENSP00000404822.2Re-query CCDS DB by Nucleotide ID:ENST00000415002Re-query CCDS DB by Protein ID:ENSP00000404822
Original member Current member EBI ENST00000437761.6 ENSP00000410182.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000437761.6Link to Ensembl Protein Viewer:ENSP00000410182.2Re-query CCDS DB by Nucleotide ID:ENST00000437761Re-query CCDS DB by Protein ID:ENSP00000410182
Original member Current member EBI ENST00000527577.5 ENSP00000432942.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000527577.5Link to Ensembl Protein Viewer:ENSP00000432942.1Re-query CCDS DB by Nucleotide ID:ENST00000527577Re-query CCDS DB by Protein ID:ENSP00000432942
Original member Current member EBI ENST00000525763.5 ENSP00000435179.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000525763.5Link to Ensembl Protein Viewer:ENSP00000435179.1Re-query CCDS DB by Nucleotide ID:ENST00000525763Re-query CCDS DB by Protein ID:ENSP00000435179
Original member Current member EBI ENST00000642928.2 ENSP00000494884.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000642928.2Link to Ensembl Protein Viewer:ENSP00000494884.1Re-query CCDS DB by Nucleotide ID:ENST00000642928Re-query CCDS DB by Protein ID:ENSP00000494884
Original member Current member EBI ENST00000652678.1 ENSP00000498448.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000652678.1Link to Ensembl Protein Viewer:ENSP00000498448.1Re-query CCDS DB by Nucleotide ID:ENST00000652678Re-query CCDS DB by Protein ID:ENSP00000498448
Original member Current member EBI ENST00000651785.1 ENSP00000498879.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000651785.1Link to Ensembl Protein Viewer:ENSP00000498879.1Re-query CCDS DB by Nucleotide ID:ENST00000651785Re-query CCDS DB by Protein ID:ENSP00000498879
Original member Current member NCBI NM_000611.6 NP_000602.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_000611.6Link to Protein Sequence:NP_000602.1Re-query CCDS DB by Nucleotide ID:NM_000611Re-query CCDS DB by Protein ID:NP_000602Link to BLAST:NP_000602.1
Original member Current member NCBI NM_001127223.1 NP_001120695.1 Accepted alive Link to Nucleotide Sequence:NM_001127223.1Link to Protein Sequence:NP_001120695.1Re-query CCDS DB by Nucleotide ID:NM_001127223Re-query CCDS DB by Protein ID:NP_001120695Link to BLAST:NP_001120695.1
Original member Current member NCBI NM_001127225.2 NP_001120697.1 Accepted alive Link to Nucleotide Sequence:NM_001127225.2Link to Protein Sequence:NP_001120697.1Re-query CCDS DB by Nucleotide ID:NM_001127225Re-query CCDS DB by Protein ID:NP_001120697Link to BLAST:NP_001120697.1
Original member Current member NCBI NM_001127226.2 NP_001120698.1 Accepted alive Link to Nucleotide Sequence:NM_001127226.2Link to Protein Sequence:NP_001120698.1Re-query CCDS DB by Nucleotide ID:NM_001127226Re-query CCDS DB by Protein ID:NP_001120698Link to BLAST:NP_001120698.1
Original member Current member NCBI NM_001127227.2 NP_001120699.1 Accepted alive Link to Nucleotide Sequence:NM_001127227.2Link to Protein Sequence:NP_001120699.1Re-query CCDS DB by Nucleotide ID:NM_001127227Re-query CCDS DB by Protein ID:NP_001120699Link to BLAST:NP_001120699.1
Original member Current member NCBI NM_203329.3 NP_976074.1 Accepted alive Link to Nucleotide Sequence:NM_203329.3Link to Protein Sequence:NP_976074.1Re-query CCDS DB by Nucleotide ID:NM_203329Re-query CCDS DB by Protein ID:NP_976074Link to BLAST:NP_976074.1
Original member Current member NCBI NM_203330.2 NP_976075.1 Accepted alive Link to Nucleotide Sequence:NM_203330.2Link to Protein Sequence:NP_976075.1Re-query CCDS DB by Nucleotide ID:NM_203330Re-query CCDS DB by Protein ID:NP_976075Link to BLAST:NP_976075.1
Original member Current member NCBI NM_203331.3 NP_976076.1 Accepted alive Link to Nucleotide Sequence:NM_203331.3Link to Protein Sequence:NP_976076.1Re-query CCDS DB by Nucleotide ID:NM_203331Re-query CCDS DB by Protein ID:NP_976076Link to BLAST:NP_976076.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000602.1 128 P13987-1 128 100% 0 0
NP_001120695.1 128 P13987-1 128 100% 0 0
NP_001120697.1 128 P13987-1 128 100% 0 0
NP_001120698.1 128 P13987-1 128 100% 0 0
NP_001120699.1 128 P13987-1 128 100% 0 0
NP_976074.1 128 P13987-1 128 100% 0 0
NP_976075.1 128 P13987-1 128 100% 0 0
NP_976076.1 128 P13987-1 128 100% 0 0

Chromosomal Locations for CCDS 7886.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 33710126 33710343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 33717370 33717471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 33722379 33722445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (387 nt):
ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTTCTGCCATTCAGGTC
ATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACTGCAAAACAGCCGTCAATTGTTCATCTGA
TTTTGATGCGTGTCTCATTACCAAAGCTGGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGC
AATTTCAACGACGTCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCTGT
GTAACTTTAACGAACAGCTTGAAAATGGTGGGACATCCTTATCAGAGAAAACAGTTCTTCTGCTGGTGAC
TCCATTTCTGGCAGCAGCCTGGAGCCTTCATCCCTAA

Translation (128 aa):
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH