NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12348.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12348.2 Public Homo sapiens 19 SMIM7 24 110 108 CCDS HistoryNCBI Gene:79086Re-query CCDS DB by CCDS ID:12348.2Re-query CCDS DB by GeneID:79086See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 12348.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000487416.7 ENSP00000417147.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000487416.7Link to Ensembl Protein Viewer:ENSP00000417147.1Re-query CCDS DB by Nucleotide ID:ENST00000487416Re-query CCDS DB by Protein ID:ENSP00000417147
Original member Current member EBI ENST00000481671.6 ENSP00000433833.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000481671.6Link to Ensembl Protein Viewer:ENSP00000433833.1Re-query CCDS DB by Nucleotide ID:ENST00000481671Re-query CCDS DB by Protein ID:ENSP00000433833
Original member Current member EBI ENST00000597781.5 ENSP00000469440.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000597781.5Link to Ensembl Protein Viewer:ENSP00000469440.1Re-query CCDS DB by Nucleotide ID:ENST00000597781Re-query CCDS DB by Protein ID:ENSP00000469440
Original member Current member EBI ENST00000599310.5 ENSP00000469918.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000599310.5Link to Ensembl Protein Viewer:ENSP00000469918.1Re-query CCDS DB by Nucleotide ID:ENST00000599310Re-query CCDS DB by Protein ID:ENSP00000469918
Original member Current member EBI ENST00000593409.5 ENSP00000469962.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000593409.5Link to Ensembl Protein Viewer:ENSP00000469962.1Re-query CCDS DB by Nucleotide ID:ENST00000593409Re-query CCDS DB by Protein ID:ENSP00000469962
Original member Current member EBI ENST00000593404.5 ENSP00000471355.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000593404.5Link to Ensembl Protein Viewer:ENSP00000471355.1Re-query CCDS DB by Nucleotide ID:ENST00000593404Re-query CCDS DB by Protein ID:ENSP00000471355
Original member Current member NCBI NM_024104.4 NP_077009.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_024104.4Link to Protein Sequence:NP_077009.2Re-query CCDS DB by Nucleotide ID:NM_024104Re-query CCDS DB by Protein ID:NP_077009Link to BLAST:NP_077009.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077009.2 75 Q9BQ49 75 100% 0 0

Chromosomal Locations for CCDS 12348.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 16647246 16647261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 16654035 16654125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 16659395 16659447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 16659959 16660000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 16660085 16660110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (228 nt):
ATGATCGGAGACATCCTGCTGTTCGGGACGTTGCTGATGAATGCCGGGGCGGTGCTGAACTTTAAGCTGA
AAAAGAAGGACACGCAGGGCTTTGGGGAGGAGTCCAGGGAGCCCAGCACAGGTGACAACATCCGGGAATT
CTTGCTGAGCCTCAGATACTTTCGAATCTTCATCGCCCTGTGGAACATCTTCATGATGTTCTGCATGATT
GTGCTGTTCGGCTCTTGA

Translation (75 aa):
MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI
VLFGS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH