NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3746.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3746.1 Public Homo sapiens 4 NDUFC1 24 110 108 CCDS HistoryNCBI Gene:4717Re-query CCDS DB by CCDS ID:3746.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3746.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000394223.2 ENSP00000377770.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000394223.2Link to Ensembl Protein Viewer:ENSP00000377770.1Re-query CCDS DB by Nucleotide ID:ENST00000394223Re-query CCDS DB by Protein ID:ENSP00000377770
Original member Current member EBI ENST00000394228.5 ENSP00000377775.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394228.5Link to Ensembl Protein Viewer:ENSP00000377775.1Re-query CCDS DB by Nucleotide ID:ENST00000394228Re-query CCDS DB by Protein ID:ENSP00000377775
Original member Current member EBI ENST00000505036.5 ENSP00000421195.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000505036.5Link to Ensembl Protein Viewer:ENSP00000421195.1Re-query CCDS DB by Nucleotide ID:ENST00000505036Re-query CCDS DB by Protein ID:ENSP00000421195
Original member Current member EBI ENST00000503997.5 ENSP00000425882.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000503997.5Link to Ensembl Protein Viewer:ENSP00000425882.1Re-query CCDS DB by Nucleotide ID:ENST00000503997Re-query CCDS DB by Protein ID:ENSP00000425882
Original member Current member EBI ENST00000539387.5 ENSP00000439882.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539387.5Link to Ensembl Protein Viewer:ENSP00000439882.1Re-query CCDS DB by Nucleotide ID:ENST00000539387Re-query CCDS DB by Protein ID:ENSP00000439882
Original member Current member EBI ENST00000539002.5 ENSP00000440133.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539002.5Link to Ensembl Protein Viewer:ENSP00000440133.1Re-query CCDS DB by Nucleotide ID:ENST00000539002Re-query CCDS DB by Protein ID:ENSP00000440133
Original member Current member EBI ENST00000544855.5 ENSP00000441126.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000544855.5Link to Ensembl Protein Viewer:ENSP00000441126.1Re-query CCDS DB by Nucleotide ID:ENST00000544855Re-query CCDS DB by Protein ID:ENSP00000441126
Original member Current member NCBI NM_001184986.1 NP_001171915.1 Accepted alive Link to Nucleotide Sequence:NM_001184986.1Link to Protein Sequence:NP_001171915.1Re-query CCDS DB by Nucleotide ID:NM_001184986Re-query CCDS DB by Protein ID:NP_001171915Link to BLAST:NP_001171915.1
Original member Current member NCBI NM_001184987.1 NP_001171916.1 Accepted alive Link to Nucleotide Sequence:NM_001184987.1Link to Protein Sequence:NP_001171916.1Re-query CCDS DB by Nucleotide ID:NM_001184987Re-query CCDS DB by Protein ID:NP_001171916Link to BLAST:NP_001171916.1
Original member Current member NCBI NM_001184988.1 NP_001171917.1 Accepted alive Link to Nucleotide Sequence:NM_001184988.1Link to Protein Sequence:NP_001171917.1Re-query CCDS DB by Nucleotide ID:NM_001184988Re-query CCDS DB by Protein ID:NP_001171917Link to BLAST:NP_001171917.1
Original member Current member NCBI NM_001184989.2 NP_001171918.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001184989.2Link to Protein Sequence:NP_001171918.1Re-query CCDS DB by Nucleotide ID:NM_001184989Re-query CCDS DB by Protein ID:NP_001171918Link to BLAST:NP_001171918.1
Original member Current member NCBI NM_001184990.1 NP_001171919.1 Accepted alive Link to Nucleotide Sequence:NM_001184990.1Link to Protein Sequence:NP_001171919.1Re-query CCDS DB by Nucleotide ID:NM_001184990Re-query CCDS DB by Protein ID:NP_001171919Link to BLAST:NP_001171919.1
Original member Current member NCBI NM_001184991.1 NP_001171920.1 Accepted alive Link to Nucleotide Sequence:NM_001184991.1Link to Protein Sequence:NP_001171920.1Re-query CCDS DB by Nucleotide ID:NM_001184991Re-query CCDS DB by Protein ID:NP_001171920Link to BLAST:NP_001171920.1
Original member Current member NCBI NM_002494.3 NP_002485.1 Accepted alive Link to Nucleotide Sequence:NM_002494.3Link to Protein Sequence:NP_002485.1Re-query CCDS DB by Nucleotide ID:NM_002494Re-query CCDS DB by Protein ID:NP_002485Link to BLAST:NP_002485.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171915.1 76 O43677 76 100% 0 0
NP_001171916.1 76 O43677 76 100% 0 0
NP_001171917.1 76 O43677 76 100% 0 0
NP_001171918.1 76 O43677 76 100% 0 0
NP_001171919.1 76 O43677 76 100% 0 0
NP_001171920.1 76 O43677 76 100% 0 0
NP_002485.1 76 O43677 76 100% 0 0

Chromosomal Locations for CCDS 3746.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 139292550 139292609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 139295043 139295146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 139295732 139295798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (231 nt):
ATGGCGCCGTCCGCCTTGCTGCGTCCCCTTTCCCGGCTGCTGGCCCCCGCCAGGCTCCCGAGCGGCCCTT
CA
GTGCGATCAAAGTTCTACGTGCGAGAGCCGCCGAATGCCAAACCTGACTGGCTGAAAGTTGGGTTCAC
C
TTGGGCACCACTGTCTTCTTGTGGATCTATCTCATCAAACAACACAATGAAGATATTTTAGAGTACAAA
AGA
AGAAATGGGCTGGAATAA


Translation (76 aa):
MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK
R
RNGLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser