NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3507.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3507.1 Public Homo sapiens 4 HOPX 24 110 108 CCDS HistoryNCBI Gene:84525Re-query CCDS DB by CCDS ID:3507.1Re-query CCDS DB by GeneID:84525See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3507.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000317745.11 ENSP00000315198.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000317745.11Link to Ensembl Protein Viewer:ENSP00000315198.7Re-query CCDS DB by Nucleotide ID:ENST00000317745Re-query CCDS DB by Protein ID:ENSP00000315198
Original member Current member EBI ENST00000337881.11 ENSP00000337330.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000337881.11Link to Ensembl Protein Viewer:ENSP00000337330.7Re-query CCDS DB by Nucleotide ID:ENST00000337881Re-query CCDS DB by Protein ID:ENSP00000337330
Original member Current member EBI ENST00000381255.7 ENSP00000370654.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381255.7Link to Ensembl Protein Viewer:ENSP00000370654.3Re-query CCDS DB by Nucleotide ID:ENST00000381255Re-query CCDS DB by Protein ID:ENSP00000370654
Original member Current member EBI ENST00000508121.2 ENSP00000422175.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508121.2Link to Ensembl Protein Viewer:ENSP00000422175.2Re-query CCDS DB by Nucleotide ID:ENST00000508121Re-query CCDS DB by Protein ID:ENSP00000422175
Original member Current member EBI ENST00000503639.7 ENSP00000424101.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000503639.7Link to Ensembl Protein Viewer:ENSP00000424101.2Re-query CCDS DB by Nucleotide ID:ENST00000503639Re-query CCDS DB by Protein ID:ENSP00000424101
Original member Current member EBI ENST00000556376.6 ENSP00000451794.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000556376.6Link to Ensembl Protein Viewer:ENSP00000451794.1Re-query CCDS DB by Nucleotide ID:ENST00000556376Re-query CCDS DB by Protein ID:ENSP00000451794
Original member Current member EBI ENST00000556614.6 ENSP00000452003.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000556614.6Link to Ensembl Protein Viewer:ENSP00000452003.1Re-query CCDS DB by Nucleotide ID:ENST00000556614Re-query CCDS DB by Protein ID:ENSP00000452003
Original member Current member EBI ENST00000555760.6 ENSP00000452098.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555760.6Link to Ensembl Protein Viewer:ENSP00000452098.1Re-query CCDS DB by Nucleotide ID:ENST00000555760Re-query CCDS DB by Protein ID:ENSP00000452098
Original member Current member EBI ENST00000553379.6 ENSP00000452340.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000553379.6Link to Ensembl Protein Viewer:ENSP00000452340.1Re-query CCDS DB by Nucleotide ID:ENST00000553379Re-query CCDS DB by Protein ID:ENSP00000452340
Original member Current member NCBI NM_001145459.2 NP_001138931.1 Accepted alive Link to Nucleotide Sequence:NM_001145459.2Link to Protein Sequence:NP_001138931.1Re-query CCDS DB by Nucleotide ID:NM_001145459Re-query CCDS DB by Protein ID:NP_001138931Link to BLAST:NP_001138931.1
Original member Current member NCBI NM_139211.5 NP_631957.1 Accepted alive Link to Nucleotide Sequence:NM_139211.5Link to Protein Sequence:NP_631957.1Re-query CCDS DB by Nucleotide ID:NM_139211Re-query CCDS DB by Protein ID:NP_631957Link to BLAST:NP_631957.1
Original member Current member NCBI NM_139212.4 NP_631958.1 Accepted alive Link to Nucleotide Sequence:NM_139212.4Link to Protein Sequence:NP_631958.1Re-query CCDS DB by Nucleotide ID:NM_139212Re-query CCDS DB by Protein ID:NP_631958Link to BLAST:NP_631958.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138931.1 73 Q9BPY8-1 73 100% 0 0
NP_631957.1 73 Q9BPY8-1 73 100% 0 0
NP_631958.1 73 Q9BPY8-1 73 100% 0 0

Chromosomal Locations for CCDS 3507.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 56648720 56648797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 56655857 56656000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (222 nt):
ATGTCGGCGGAGACCGCGAGCGGCCCCACAGAGGACCAGGTGGAAATCCTGGAGTACAACTTCAACAAGG
TCGACAAGCACCCGGATTCCACCACGCTGTGCCTCATCGCGGCCGAGGCAGGCCTTTCCGAGGAGGAGAC
CCAGAAATGGTTTAAGCAGCGCCTGGCAAAGTGGCGGCGCTCAGAAGGCCTGCCCTCAGAGTGCAGATCC
GTCACAGACTAA

Translation (73 aa):
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS
VTD


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH