NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 4, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS39049.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39049.1 Public Mus musculus 5 Ost4 23 108 98 CCDS HistoryNCBI Gene:67695Re-query CCDS DB by CCDS ID:39049.1Re-query CCDS DB by GeneID:67695See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39049.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000132034.4 ENSMUSP00000126221.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000132034.4Link to Ensembl Protein Viewer:ENSMUSP00000126221.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000132034Re-query CCDS DB by Protein ID:ENSMUSP00000126221
Original member Current member EBI ENSMUST00000132253.4 ENSMUSP00000128352.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000132253.4Link to Ensembl Protein Viewer:ENSMUSP00000128352.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000132253Re-query CCDS DB by Protein ID:ENSMUSP00000128352
Original member Current member NCBI NM_001134692.2 NP_001128164.1 Accepted alive Link to Nucleotide Sequence:NM_001134692.2Link to Protein Sequence:NP_001128164.1Re-query CCDS DB by Nucleotide ID:NM_001134692Re-query CCDS DB by Protein ID:NP_001128164Link to BLAST:NP_001128164.1
Original member Current member NCBI NM_024460.4 NP_077780.3 Accepted alive Link to Nucleotide Sequence:NM_024460.4Link to Protein Sequence:NP_077780.3Re-query CCDS DB by Nucleotide ID:NM_024460Re-query CCDS DB by Protein ID:NP_077780Link to BLAST:NP_077780.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001128164.1 37 Q99LX8 37 100% 0 0
NP_077780.3 37 Q99LX8 37 100% 0 0

Chromosomal Locations for CCDS 39049.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 30907422 30907535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (114 nt):
ATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCC
TC
TATCACTACGTGGCAGTAAACAACCCCAAGAAGCAGGAATGA


Translation (37 aa):
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser