NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS21495.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21495.1 Public Mus musculus 7 Kcne3 23 108 98 CCDS HistoryNCBI Gene:57442Re-query CCDS DB by CCDS ID:21495.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21495.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000049333.12 ENSMUSP00000039353.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000049333.12Link to Ensembl Protein Viewer:ENSMUSP00000039353.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000049333Re-query CCDS DB by Protein ID:ENSMUSP00000039353
Original member Current member EBI ENSMUST00000170954.9 ENSMUSP00000130019.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170954.9Link to Ensembl Protein Viewer:ENSMUSP00000130019.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000170954Re-query CCDS DB by Protein ID:ENSMUSP00000130019
Original member Current member EBI ENSMUST00000179842.2 ENSMUSP00000136415.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179842.2Link to Ensembl Protein Viewer:ENSMUSP00000136415.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000179842Re-query CCDS DB by Protein ID:ENSMUSP00000136415
Original member Current member EBI ENSMUST00000178946.8 ENSMUSP00000136616.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178946.8Link to Ensembl Protein Viewer:ENSMUSP00000136616.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000178946Re-query CCDS DB by Protein ID:ENSMUSP00000136616
Original member Current member EBI ENSMUST00000207358.1 ENSMUSP00000146583.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000207358.1Link to Ensembl Protein Viewer:ENSMUSP00000146583.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000207358Re-query CCDS DB by Protein ID:ENSMUSP00000146583
Original member Current member EBI ENSMUST00000208260.1 ENSMUSP00000147047.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000208260.1Link to Ensembl Protein Viewer:ENSMUSP00000147047.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000208260Re-query CCDS DB by Protein ID:ENSMUSP00000147047
Original member Current member EBI ENSMUST00000207995.1 ENSMUSP00000147151.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000207995.1Link to Ensembl Protein Viewer:ENSMUSP00000147151.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000207995Re-query CCDS DB by Protein ID:ENSMUSP00000147151
Original member Current member NCBI NM_001190869.1 NP_001177798.1 Accepted alive Link to Nucleotide Sequence:NM_001190869.1Link to Protein Sequence:NP_001177798.1Re-query CCDS DB by Nucleotide ID:NM_001190869Re-query CCDS DB by Protein ID:NP_001177798Link to BLAST:NP_001177798.1
Original member Current member NCBI NM_001190870.1 NP_001177799.1 Accepted alive Link to Nucleotide Sequence:NM_001190870.1Link to Protein Sequence:NP_001177799.1Re-query CCDS DB by Nucleotide ID:NM_001190870Re-query CCDS DB by Protein ID:NP_001177799Link to BLAST:NP_001177799.1
Original member Current member NCBI NM_001190871.2 NP_001177800.1 Accepted alive Link to Nucleotide Sequence:NM_001190871.2Link to Protein Sequence:NP_001177800.1Re-query CCDS DB by Nucleotide ID:NM_001190871Re-query CCDS DB by Protein ID:NP_001177800Link to BLAST:NP_001177800.1
Original member Current member NCBI NM_001190950.1 NP_001177879.1 Accepted alive Link to Nucleotide Sequence:NM_001190950.1Link to Protein Sequence:NP_001177879.1Re-query CCDS DB by Nucleotide ID:NM_001190950Re-query CCDS DB by Protein ID:NP_001177879Link to BLAST:NP_001177879.1
Original member Current member NCBI NM_001360466.1 NP_001347395.1 Accepted alive Link to Nucleotide Sequence:NM_001360466.1Link to Protein Sequence:NP_001347395.1Re-query CCDS DB by Nucleotide ID:NM_001360466Re-query CCDS DB by Protein ID:NP_001347395Link to BLAST:NP_001347395.1
Original member Current member NCBI NM_001360467.1 NP_001347396.1 Accepted alive Link to Nucleotide Sequence:NM_001360467.1Link to Protein Sequence:NP_001347396.1Re-query CCDS DB by Nucleotide ID:NM_001360467Re-query CCDS DB by Protein ID:NP_001347396Link to BLAST:NP_001347396.1
Original member Current member NCBI NM_020574.5 NP_065599.1 Accepted alive Link to Nucleotide Sequence:NM_020574.5Link to Protein Sequence:NP_065599.1Re-query CCDS DB by Nucleotide ID:NM_020574Re-query CCDS DB by Protein ID:NP_065599Link to BLAST:NP_065599.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001177798.1 103 Q9WTW2 103 100% 0 0
NP_001177799.1 103 Q9WTW2 103 100% 0 0
NP_001177800.1 103 Q9WTW2 103 100% 0 0
NP_001177879.1 103 Q9WTW2 103 100% 0 0
NP_001347395.1 103 Q9WTW2 103 100% 0 0
NP_001347396.1 103 Q9WTW2 103 100% 0 0
NP_065599.1 103 Q9WTW2 103 100% 0 0

Chromosomal Locations for CCDS 21495.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 100184178 100184489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (312 nt):
ATGGAGACTTCCAACGGGACTGAGACCTGGTACATGAGCCTCCATGCTGTGCTGAAGGCTCTGAACACAA
CCCTTCACAGTCACTTGCTCTGCCGGCCTGGGCCAGGACCAGGGCCAGACAATCAAACTGAGGATCGTCG
GGCTAGCCTTCCTGGTCGTAATGACAACTCCTACATGTATATTCTCTTTGTCATGTTCCTATTTGCCGTC
ACTGTGGGCAGTCTCATCCTGGGATATACCCGTTCACGCAAAGTGGACAAACGTAGTGACCCCTATCATG
TGTACATCAAGAACCGTGTGTCTATGATCTGA

Translation (103 aa):
METSNGTETWYMSLHAVLKALNTTLHSHLLCRPGPGPGPDNQTEDRRASLPGRNDNSYMYILFVMFLFAV
TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH